BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001L08

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599227.1|  PREDICTED: cullin-4                                275   7e-113   Nicotiana tomentosiformis
ref|XP_006361548.1|  PREDICTED: cullin-4-like                           274   3e-112   Solanum tuberosum [potatoes]
ref|XP_009759464.1|  PREDICTED: cullin-4                                273   3e-112   Nicotiana sylvestris
ref|NP_001234356.1|  cullin 4                                           273   4e-112   
gb|EYU43260.1|  hypothetical protein MIMGU_mgv1a001310mg                270   2e-110   Erythranthe guttata [common monkey flower]
ref|XP_006467459.1|  PREDICTED: cullin-4-like isoform X1                267   3e-110   Citrus sinensis [apfelsine]
gb|KDO78193.1|  hypothetical protein CISIN_1g003648mg                   266   3e-110   Citrus sinensis [apfelsine]
gb|KDO78194.1|  hypothetical protein CISIN_1g003648mg                   266   5e-110   Citrus sinensis [apfelsine]
ref|XP_011096567.1|  PREDICTED: cullin-4-like                           266   5e-110   Sesamum indicum [beniseed]
ref|XP_006467460.1|  PREDICTED: cullin-4-like isoform X2                266   5e-110   
ref|XP_010666663.1|  PREDICTED: cullin-4                                266   6e-110   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN47328.1|  Cullin-4                                                266   6e-110   Glycine soja [wild soybean]
ref|XP_008225565.1|  PREDICTED: cullin-4                                266   6e-110   Prunus mume [ume]
ref|XP_003524860.1|  PREDICTED: cullin-4-like                           267   6e-110   Glycine max [soybeans]
ref|XP_007214632.1|  hypothetical protein PRUPE_ppa001433mg             266   7e-110   Prunus persica
ref|XP_008444359.1|  PREDICTED: cullin-4                                266   7e-110   Cucumis melo [Oriental melon]
gb|KHN46079.1|  Cullin-4                                                266   8e-110   Glycine soja [wild soybean]
gb|KDP37982.1|  hypothetical protein JCGZ_04625                         267   9e-110   Jatropha curcas
gb|KJB66935.1|  hypothetical protein B456_010G166800                    264   2e-109   Gossypium raimondii
gb|KGN65537.1|  hypothetical protein Csa_1G435820                       264   2e-109   Cucumis sativus [cucumbers]
ref|XP_004149667.1|  PREDICTED: cullin-4-like                           263   3e-109   Cucumis sativus [cucumbers]
ref|XP_011085242.1|  PREDICTED: cullin-4                                263   3e-109   
gb|KJB66937.1|  hypothetical protein B456_010G166800                    263   3e-109   Gossypium raimondii
ref|XP_010274939.1|  PREDICTED: cullin-4-like                           263   3e-109   Nelumbo nucifera [Indian lotus]
ref|XP_007025064.1|  Cullin-4B isoform 1                                263   3e-109   
ref|XP_006377604.1|  hypothetical protein POPTR_0011s08280g             263   3e-109   Populus trichocarpa [western balsam poplar]
gb|KHN12460.1|  Cullin-4                                                264   3e-109   Glycine soja [wild soybean]
gb|KHN06973.1|  Cullin-4                                                263   4e-109   Glycine soja [wild soybean]
ref|XP_003532695.2|  PREDICTED: cullin-4-like isoform X1                264   4e-109   Glycine max [soybeans]
ref|XP_011013417.1|  PREDICTED: cullin-4-like                           263   4e-109   Populus euphratica
ref|XP_010941311.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      262   5e-109   Elaeis guineensis
ref|XP_004162809.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      263   5e-109   
ref|XP_003546083.1|  PREDICTED: cullin-4-like                           263   6e-109   Glycine max [soybeans]
ref|XP_011011308.1|  PREDICTED: cullin-4-like isoform X1                262   9e-109   Populus euphratica
ref|XP_010247870.1|  PREDICTED: cullin-4-like isoform X1                260   1e-108   Nelumbo nucifera [Indian lotus]
emb|CBI30911.3|  unnamed protein product                                262   1e-108   Vitis vinifera
ref|XP_002270764.2|  PREDICTED: cullin-4                                262   1e-108   Vitis vinifera
ref|XP_007147910.1|  hypothetical protein PHAVU_006G165300g             261   1e-108   Phaseolus vulgaris [French bean]
ref|XP_008787804.1|  PREDICTED: cullin-4-like isoform X2                265   2e-108   Phoenix dactylifera
ref|XP_002305340.2|  hypothetical protein POPTR_0004s14020g             261   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_011460204.1|  PREDICTED: cullin-4                                264   2e-108   Fragaria vesca subsp. vesca
ref|XP_008371761.1|  PREDICTED: cullin-4                                261   2e-108   
ref|XP_010110959.1|  hypothetical protein L484_021653                   261   3e-108   
ref|XP_010923713.1|  PREDICTED: cullin-4-like isoform X2                259   5e-108   Elaeis guineensis
ref|XP_010056896.1|  PREDICTED: cullin-4                                259   5e-108   Eucalyptus grandis [rose gum]
ref|XP_003593912.1|  Cullin                                             260   6e-108   Medicago truncatula
gb|KJB69827.1|  hypothetical protein B456_011G044900                    260   6e-108   Gossypium raimondii
ref|XP_003593911.1|  Cullin                                             259   6e-108   
gb|KCW73810.1|  hypothetical protein EUGRSUZ_E02414                     259   7e-108   Eucalyptus grandis [rose gum]
ref|XP_006352972.1|  PREDICTED: cullin-4-like                           263   1e-107   Solanum tuberosum [potatoes]
ref|XP_008809585.1|  PREDICTED: cullin-4-like                           258   2e-107   
ref|XP_009398338.1|  PREDICTED: cullin-4-like                           257   2e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009360892.1|  PREDICTED: cullin-4                                257   3e-107   Pyrus x bretschneideri [bai li]
gb|KCW73811.1|  hypothetical protein EUGRSUZ_E02414                     257   3e-107   Eucalyptus grandis [rose gum]
ref|XP_004981510.1|  PREDICTED: cullin-4-like isoform X2                258   4e-107   Setaria italica
gb|KHG21020.1|  Cullin-4 -like protein                                  256   6e-107   Gossypium arboreum [tree cotton]
gb|KJB68318.1|  hypothetical protein B456_010G238300                    256   6e-107   Gossypium raimondii
gb|KJB68316.1|  hypothetical protein B456_010G238300                    256   6e-107   Gossypium raimondii
gb|EEC76292.1|  hypothetical protein OsI_13805                          259   7e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_006650698.1|  PREDICTED: cullin-4-like                           259   9e-107   Oryza brachyantha
gb|AAT75245.1|  putative cullin protein                                 258   9e-107   Oryza sativa Japonica Group [Japonica rice]
gb|KJB68317.1|  hypothetical protein B456_010G238300                    255   1e-106   Gossypium raimondii
gb|EEE60060.1|  hypothetical protein OsJ_12866                          258   1e-106   Oryza sativa Japonica Group [Japonica rice]
gb|ABF99238.1|  Cullin-4B, putative, expressed                          258   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644442.1|  PREDICTED: cullin-4                                257   2e-106   Zea mays [maize]
ref|XP_002466340.1|  hypothetical protein SORBIDRAFT_01g005920          257   2e-106   Sorghum bicolor [broomcorn]
ref|XP_004233125.1|  PREDICTED: cullin-4                                258   3e-106   Solanum lycopersicum
ref|XP_003558082.1|  PREDICTED: cullin-4                                255   4e-106   Brachypodium distachyon [annual false brome]
dbj|BAK02870.1|  predicted protein                                      254   6e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT18857.1|  Cullin-4B                                               254   6e-106   
ref|XP_008366025.1|  PREDICTED: cullin-4-like                           253   8e-106   
ref|XP_006449702.1|  hypothetical protein CICLE_v10014310mg             251   2e-105   Citrus clementina [clementine]
ref|XP_006449701.1|  hypothetical protein CICLE_v10014310mg             251   2e-105   
ref|XP_010518764.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      250   2e-105   Tarenaya hassleriana [spider flower]
ref|XP_006449704.1|  hypothetical protein CICLE_v10014310mg             251   2e-105   
ref|XP_004486019.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      250   5e-105   Cicer arietinum [garbanzo]
emb|CDX77644.1|  BnaC07g18980D                                          249   6e-105   
ref|XP_006398308.1|  hypothetical protein EUTSA_v10000782mg             249   9e-105   Eutrema salsugineum [saltwater cress]
ref|XP_009101534.1|  PREDICTED: cullin-4-like                           248   1e-104   Brassica rapa
emb|CDY33461.1|  BnaA06g36120D                                          248   1e-104   Brassica napus [oilseed rape]
emb|CDY03235.1|  BnaC09g19210D                                          249   1e-104   
gb|KFK31486.1|  cullin                                                  247   1e-104   Arabis alpina [alpine rockcress]
ref|XP_009114369.1|  PREDICTED: cullin-4-like                           248   1e-104   Brassica rapa
emb|CDY35152.1|  BnaA09g17890D                                          248   2e-104   Brassica napus [oilseed rape]
ref|XP_006836434.1|  hypothetical protein AMTR_s00092p00163840          248   2e-104   Amborella trichopoda
ref|XP_008787803.1|  PREDICTED: cullin-4-like isoform X1                251   3e-104   Phoenix dactylifera
emb|CAN75926.1|  hypothetical protein VITISV_010491                     247   3e-104   Vitis vinifera
emb|CAC85265.1|  cullin 4                                               246   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923712.1|  PREDICTED: cullin-4-like isoform X1                245   8e-104   Elaeis guineensis
gb|AAM14063.1|  putative cullin                                         246   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568658.1|  cullin4                                               246   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408525.1|  PREDICTED: cullin-4-like                           248   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009128848.1|  PREDICTED: cullin-4                                244   2e-103   Brassica rapa
emb|CDX87735.1|  BnaC02g32140D                                          244   2e-103   
emb|CDY43957.1|  BnaA02g24350D                                          244   2e-103   Brassica napus [oilseed rape]
ref|XP_002984123.1|  ubiquitin-protein ligase, cullin 4                 247   2e-103   
ref|XP_002972211.1|  ubiquitin-protein ligase, Cullin 4                 247   2e-103   
ref|XP_002863417.1|  hypothetical protein ARALYDRAFT_916814             244   3e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_006281916.1|  hypothetical protein CARUB_v10028121mg             244   5e-103   Capsella rubella
ref|XP_006414121.1|  hypothetical protein EUTSA_v10024458mg             247   1e-102   Eutrema salsugineum [saltwater cress]
ref|XP_001776334.1|  predicted protein                                  241   3e-102   
ref|XP_010441611.1|  PREDICTED: cullin-4                                240   5e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010529158.1|  PREDICTED: cullin-4                                253   1e-101   Tarenaya hassleriana [spider flower]
gb|KDO78190.1|  hypothetical protein CISIN_1g003648mg                   238   2e-101   Citrus sinensis [apfelsine]
ref|XP_006585082.1|  PREDICTED: cullin-4-like isoform X2                233   4e-100   Glycine max [soybeans]
gb|KFK28509.1|  cullin 4                                                238   2e-99    Arabis alpina [alpine rockcress]
gb|KHG10035.1|  Cullin-4 -like protein                                  264   3e-99    Gossypium arboreum [tree cotton]
ref|XP_001764780.1|  predicted protein                                  230   2e-95    
dbj|BAB08502.1|  cullin                                                 217   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484784.1|  PREDICTED: cullin-4-like                           196   1e-88    Camelina sativa [gold-of-pleasure]
gb|KDO78191.1|  hypothetical protein CISIN_1g003648mg                   267   3e-88    Citrus sinensis [apfelsine]
ref|XP_002519675.1|  cullin, putative                                   264   7e-88    
gb|KJB66936.1|  hypothetical protein B456_010G166800                    264   4e-87    Gossypium raimondii
gb|KJB69828.1|  hypothetical protein B456_011G044900                    261   1e-85    Gossypium raimondii
ref|XP_003593913.1|  Cullin                                             260   2e-85    
ref|XP_004981509.1|  PREDICTED: cullin-4-like isoform X1                258   2e-85    
gb|KJB68319.1|  hypothetical protein B456_010G238300                    256   1e-84    Gossypium raimondii
ref|XP_006449703.1|  hypothetical protein CICLE_v10014310mg             251   1e-83    
ref|XP_006449705.1|  hypothetical protein CICLE_v10014310mg             251   2e-83    
ref|XP_005644988.1|  Cullin-domain-containing protein                   209   4e-83    Coccomyxa subellipsoidea C-169
ref|XP_006003900.1|  PREDICTED: cullin-4B                               196   3e-82    Latimeria chalumnae
gb|EGW01006.1|  Cullin-4B                                               197   3e-82    Cricetulus griseus [Chinese hamsters]
ref|XP_007610124.1|  PREDICTED: cullin-4B isoform X2                    197   4e-82    
ref|XP_007647173.1|  PREDICTED: cullin-4B isoform X1                    197   4e-82    Cricetulus griseus [Chinese hamsters]
ref|XP_003774810.1|  PREDICTED: cullin-4B                               198   6e-82    Sarcophilus harrisii
gb|ELK27187.1|  Cullin-4B                                               196   7e-82    Myotis davidii
ref|XP_009088610.1|  PREDICTED: cullin-4B                               196   8e-82    Serinus canaria [canary]
gb|EPQ19199.1|  Cullin-4B                                               196   9e-82    Myotis brandtii
ref|XP_005413716.1|  PREDICTED: cullin-4B isoform X4                    196   9e-82    Chinchilla lanigera
ref|XP_006144939.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          196   9e-82    Tupaia chinensis
ref|XP_006877534.1|  PREDICTED: cullin-4B isoform X1                    196   9e-82    Chrysochloris asiatica
ref|XP_004587715.1|  PREDICTED: cullin-4B                               196   1e-81    Ochotona princeps [southern American pika]
ref|XP_005884739.1|  PREDICTED: cullin-4B                               196   1e-81    
gb|EAX11878.1|  cullin 4B, isoform CRA_c                                196   1e-81    Homo sapiens [man]
ref|XP_005413714.1|  PREDICTED: cullin-4B isoform X2                    196   1e-81    Chinchilla lanigera
ref|XP_003797087.1|  PREDICTED: cullin-4B-like                          196   1e-81    
ref|XP_006082210.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Myotis lucifugus
ref|XP_006082211.1|  PREDICTED: cullin-4B isoform X2                    196   1e-81    Myotis lucifugus
ref|NP_001100421.1|  cullin-4B                                          196   1e-81    Rattus norvegicus [brown rat]
gb|AAK16812.1|AF212995_1  cullin CUL4B                                  196   1e-81    Homo sapiens [man]
ref|XP_005262538.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    
ref|NP_003579.3|  cullin-4B isoform 1                                   196   1e-81    Homo sapiens [man]
ref|XP_005413713.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Chinchilla lanigera
ref|XP_010287736.1|  PREDICTED: cullin-4B                               196   1e-81    Phaethon lepturus
ref|XP_004762115.1|  PREDICTED: cullin-4B isoform X2                    196   1e-81    
ref|XP_008832150.1|  PREDICTED: cullin-4B                               196   1e-81    
ref|XP_005358493.1|  PREDICTED: cullin-4B                               196   1e-81    
ref|XP_009196468.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Papio anubis [baboon]
ref|NP_001103612.1|  cullin-4B                                          196   1e-81    Mus musculus [mouse]
ref|XP_008154341.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    
ref|XP_006746270.1|  PREDICTED: cullin-4B                               196   1e-81    Leptonychotes weddellii
ref|XP_006981625.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    
gb|ELK07572.1|  Cullin-4B                                               196   1e-81    Pteropus alecto
ref|XP_001086195.1|  PREDICTED: cullin-4B isoform 1                     196   1e-81    Macaca mulatta [rhesus macaque]
ref|XP_005413715.1|  PREDICTED: cullin-4B isoform X3                    196   1e-81    Chinchilla lanigera
ref|XP_004762116.1|  PREDICTED: cullin-4B isoform X3                    196   1e-81    Mustela putorius furo [black ferret]
ref|XP_003262326.2|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B is...    196   1e-81    
ref|XP_004899937.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          196   1e-81    
ref|XP_002720454.2|  PREDICTED: cullin-4B isoform X2                    196   1e-81    Oryctolagus cuniculus [domestic rabbit]
ref|XP_005594545.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          196   1e-81    
dbj|BAA31670.2|  KIAA0695 protein                                       196   1e-81    Homo sapiens [man]
ref|XP_008974985.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Pan paniscus [bonobo]
ref|XP_004762114.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Mustela putorius furo [black ferret]
ref|XP_864628.3|  PREDICTED: cullin-4B isoform 3                        196   1e-81    
ref|XP_006191372.1|  PREDICTED: cullin-4B-like isoform X1               196   1e-81    Camelus ferus
ref|XP_006191373.1|  PREDICTED: cullin-4B-like isoform X2               196   1e-81    Camelus ferus
ref|XP_011277733.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Felis catus [cat]
ref|XP_011277734.1|  PREDICTED: cullin-4B isoform X2                    196   1e-81    Felis catus [cat]
ref|XP_006082213.1|  PREDICTED: cullin-4B isoform X4                    196   1e-81    
ref|XP_011376545.1|  PREDICTED: cullin-4B isoform X2                    196   1e-81    
ref|NP_001041617.1|  cullin-4B                                          196   1e-81    Felis catus [cat]
ref|XP_008271384.1|  PREDICTED: cullin-4B isoform X5                    196   1e-81    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008017652.1|  PREDICTED: cullin-4B isoform X5                    196   1e-81    Chlorocebus sabaeus
ref|XP_011227401.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Ailuropoda melanoleuca
ref|XP_004685823.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    
ref|XP_004762117.1|  PREDICTED: cullin-4B isoform X4                    196   1e-81    Mustela putorius furo [black ferret]
ref|XP_006257551.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Rattus norvegicus [brown rat]
ref|XP_007122105.1|  PREDICTED: cullin-4B-like isoform X1               196   1e-81    Physeter catodon
ref|XP_006082212.1|  PREDICTED: cullin-4B isoform X3                    196   1e-81    
ref|XP_010819678.1|  PREDICTED: cullin-4B isoform X5                    196   1e-81    
ref|XP_008271380.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    Oryctolagus cuniculus [domestic rabbit]
ref|XP_011227402.1|  PREDICTED: cullin-4B isoform X2                    196   1e-81    Ailuropoda melanoleuca
gb|KFQ77299.1|  Cullin-4B                                               196   1e-81    Phaethon lepturus
ref|XP_008988096.1|  PREDICTED: cullin-4B isoform X4                    196   1e-81    Callithrix jacchus [common marmoset]
ref|XP_008988093.1|  PREDICTED: cullin-4B isoform X1                    196   1e-81    
ref|XP_008017651.1|  PREDICTED: cullin-4B isoform X4                    196   1e-81    Chlorocebus sabaeus
ref|XP_008585583.1|  PREDICTED: cullin-4B isoform X1                    196   2e-81    Galeopterus variegatus [Malayan flying lemur]
ref|XP_007076302.1|  PREDICTED: cullin-4B isoform X2                    196   2e-81    Panthera tigris altaica
ref|XP_008271382.1|  PREDICTED: cullin-4B isoform X3                    196   2e-81    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004647716.1|  PREDICTED: cullin-4B                               196   2e-81    
ref|XP_011376543.1|  PREDICTED: cullin-4B isoform X1                    196   2e-81    Pteropus vampyrus
ref|XP_007076301.1|  PREDICTED: cullin-4B isoform X1                    196   2e-81    Panthera tigris altaica
ref|XP_007076303.1|  PREDICTED: cullin-4B isoform X3                    196   2e-81    Panthera tigris altaica
ref|XP_006981626.1|  PREDICTED: cullin-4B isoform X2                    196   2e-81    
ref|XP_008988094.1|  PREDICTED: cullin-4B isoform X2                    196   2e-81    Callithrix jacchus [common marmoset]
ref|XP_006724847.1|  PREDICTED: cullin-4B isoform X2                    196   2e-81    
ref|XP_005319406.1|  PREDICTED: cullin-4B isoform X1                    196   2e-81    Ictidomys tridecemlineatus
ref|XP_008271383.1|  PREDICTED: cullin-4B isoform X4                    196   2e-81    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010627872.1|  PREDICTED: cullin-4B isoform X1                    196   2e-81    Fukomys damarensis [Damara mole rat]
ref|XP_004406978.1|  PREDICTED: cullin-4B                               195   2e-81    
ref|XP_004874660.1|  PREDICTED: cullin-4B isoform X2                    196   2e-81    
ref|XP_008585584.1|  PREDICTED: cullin-4B isoform X2                    196   2e-81    Galeopterus variegatus [Malayan flying lemur]
ref|XP_005673911.1|  PREDICTED: cullin-4B                               195   2e-81    
ref|XP_008017648.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    Chlorocebus sabaeus
ref|XP_004606393.1|  PREDICTED: cullin-4B isoform X1                    196   2e-81    
ref|XP_004478393.1|  PREDICTED: cullin-4B                               196   2e-81    
ref|XP_006724848.1|  PREDICTED: cullin-4B isoform X3                    195   2e-81    
emb|CAD97843.1|  hypothetical protein                                   195   2e-81    Homo sapiens [man]
gb|EFB16493.1|  hypothetical protein PANDA_011593                       195   2e-81    Ailuropoda melanoleuca
ref|XP_004437389.1|  PREDICTED: cullin-4B                               196   2e-81    
ref|XP_010819677.1|  PREDICTED: cullin-4B isoform X3                    195   2e-81    Bos taurus [bovine]
ref|NP_001073341.1|  cullin-4B isoform 2                                195   2e-81    Homo sapiens [man]
ref|XP_008988095.1|  PREDICTED: cullin-4B isoform X3                    195   2e-81    
ref|XP_008538115.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    Equus przewalskii [Przewalski horse]
ref|XP_010210224.1|  PREDICTED: cullin-4B                               195   2e-81    Tinamus guttatus
ref|XP_008070821.1|  PREDICTED: cullin-4B                               195   2e-81    Carlito syrichta
ref|XP_008017649.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    Chlorocebus sabaeus
ref|XP_007530424.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    Erinaceus europaeus [common hedgehog]
ref|XP_004874659.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    
ref|XP_008538116.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    Equus przewalskii [Przewalski horse]
ref|XP_005227530.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    
dbj|BAB28222.2|  unnamed protein product                                195   2e-81    Mus musculus [mouse]
ref|XP_008017653.1|  PREDICTED: cullin-4B isoform X6                    195   2e-81    Chlorocebus sabaeus
ref|XP_004285634.1|  PREDICTED: cullin-4B isoform 1                     195   2e-81    Orcinus orca [Orca]
ref|XP_004379637.1|  PREDICTED: cullin-4B isoform 1                     195   2e-81    
ref|XP_010627873.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    Fukomys damarensis [Damara mole rat]
ref|XP_006048866.1|  PREDICTED: cullin-4B isoform X3                    195   2e-81    Bubalus bubalis [domestic water buffalo]
ref|XP_006767871.1|  PREDICTED: cullin-4B                               195   2e-81    Myotis davidii
ref|XP_002699556.2|  PREDICTED: cullin-4B isoform X4                    195   2e-81    Bos taurus [bovine]
ref|XP_006048867.1|  PREDICTED: cullin-4B isoform X4                    195   2e-81    Bubalus bubalis [domestic water buffalo]
ref|XP_006048864.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    Bubalus bubalis [domestic water buffalo]
ref|XP_006917880.1|  PREDICTED: cullin-4B                               195   2e-81    
ref|XP_006885130.1|  PREDICTED: cullin-4B-like isoform X1               195   2e-81    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007122106.1|  PREDICTED: cullin-4B-like isoform X2               195   2e-81    
dbj|BAK62681.1|  cullin-4B                                              195   2e-81    Pan troglodytes
ref|XP_011376546.1|  PREDICTED: cullin-4B isoform X3                    195   2e-81    
dbj|BAG53936.1|  unnamed protein product                                195   2e-81    Homo sapiens [man]
ref|XP_004606394.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    Sorex araneus [Eurasian shrew]
ref|XP_003465638.1|  PREDICTED: cullin-4B                               195   2e-81    
ref|XP_007060188.1|  PREDICTED: cullin-4B                               195   2e-81    Chelonia mydas [green seaturtle]
ref|NP_001116316.1|  cullin-4B                                          195   2e-81    Danio rerio [leopard danio]
gb|AAB67315.1|  Very similar and perhaps identical to Hs-CUL-4B.;...    195   2e-81    Homo sapiens [man]
gb|AAC50548.1|  Hs-CUL-4B                                               195   2e-81    Homo sapiens [man]
ref|XP_008171287.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    Chrysemys picta bellii
ref|XP_010592962.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    Loxodonta africana [African bush elephant]
gb|AAH36216.1|  Cullin 4B                                               195   2e-81    Homo sapiens [man]
ref|XP_006632966.1|  PREDICTED: cullin-4B-like                          195   2e-81    
ref|XP_006215961.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    
ref|XP_420335.2|  PREDICTED: cullin-4B                                  195   2e-81    Gallus gallus [bantam]
pdb|4A0L|E  Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A...    195   2e-81    Homo sapiens [man]
ref|XP_005700400.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    
ref|XP_010798617.1|  PREDICTED: cullin-4B isoform X1                    195   2e-81    
ref|XP_006028559.1|  PREDICTED: cullin-4B                               195   2e-81    Alligator sinensis
ref|XP_006260081.1|  PREDICTED: cullin-4B                               195   2e-81    
ref|XP_005307468.2|  PREDICTED: cullin-4B isoform X1                    195   2e-81    Chrysemys picta bellii
gb|KFO30994.1|  Cullin-4B                                               195   2e-81    Fukomys damarensis [Damara mole rat]
pdb|4A0C|C  Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex          195   2e-81    Mus musculus [mouse]
ref|XP_006215962.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    Vicugna pacos
ref|XP_003414815.1|  PREDICTED: cullin-4B isoform X2                    195   2e-81    
ref|XP_003208504.1|  PREDICTED: cullin-4B                               195   2e-81    Meleagris gallopavo [common turkey]
dbj|BAE36141.1|  unnamed protein product                                195   2e-81    Mus musculus [mouse]
gb|EAX11876.1|  cullin 4B, isoform CRA_a                                195   2e-81    Homo sapiens [man]
ref|XP_010206238.1|  PREDICTED: cullin-4B                               195   2e-81    Colius striatus
gb|KFW05399.1|  Cullin-4B                                               195   2e-81    Eurypyga helias
ref|XP_004022402.1|  PREDICTED: cullin-4B isoform 1                     195   3e-81    
ref|XP_005504485.1|  PREDICTED: cullin-4B                               195   3e-81    Columba livia [carrier pigeon]
ref|XP_003365917.2|  PREDICTED: cullin-4B                               195   3e-81    
ref|XP_008154342.1|  PREDICTED: cullin-4B isoform X2                    195   3e-81    Eptesicus fuscus
ref|XP_006877535.1|  PREDICTED: cullin-4B isoform X2                    195   3e-81    Chrysochloris asiatica
ref|XP_001510185.3|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_006115461.1|  PREDICTED: cullin-4B                               194   3e-81    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007530425.1|  PREDICTED: cullin-4B isoform X2                    195   3e-81    Erinaceus europaeus [common hedgehog]
ref|XP_002196531.1|  PREDICTED: cullin-4B                               195   3e-81    Taeniopygia guttata
ref|XP_005484500.1|  PREDICTED: cullin-4B                               195   3e-81    Zonotrichia albicollis
ref|XP_004285635.1|  PREDICTED: cullin-4B isoform 2                     195   3e-81    Orcinus orca [Orca]
ref|XP_009899852.1|  PREDICTED: cullin-4B                               195   3e-81    Picoides pubescens
ref|XP_008491853.1|  PREDICTED: cullin-4B                               195   3e-81    Calypte anna
ref|XP_010139394.1|  PREDICTED: cullin-4B                               195   3e-81    Buceros rhinoceros silvestris
ref|XP_009564621.1|  PREDICTED: cullin-4B                               195   3e-81    Cuculus canorus
ref|XP_006885131.1|  PREDICTED: cullin-4B-like isoform X2               195   3e-81    
ref|XP_004685824.1|  PREDICTED: cullin-4B isoform X2                    195   3e-81    
ref|XP_009887578.1|  PREDICTED: cullin-4B                               195   3e-81    
ref|XP_005432498.1|  PREDICTED: cullin-4B                               195   3e-81    
ref|XP_005148357.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_008638702.1|  PREDICTED: cullin-4B                               195   3e-81    
ref|XP_009670270.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_009981623.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_010150094.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_008935860.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_004379638.1|  PREDICTED: cullin-4B isoform 2                     195   3e-81    
gb|EMC88699.1|  Cullin-4B                                               195   3e-81    
ref|XP_009196472.1|  PREDICTED: cullin-4B isoform X5                    195   3e-81    
gb|EAX11877.1|  cullin 4B, isoform CRA_b                                195   3e-81    
ref|XP_005045907.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_009968477.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_010020149.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_009871272.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_009578947.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_009487693.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_009273579.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_010162624.1|  PREDICTED: cullin-4B                               194   3e-81    
ref|XP_005241130.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          194   3e-81    
ref|XP_009073198.1|  PREDICTED: cullin-4B                               194   3e-81    
gb|KFP13940.1|  Cullin-4B                                               194   3e-81    
ref|XP_009915406.1|  PREDICTED: cullin-4B isoform X1                    194   3e-81    
gb|KFP00724.1|  Cullin-4B                                               194   3e-81    
gb|KGL72508.1|  Cullin-4B                                               194   3e-81    
gb|KFO64284.1|  Cullin-4B                                               194   3e-81    
ref|XP_004022403.1|  PREDICTED: cullin-4B isoform 2                     195   3e-81    
gb|KFW86599.1|  Cullin-4B                                               194   3e-81    
gb|ELR59400.1|  Cullin-4B                                               195   3e-81    
gb|KFQ64788.1|  Cullin-4B                                               194   3e-81    
gb|KFV68186.1|  Cullin-4B                                               194   3e-81    
gb|KFV93759.1|  Cullin-4B                                               194   3e-81    
gb|KFP90614.1|  Cullin-4B                                               194   3e-81    
gb|KFP57528.1|  Cullin-4B                                               194   3e-81    
gb|KFM04851.1|  Cullin-4B                                               194   3e-81    
gb|KFO92809.1|  Cullin-4B                                               194   3e-81    
ref|XP_003584977.2|  PREDICTED: cullin-4B-like                          194   3e-81    
ref|XP_008988097.1|  PREDICTED: cullin-4B isoform X5                    194   3e-81    
gb|AAH04026.1|  Cul4b protein                                           194   3e-81    
gb|AAR13073.1|  cullin 4B                                               194   3e-81    
ref|XP_005022179.1|  PREDICTED: cullin-4B                               194   3e-81    
gb|KFQ02433.1|  Cullin-4B                                               194   3e-81    
gb|KFV04835.1|  Cullin-4B                                               194   4e-81    
gb|KFZ62825.1|  Cullin-4B                                               194   4e-81    
gb|KFQ18028.1|  Cullin-4B                                               194   4e-81    
ref|XP_008017654.1|  PREDICTED: cullin-4B isoform X7                    195   4e-81    
gb|KFU89258.1|  Cullin-4B                                               194   4e-81    
gb|KFR04226.1|  Cullin-4B                                               194   4e-81    
ref|XP_009956705.1|  PREDICTED: cullin-4B                               194   4e-81    
gb|AAH10347.1|  Cul4b protein                                           194   4e-81    
ref|XP_009943501.1|  PREDICTED: cullin-4B                               194   4e-81    
ref|XP_010073509.1|  PREDICTED: cullin-4B                               194   4e-81    
ref|XP_005319407.1|  PREDICTED: cullin-4B isoform X2                    194   4e-81    
gb|KFQ89647.1|  Cullin-4B                                               194   4e-81    
gb|KFQ56289.1|  Cullin-4B                                               194   4e-81    
gb|KFP38487.1|  Cullin-4B                                               194   4e-81    
gb|KFO06527.1|  Cullin-4B                                               194   4e-81    
gb|KFV55551.1|  Cullin-4B                                               194   4e-81    
ref|XP_009506519.1|  PREDICTED: cullin-4B                               194   4e-81    
gb|KFV79701.1|  Cullin-4B                                               194   4e-81    
gb|KFZ46418.1|  Cullin-4B                                               194   4e-81    
ref|XP_010185411.1|  PREDICTED: cullin-4B                               194   4e-81    
ref|XP_009995422.1|  PREDICTED: cullin-4B                               194   4e-81    
ref|XP_009915407.1|  PREDICTED: cullin-4B isoform X2                    194   4e-81    
gb|KGL96725.1|  Cullin-4B                                               194   4e-81    
ref|XP_003229259.1|  PREDICTED: cullin-4B                               194   4e-81    
gb|KFP80278.1|  Cullin-4B                                               194   5e-81    
gb|KFQ15708.1|  Cullin-4B                                               194   5e-81    
ref|XP_007507207.1|  PREDICTED: cullin-4B isoform X4                    195   5e-81    
dbj|BAC27992.1|  unnamed protein product                                195   5e-81    
ref|XP_007507205.1|  PREDICTED: cullin-4B isoform X2                    195   5e-81    
gb|KFV08408.1|  Cullin-4B                                               194   5e-81    
ref|XP_007507204.1|  PREDICTED: cullin-4B isoform X1                    195   5e-81    
ref|XP_007507206.1|  PREDICTED: cullin-4B isoform X3                    195   6e-81    
gb|KFQ37918.1|  Cullin-4B                                               194   6e-81    
gb|KFW96883.1|  Cullin-4B                                               194   6e-81    
ref|XP_007436244.1|  PREDICTED: cullin-4B                               195   6e-81    
ref|XP_010962238.1|  PREDICTED: cullin-4B                               193   7e-81    
ref|XP_007254497.1|  PREDICTED: cullin-4B-like                          193   1e-80    
dbj|BAC41443.3|  mKIAA0695 protein                                      195   2e-80    
ref|XP_004713104.1|  PREDICTED: cullin-4B isoform X1                    191   3e-80    
ref|XP_004713105.1|  PREDICTED: cullin-4B isoform X2                    191   3e-80    
ref|XP_010730305.1|  PREDICTED: cullin-4B                               192   3e-80    
ref|XP_008707988.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          196   4e-80    
ref|XP_004713106.1|  PREDICTED: cullin-4B isoform X3                    191   6e-80    
ref|XP_010894682.1|  PREDICTED: cullin-4B isoform X3                    191   9e-80    
ref|XP_005799582.1|  PREDICTED: cullin-4B-like                          194   1e-79    
gb|ERL94806.1|  hypothetical protein D910_12080                         194   1e-79    
emb|CDQ70188.1|  unnamed protein product                                191   2e-79    
gb|ENN80292.1|  hypothetical protein YQE_03285                          194   2e-79    
ref|XP_003970600.1|  PREDICTED: cullin-4B-like                          192   3e-79    
ref|XP_010894673.1|  PREDICTED: cullin-4B isoform X2                    190   3e-79    
ref|XP_010894664.1|  PREDICTED: cullin-4B isoform X1                    190   3e-79    
ref|XP_008418856.1|  PREDICTED: cullin-4B                               192   3e-79    
ref|XP_007569758.1|  PREDICTED: cullin-4B                               192   3e-79    
ref|XP_006803308.1|  PREDICTED: cullin-4B-like                          192   4e-79    
ref|XP_010764721.1|  PREDICTED: cullin-4B                               189   4e-79    
ref|XP_003445252.1|  PREDICTED: cullin-4B                               192   5e-79    
ref|XP_007891612.1|  PREDICTED: cullin-4B                               191   5e-79    
ref|XP_004545810.1|  PREDICTED: cullin-4B-like                          192   6e-79    
ref|XP_005913219.1|  PREDICTED: cullin-4B-like                          192   7e-79    
ref|XP_003397436.1|  PREDICTED: cullin-4B-like                          193   7e-79    
ref|XP_392800.3|  PREDICTED: cullin-4B-like                             193   7e-79    
ref|XP_003690323.1|  PREDICTED: cullin-4B-like                          193   8e-79    
ref|XP_010592318.1|  PREDICTED: cullin-4A isoform X1                    190   8e-79    
ref|XP_010592319.1|  PREDICTED: cullin-4A isoform X2                    190   8e-79    
ref|XP_008324704.1|  PREDICTED: cullin-4B                               191   9e-79    
ref|XP_001814199.1|  PREDICTED: cullin-4A                               194   9e-79    
ref|XP_002504743.1|  predicted protein                                  189   9e-79    
ref|XP_006752398.1|  PREDICTED: LOW QUALITY PROTEIN: cullin 4A          189   9e-79    
ref|XP_008274104.1|  PREDICTED: cullin-4B                               190   1e-78    
ref|XP_009644037.1|  PREDICTED: cullin-4A                               189   1e-78    
gb|KFP21637.1|  Cullin-4A                                               189   1e-78    
ref|XP_007940575.1|  PREDICTED: cullin-4A                               189   1e-78    
ref|XP_004704475.1|  PREDICTED: cullin-4A                               188   1e-78    
ref|XP_004383008.1|  PREDICTED: cullin-4A                               189   2e-78    
ref|XP_011351411.1|  PREDICTED: cullin-4A                               192   2e-78    
ref|NP_001090088.1|  cullin 4B                                          187   2e-78    
ref|XP_011504999.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A-like     193   2e-78    
gb|AAS21017.1|  cullin                                                  249   2e-78    
ref|XP_011146247.1|  PREDICTED: cullin-4A                               192   2e-78    
gb|ELK14877.1|  Cullin-4A                                               189   2e-78    
gb|AAI67417.1|  Unknown (protein for IMAGE:7555086)                     186   2e-78    
ref|NP_001120891.1|  cullin 4B                                          186   2e-78    
ref|XP_004823542.1|  PREDICTED: cullin-4A                               188   2e-78    
ref|XP_005516645.1|  PREDICTED: cullin-4A                               189   2e-78    
gb|AEB61292.1|  cullin-4A-like protein                                  188   2e-78    
ref|XP_003640577.1|  PREDICTED: cullin-4A isoform X1                    188   2e-78    
ref|XP_006909411.1|  PREDICTED: cullin-4A                               189   2e-78    
ref|XP_007075342.1|  PREDICTED: cullin-4A isoform X1                    188   2e-78    
ref|XP_849542.3|  PREDICTED: cullin-4A                                  189   2e-78    
ref|XP_007075343.1|  PREDICTED: cullin-4A isoform X2                    188   2e-78    
gb|KFM58691.1|  Cullin-4A                                               192   2e-78    
ref|XP_001603521.1|  PREDICTED: cullin-4A                               195   2e-78    
ref|XP_005037540.1|  PREDICTED: cullin-4A isoform X1                    188   2e-78    
ref|XP_004746221.1|  PREDICTED: cullin-4A                               188   2e-78    
ref|XP_005037542.1|  PREDICTED: cullin-4A isoform X3                    188   2e-78    
ref|XP_011478226.1|  PREDICTED: cullin-4B                               189   3e-78    
ref|XP_011258663.1|  PREDICTED: cullin-4A                               192   3e-78    
gb|EGI59840.1|  Cullin-4B                                               192   3e-78    
ref|XP_011279428.1|  PREDICTED: cullin-4A                               188   3e-78    
ref|XP_006851582.1|  PREDICTED: cullin-4A                               188   3e-78    
ref|XP_011063503.1|  PREDICTED: cullin-4A                               192   3e-78    
ref|XP_005037541.1|  PREDICTED: cullin-4A isoform X2                    188   3e-78    
ref|XP_005037543.1|  PREDICTED: cullin-4A isoform X4                    188   3e-78    
gb|EFN66773.1|  Cullin-4B                                               192   3e-78    
ref|XP_009914151.1|  PREDICTED: cullin-4A isoform X3                    188   3e-78    
ref|XP_004450824.1|  PREDICTED: cullin-4A                               188   3e-78    
ref|XP_007902268.1|  PREDICTED: cullin-4A isoform X1                    187   3e-78    
ref|XP_009988821.1|  PREDICTED: cullin-4A                               188   3e-78    
ref|XP_006102095.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          188   3e-78    
ref|XP_005488058.1|  PREDICTED: cullin-4A                               188   3e-78    
ref|XP_009914148.1|  PREDICTED: cullin-4A isoform X1                    187   3e-78    
ref|XP_008683174.1|  PREDICTED: cullin-4A                               188   4e-78    
ref|XP_010392614.1|  PREDICTED: cullin-4A isoform X1                    187   4e-78    
ref|XP_009914149.1|  PREDICTED: cullin-4A isoform X2                    187   4e-78    
ref|XP_010392615.1|  PREDICTED: cullin-4A isoform X2                    188   4e-78    
ref|XP_007902269.1|  PREDICTED: cullin-4A isoform X2                    187   4e-78    
gb|AAC50547.1|  Hs-CUL-4A                                               187   4e-78    
ref|XP_011168244.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          192   4e-78    
ref|XP_008924491.1|  PREDICTED: cullin-4A                               187   4e-78    
ref|XP_009083710.1|  PREDICTED: cullin-4A                               187   4e-78    
ref|XP_009190538.1|  PREDICTED: cullin-4A isoform X3                    187   4e-78    
ref|XP_005022013.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          188   4e-78    
ref|XP_005884540.1|  PREDICTED: cullin-4A                               188   4e-78    
dbj|BAG59294.1|  unnamed protein product                                187   4e-78    
ref|XP_010117727.1|  PREDICTED: cullin-4A                               187   4e-78    
ref|XP_009470947.1|  PREDICTED: cullin-4A                               187   4e-78    
ref|XP_009578999.1|  PREDICTED: cullin-4A                               187   4e-78    
ref|XP_004423239.1|  PREDICTED: cullin-4A                               187   4e-78    
ref|XP_005586359.1|  PREDICTED: cullin-4A isoform X2                    187   5e-78    
ref|XP_005420081.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          187   5e-78    
gb|KFP93822.1|  Cullin-4A                                               187   5e-78    
ref|XP_008142137.1|  PREDICTED: cullin-4A                               187   5e-78    
gb|KFP35944.1|  Cullin-4A                                               187   5e-78    
gb|KDO33656.1|  hypothetical protein SPRG_01614                         187   5e-78    
gb|KFV05672.1|  Cullin-4A                                               187   5e-78    
ref|XP_008516382.1|  PREDICTED: cullin-4A                               187   5e-78    
gb|KFV89189.1|  Cullin-4A                                               187   5e-78    
dbj|BAA33146.1|  cullin-4A                                              187   5e-78    
gb|KFM05368.1|  Cullin-4A                                               187   5e-78    
ref|XP_010086167.1|  PREDICTED: cullin-4A                               187   5e-78    
ref|XP_002191553.2|  PREDICTED: cullin-4A                               187   5e-78    
ref|XP_003800032.1|  PREDICTED: cullin-4A                               187   6e-78    
ref|XP_005145983.1|  PREDICTED: cullin-4A                               187   6e-78    
ref|XP_009190537.1|  PREDICTED: cullin-4A isoform X1                    187   6e-78    
gb|KFU89815.1|  Cullin-4A                                               187   6e-78    
ref|XP_002808198.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A-like     187   6e-78    
gb|ACG69447.2|  cullin 4A isoform 1 (predicted)                         187   6e-78    
ref|XP_005969110.1|  PREDICTED: cullin-4A                               189   6e-78    
ref|XP_009996265.1|  PREDICTED: cullin-4A                               187   7e-78    
ref|XP_005586358.1|  PREDICTED: cullin-4A isoform X1                    187   7e-78    
ref|XP_010726908.1|  PREDICTED: cullin-4A                               187   7e-78    
ref|XP_002824497.1|  PREDICTED: cullin-4A                               187   7e-78    
ref|XP_010989951.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          195   7e-78    
ref|XP_003914139.1|  PREDICTED: cullin-4A isoform X2                    187   7e-78    
gb|KFW82894.1|  Cullin-4A                                               187   7e-78    
ref|XP_007959168.1|  PREDICTED: cullin-4A isoform X1                    187   7e-78    
ref|XP_008955751.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          187   8e-78    
ref|XP_005601443.1|  PREDICTED: cullin-4A                               187   8e-78    
ref|XP_003279808.1|  PREDICTED: cullin-4A isoform 1                     187   8e-78    
ref|XP_007959169.1|  PREDICTED: cullin-4A isoform X2                    187   8e-78    
ref|XP_010358365.1|  PREDICTED: cullin-4A isoform X1                    187   8e-78    
dbj|BAD93235.1|  cullin-4A                                              187   8e-78    
ref|XP_002593347.1|  hypothetical protein BRAFLDRAFT_277112             183   8e-78    
gb|EAX09201.1|  cullin 4A                                               187   8e-78    
ref|NP_001008895.1|  cullin-4A isoform 1                                187   8e-78    
ref|XP_003279809.1|  PREDICTED: cullin-4A isoform 2                     187   8e-78    
ref|NP_001265443.1|  cullin-4A isoform 3                                187   9e-78    
gb|AAP36287.1|  Homo sapiens cullin 4A                                  187   9e-78    
ref|NP_003580.1|  cullin-4A isoform 2                                   187   9e-78    
pdb|4A0K|A  Chain A, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A...    186   9e-78    
ref|XP_009274422.1|  PREDICTED: cullin-4A                               187   9e-78    
ref|XP_009890453.1|  PREDICTED: cullin-4A                               186   9e-78    
ref|XP_004054819.1|  PREDICTED: cullin-4A                               187   1e-77    
gb|EHH58721.1|  hypothetical protein EGM_08641                          186   1e-77    
ref|XP_008615934.1|  Cullin 4                                           186   1e-77    
ref|XP_010223965.1|  PREDICTED: cullin-4A                               186   1e-77    



>ref|XP_009599227.1| PREDICTED: cullin-4 [Nicotiana tomentosiformis]
Length=821

 Score =   275 bits (704),  Expect(2) = 7e-113, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTV LMLFN+
Sbjct  607  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVALMLFND  666

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIKEA GIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL
Sbjct  667  AEKLSFQDIKEATGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  726

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  727  YRIKVNAIQMKETVEENTS  745


 Score =   160 bits (404),  Expect(2) = 7e-113, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  743  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  802

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  803  DREYLERDKNNPQIYNYLA  821



>ref|XP_006361548.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=824

 Score =   274 bits (700),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAE+PKG+KELAVS FQTVVLMLFN+
Sbjct  610  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEYPKGKKELAVSLFQTVVLMLFND  669

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AE  SFQDIKEA GIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL
Sbjct  670  AENLSFQDIKEATGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  729

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  730  YRIKVNAIQMKETVEENTS  748


 Score =   159 bits (403),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  746  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  805

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  806  DREYLERDKNNPQIYNYLA  824



>ref|XP_009759464.1| PREDICTED: cullin-4 [Nicotiana sylvestris]
Length=821

 Score =   273 bits (699),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTV LMLFN+
Sbjct  607  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVALMLFND  666

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIKEA GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED+DTFVFNDQFTAPL
Sbjct  667  AEKLSFQDIKEATGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDEDTFVFNDQFTAPL  726

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  727  YRIKVNAIQMKETVEENTS  745


 Score =   160 bits (404),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  743  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  802

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  803  DREYLERDKNNPQIYNYLA  821



>ref|NP_001234356.1| cullin 4 [Solanum lycopersicum]
 gb|ABX09988.1| cullin 4 [Solanum lycopersicum]
Length=785

 Score =   273 bits (699),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAE+PKG+KELAVS FQTVVLMLFN+
Sbjct  571  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEYPKGKKELAVSLFQTVVLMLFND  630

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AE  SFQDIKEA GIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL
Sbjct  631  AENLSFQDIKEATGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  690

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  691  YRIKVNAIQMKETVEENTS  709


 Score =   159 bits (402),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  707  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  766

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  767  DREYLERDKNNPQIYNYLA  785



>gb|EYU43260.1| hypothetical protein MIMGU_mgv1a001310mg [Erythranthe guttata]
Length=843

 Score =   270 bits (689),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+
Sbjct  629  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFND  688

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIKE+ GIEDKELRRTLQSLACGK RVLQK+PKGRDVEDDDTFVFNDQF APL
Sbjct  689  AQKLSFQDIKESTGIEDKELRRTLQSLACGKFRVLQKMPKGRDVEDDDTFVFNDQFAAPL  748

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKET+EE  +
Sbjct  749  YRIKVNAIQMKETIEENTS  767


 Score =   157 bits (398),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK+LSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  765  NTSTTERVFQDRQYQVDAAIVRIMKTRKMLSHTLLITELFQQLKFPIKPADLKKRIESLI  824

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQ+YNYLA
Sbjct  825  DREYLERDKNNPQVYNYLA  843



>ref|XP_006467459.1| PREDICTED: cullin-4-like isoform X1 [Citrus sinensis]
 gb|KDO78189.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=804

 Score =   267 bits (682),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  590  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  649

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  650  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  709

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  710  YRIKVNAIQMKETVEENTS  728


 Score =   159 bits (402),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  726  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  785

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  786  DREYLERDKNNPQIYNYLA  804



>gb|KDO78193.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=662

 Score =   266 bits (681),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  448  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  507

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  508  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  567

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  568  YRIKVNAIQMKETVEENTS  586


 Score =   159 bits (403),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  584  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  643

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  644  DREYLERDKNNPQIYNYLA  662



>gb|KDO78194.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
 gb|KDO78195.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=540

 Score =   266 bits (681),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  326  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  385

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  386  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  445

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  446  YRIKVNAIQMKETVEENTS  464


 Score =   159 bits (402),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  462  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  521

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  522  DREYLERDKNNPQIYNYLA  540



>ref|XP_011096567.1| PREDICTED: cullin-4-like [Sesamum indicum]
Length=846

 Score =   266 bits (680),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  632  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  691

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIKE+ GIEDKELRRTLQSLACGK RVLQKIPKGRDVED+D+FVFNDQF APL
Sbjct  692  AQKLSFQDIKESTGIEDKELRRTLQSLACGKFRVLQKIPKGRDVEDEDSFVFNDQFAAPL  751

Query  407  YRIKVNAIQMKETVEETRA  351
            YR+KVNAIQMKETVEE  +
Sbjct  752  YRLKVNAIQMKETVEENTS  770


 Score =   160 bits (404),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  768  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  827

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  828  DREYLERDKNNPQIYNYLA  846



>ref|XP_006467460.1| PREDICTED: cullin-4-like isoform X2 [Citrus sinensis]
Length=783

 Score =   266 bits (681),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  569  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  628

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  629  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  688

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  689  YRIKVNAIQMKETVEENTS  707


 Score =   159 bits (402),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  705  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  764

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  765  DREYLERDKNNPQIYNYLA  783



>ref|XP_010666663.1| PREDICTED: cullin-4 [Beta vulgaris subsp. vulgaris]
Length=825

 Score =   266 bits (679),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQ VVLMLFN+
Sbjct  611  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQAVVLMLFND  670

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+FVFND F+APL
Sbjct  671  AEKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKVPKGREVEDDDSFVFNDTFSAPL  730

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  731  YRIKVNAIQMKETVEENTS  749


 Score =   159 bits (403),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  747  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  806

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  807  DREYLERDKNNPQIYNYLA  825



>gb|KHN47328.1| Cullin-4 [Glycine soja]
Length=777

 Score =   266 bits (680),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  563  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  622

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  623  AEKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  682

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  683  YRIKVNAIQLKETVEENTS  701


 Score =   159 bits (403),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  699  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  758

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  759  DREYLERDKNNPQIYNYLA  777



>ref|XP_008225565.1| PREDICTED: cullin-4 [Prunus mume]
Length=821

 Score =   266 bits (679),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  607  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  666

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDVEDDDTF FND FTAPL
Sbjct  667  AEKLSLQDIKDSTGIEDKELRRTLQSLACGKVRVLQKFPKGRDVEDDDTFTFNDGFTAPL  726

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  727  YRIKVNAIQMKETVEENTS  745


 Score =   159 bits (403),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  743  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  802

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  803  DREYLERDKNNPQIYNYLA  821



>ref|XP_003524860.1| PREDICTED: cullin-4-like [Glycine max]
Length=775

 Score =   267 bits (682),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+
Sbjct  561  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFND  620

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD FVFND FTAPL
Sbjct  621  AEKLSLQDIKDATGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDDDLFVFNDGFTAPL  680

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  681  YRIKVNAIQLKETVEENTS  699


 Score =   158 bits (400),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVF DRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  697  NTSTTERVFHDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  756

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  757  DREYLERDKSNPQIYNYLA  775



>ref|XP_007214632.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
 gb|EMJ15831.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
Length=830

 Score =   266 bits (679),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  616  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  675

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDVEDDDTF FND FTAPL
Sbjct  676  AEKLSLQDIKDSTGIEDKELRRTLQSLACGKVRVLQKFPKGRDVEDDDTFTFNDGFTAPL  735

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  736  YRIKVNAIQMKETVEENTS  754


 Score =   159 bits (403),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  752  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  811

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  812  DREYLERDKNNPQIYNYLA  830



>ref|XP_008444359.1| PREDICTED: cullin-4 [Cucumis melo]
Length=829

 Score =   266 bits (679),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMW NSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  615  HELNVYQDIFKEFYLSKYSGRRLMWHNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  674

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDI+E+ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED+D+FVFND FTAPL
Sbjct  675  AEKLSFQDIRESTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPL  734

Query  407  YRIKVNAIQMKETVEETRA  351
            YR+KVNAIQMKETVEE  +
Sbjct  735  YRLKVNAIQMKETVEENTS  753


 Score =   159 bits (403),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  751  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  810

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  811  DREYLERDKNNPQIYNYLA  829



>gb|KHN46079.1| Cullin-4 [Glycine soja]
Length=764

 Score =   266 bits (681),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+
Sbjct  550  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFND  609

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD FVFND FTAPL
Sbjct  610  AEKLSLQDIKDATGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDDDLFVFNDGFTAPL  669

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  670  YRIKVNAIQLKETVEENTS  688


 Score =   158 bits (400),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVF DRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  686  NTSTTERVFHDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  745

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  746  DREYLERDKSNPQIYNYLA  764



>gb|KDP37982.1| hypothetical protein JCGZ_04625 [Jatropha curcas]
Length=821

 Score =   267 bits (682),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  607  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  666

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  667  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  726

Query  407  YRIKVNAIQMKETVEET  357
            YRIKVNAIQMKETVEE 
Sbjct  727  YRIKVNAIQMKETVEEN  743


 Score =   158 bits (399),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NT+TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  743  NTNTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  802

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  803  DREYLERDKNNPQIYNYLA  821



>gb|KJB66935.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=816

 Score =   264 bits (675),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  602  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  661

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED+D+F+FND FTAPL
Sbjct  662  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDNDSFIFNDGFTAPL  721

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  722  YRIKVNAIQMKETVEENTS  740


 Score =   159 bits (403),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  738  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  797

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  798  DREYLERDKNNPQIYNYLA  816



>gb|KGN65537.1| hypothetical protein Csa_1G435820 [Cucumis sativus]
Length=540

 Score =   264 bits (674),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMW NSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  326  HELNVYQDIFKEFYLSKYSGRRLMWHNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  385

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDI+E+ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED+D+FVFND FTAPL
Sbjct  386  AEKLSLQDIRESTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPL  445

Query  407  YRIKVNAIQMKETVEETRA  351
            YR+KVNAIQMKETVEE  +
Sbjct  446  YRLKVNAIQMKETVEENTS  464


 Score =   159 bits (403),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  462  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  521

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  522  DREYLERDKNNPQIYNYLA  540



>ref|XP_004149667.1| PREDICTED: cullin-4-like [Cucumis sativus]
Length=833

 Score =   263 bits (673),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMW NSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  619  HELNVYQDIFKEFYLSKYSGRRLMWHNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  678

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDI+E+ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED+D+FVFND FTAPL
Sbjct  679  AEKLSLQDIRESTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPL  738

Query  407  YRIKVNAIQMKETVEETRA  351
            YR+KVNAIQMKETVEE  +
Sbjct  739  YRLKVNAIQMKETVEENTS  757


 Score =   159 bits (403),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  755  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  814

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  815  DREYLERDKNNPQIYNYLA  833



>ref|XP_011085242.1| PREDICTED: cullin-4 [Sesamum indicum]
Length=844

 Score =   263 bits (673),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A
Sbjct  631  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDA  690

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            +K  FQDIKE+ GIEDKELRRTLQSLACGK RVLQKIPKGRDVEDDD FVFNDQFTAPLY
Sbjct  691  QKLGFQDIKESTGIEDKELRRTLQSLACGKFRVLQKIPKGRDVEDDDFFVFNDQFTAPLY  750

Query  404  RIKVNAIQMKETVEETRA  351
            RIKVNAIQMKETVEE  +
Sbjct  751  RIKVNAIQMKETVEENTS  768


 Score =   159 bits (403),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  766  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  825

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  826  DREYLERDKNNPQIYNYLA  844



>gb|KJB66937.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=662

 Score =   263 bits (673),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  448  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  507

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED+D+F+FND FTAPL
Sbjct  508  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDNDSFIFNDGFTAPL  567

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  568  YRIKVNAIQMKETVEENTS  586


 Score =   159 bits (403),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  584  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  643

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  644  DREYLERDKNNPQIYNYLA  662



>ref|XP_010274939.1| PREDICTED: cullin-4-like [Nelumbo nucifera]
Length=837

 Score =   263 bits (672),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  623  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  682

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDVEDDD+F+FN++F+APL
Sbjct  683  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKFPKGRDVEDDDSFLFNEEFSAPL  742

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  743  YRIKVNAIQMKETVEENTS  761


 Score =   160 bits (404),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  759  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  818

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  819  DREYLERDKNNPQIYNYLA  837



>ref|XP_007025064.1| Cullin-4B isoform 1 [Theobroma cacao]
 gb|EOY27686.1| Cullin-4B isoform 1 [Theobroma cacao]
Length=819

 Score =   263 bits (673),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  605  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  664

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  665  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  724

Query  407  YRIKVNAIQMKETVEETRA  351
            YR+KVNAIQMKETVEE  +
Sbjct  725  YRLKVNAIQMKETVEENTS  743


 Score =   159 bits (403),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  741  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  800

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  801  DREYLERDKNNPQIYNYLA  819



>ref|XP_006377604.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55401.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=811

 Score =   263 bits (673),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  597  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  656

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVE+DD+FVFN+ FTAPL
Sbjct  657  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEEDDSFVFNEGFTAPL  716

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  717  YRIKVNAIQMKETVEENTS  735


 Score =   159 bits (403),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  733  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  792

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  793  DREYLERDKNNPQIYNYLA  811



>gb|KHN12460.1| Cullin-4 [Glycine soja]
Length=760

 Score =   264 bits (674),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGR LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+
Sbjct  546  HELNVYQDIFKEFYLSKYSGRHLMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFND  605

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDIK+A GIEDKELRR LQSLACGKVRVLQK+PKGRDVEDDD+FVFND FTAPL
Sbjct  606  AEKLSLQDIKDATGIEDKELRRILQSLACGKVRVLQKMPKGRDVEDDDSFVFNDGFTAPL  665

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  666  YRIKVNAIQLKETVEENTS  684


 Score =   159 bits (402),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAA+VRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  682  NTSTTERVFQDRQYQIDAALVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  741

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  742  DREYLERDKSNPQIYNYLA  760



>gb|KHN06973.1| Cullin-4 [Glycine soja]
Length=788

 Score =   263 bits (673),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  574  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  633

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++ GIE KELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  634  AEKLSFQDIKDSTGIEGKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  693

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  694  YRIKVNAIQLKETVEENTS  712


 Score =   159 bits (403),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  710  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  769

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  770  DREYLERDKNNPQIYNYLA  788



>ref|XP_003532695.2| PREDICTED: cullin-4-like isoform X1 [Glycine max]
Length=769

 Score =   264 bits (674),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGR LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+
Sbjct  555  HELNVYQDIFKEFYLSKYSGRHLMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFND  614

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDIK+A GIEDKELRR LQSLACGKVRVLQK+PKGRDVEDDD+FVFND FTAPL
Sbjct  615  AEKLSLQDIKDATGIEDKELRRILQSLACGKVRVLQKMPKGRDVEDDDSFVFNDGFTAPL  674

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  675  YRIKVNAIQLKETVEENTS  693


 Score =   159 bits (402),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAA+VRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  691  NTSTTERVFQDRQYQIDAALVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  750

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  751  DREYLERDKSNPQIYNYLA  769



>ref|XP_011013417.1| PREDICTED: cullin-4-like [Populus euphratica]
Length=811

 Score =   263 bits (673),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  597  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  656

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVE+DD+FVFN+ FTAPL
Sbjct  657  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEEDDSFVFNEGFTAPL  716

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  717  YRIKVNAIQMKETVEENTS  735


 Score =   159 bits (402),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  733  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  792

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  793  DREYLERDKNNPQIYNYLA  811



>ref|XP_010941311.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Elaeis guineensis]
Length=846

 Score =   262 bits (670),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSK+SGRRLMWQNSLGHCVLKAEFPKG KELAVS FQTVVLMLFN+
Sbjct  632  HELNVYQDIFKEFYLSKHSGRRLMWQNSLGHCVLKAEFPKGXKELAVSLFQTVVLMLFND  691

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GI+DKELRRTLQSLACGKVRVLQKIPKGR+VEDDDTFVFN++F+APL
Sbjct  692  AQKLSFQDIKDSTGIDDKELRRTLQSLACGKVRVLQKIPKGREVEDDDTFVFNEEFSAPL  751

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  752  YRIKVNAIQMKETVEENTS  770


 Score =   160 bits (404),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  768  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  827

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  828  DREYLERDKNNPQIYNYLA  846



>ref|XP_004162809.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cucumis sativus]
Length=833

 Score =   263 bits (671),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMW NSLGHCVLKAEFPKG KELAVS FQTVVLMLFN+
Sbjct  619  HELNVYQDIFKEFYLSKYSGRRLMWHNSLGHCVLKAEFPKGXKELAVSLFQTVVLMLFND  678

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S QDI+E+ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED+D+FVFND FTAPL
Sbjct  679  AEKLSLQDIRESTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPL  738

Query  407  YRIKVNAIQMKETVEETRA  351
            YR+KVNAIQMKETVEE  +
Sbjct  739  YRLKVNAIQMKETVEENTS  757


 Score =   159 bits (403),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  755  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  814

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  815  DREYLERDKNNPQIYNYLA  833



>ref|XP_003546083.1| PREDICTED: cullin-4-like [Glycine max]
Length=788

 Score =   263 bits (671),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  574  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  633

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++ GIE KELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  634  AEKLSFQDIKDSTGIEGKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  693

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  694  YRIKVNAIQLKETVEENTS  712


 Score =   159 bits (403),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  710  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  769

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  770  DREYLERDKNNPQIYNYLA  788



>ref|XP_011011308.1| PREDICTED: cullin-4-like isoform X1 [Populus euphratica]
Length=808

 Score =   262 bits (669),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  594  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  653

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K  FQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ F APL
Sbjct  654  AQKLGFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFAAPL  713

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  714  YRIKVNAIQMKETVEENTS  732


 Score =   159 bits (403),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  730  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  789

Query  180  DREYLERDKSNPQIYNYLA  124
            DR+YLERDKSNPQIYNYLA
Sbjct  790  DRDYLERDKSNPQIYNYLA  808



>ref|XP_010247870.1| PREDICTED: cullin-4-like isoform X1 [Nelumbo nucifera]
Length=827

 Score =   260 bits (664),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  613  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  672

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDI+++ GIEDKELRRTLQSLACGKVRVLQK PKGR+VEDDD FVFN++F+APL
Sbjct  673  AQKLSFQDIRDSTGIEDKELRRTLQSLACGKVRVLQKSPKGREVEDDDLFVFNEEFSAPL  732

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  733  YRIKVNAIQMKETVEENTS  751


 Score =   161 bits (408),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  749  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  808

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  809  DREYLERDKSNPQIYNYLA  827



>emb|CBI30911.3| unnamed protein product [Vitis vinifera]
Length=802

 Score =   262 bits (670),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  588  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  647

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+F+FN+ FTAPL
Sbjct  648  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGREVEDDDSFMFNEGFTAPL  707

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  708  YRIKVNAIQMKETVEENTS  726


 Score =   159 bits (402),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  724  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  783

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  784  DREYLERDKNNPQIYNYLA  802



>ref|XP_002270764.2| PREDICTED: cullin-4 [Vitis vinifera]
Length=828

 Score =   262 bits (669),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  614  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  673

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+F+FN+ FTAPL
Sbjct  674  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGREVEDDDSFMFNEGFTAPL  733

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  734  YRIKVNAIQMKETVEENTS  752


 Score =   159 bits (402),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  750  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  809

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  810  DREYLERDKNNPQIYNYLA  828



>ref|XP_007147910.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
 gb|ESW19904.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
Length=787

 Score =   261 bits (668),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  573  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  632

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++  IEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ F APL
Sbjct  633  AEKLSFQDIKDSTSIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFAAPL  692

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  693  YRIKVNAIQLKETVEENTS  711


 Score =   159 bits (402),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  709  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  768

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  769  DREYLERDKNNPQIYNYLA  787



>ref|XP_008787804.1| PREDICTED: cullin-4-like isoform X2 [Phoenix dactylifera]
Length=846

 Score =   265 bits (676),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSK+SGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  632  HELNVYQDIFKEFYLSKHSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  691

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GI+DKELRRTLQSLACGKVRVLQKIPKGR+VEDDDTFVFN++FTAPL
Sbjct  692  AQKLSFQDIKDSTGIDDKELRRTLQSLACGKVRVLQKIPKGREVEDDDTFVFNEEFTAPL  751

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  752  YRIKVNAIQMKETVEENTS  770


 Score =   155 bits (393),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK+LSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  768  NTSTTERVFQDRQYQVDAAIVRIMKTRKILSHTLLITELFQQLKFPIKPADLKKRIESLI  827

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+N QIYNYLA
Sbjct  828  DREYLERDKNNSQIYNYLA  846



>ref|XP_002305340.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
 gb|EEE85851.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
Length=813

 Score =   261 bits (667),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  599  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  658

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVL K+PKGRDVEDDD+FVFN+ F APL
Sbjct  659  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLLKLPKGRDVEDDDSFVFNEGFAAPL  718

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  719  YRIKVNAIQMKETVEENTS  737


 Score =   159 bits (403),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  735  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  794

Query  180  DREYLERDKSNPQIYNYLA  124
            DR+YLERDKSNPQIYNYLA
Sbjct  795  DRDYLERDKSNPQIYNYLA  813



>ref|XP_011460204.1| PREDICTED: cullin-4 [Fragaria vesca subsp. vesca]
Length=797

 Score =   264 bits (675),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+
Sbjct  583  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFND  642

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++  IEDKELRRTLQSLACGKVRVLQK+PKGRDVED+D+F FND FTAPL
Sbjct  643  AEKLSFQDIKDSTSIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDNDSFTFNDTFTAPL  702

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  703  YRIKVNAIQMKETVEENTS  721


 Score =   155 bits (393),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRK+LSHT+LI ELFQQLKFPIKPADLKKRIESLI
Sbjct  719  NTSTTERVFQDRQYQIDAAIVRIMKTRKLLSHTILITELFQQLKFPIKPADLKKRIESLI  778

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQ+YNYLA
Sbjct  779  DREYLERDKNNPQVYNYLA  797



>ref|XP_008371761.1| PREDICTED: cullin-4 [Malus domestica]
Length=834

 Score =   261 bits (666),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  620  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  679

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S +DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D DTF FND FTAPL
Sbjct  680  AEKLSLEDIKDSTGIEDKELRRTLQSLACGKVRVLQKFPKGRDVDDGDTFTFNDSFTAPL  739

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  740  YRIKVNAIQMKETVEENTS  758


 Score =   159 bits (403),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  756  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  815

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  816  DREYLERDKNNPQIYNYLA  834



>ref|XP_010110959.1| hypothetical protein L484_021653 [Morus notabilis]
 gb|EXC29345.1| hypothetical protein L484_021653 [Morus notabilis]
Length=862

 Score =   261 bits (666),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  648  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  707

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AE+ SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED+D FVFN+ F+APL
Sbjct  708  AERLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDNDAFVFNEAFSAPL  767

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  768  YRIKVNAIQMKETVEENTS  786


 Score =   159 bits (402),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  784  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  843

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  844  DREYLERDKNNPQIYNYLA  862



>ref|XP_010923713.1| PREDICTED: cullin-4-like isoform X2 [Elaeis guineensis]
Length=845

 Score =   259 bits (661),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLG CVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  631  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGQCVLKAEFPKGKKELAVSLFQTVVLMLFND  690

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
             +K SFQDIK++ GI+DKELRRTLQSLACGKVRVLQKIPKGR+VEDDD+FVFN++F+APL
Sbjct  691  TQKLSFQDIKDSTGIDDKELRRTLQSLACGKVRVLQKIPKGREVEDDDSFVFNEEFSAPL  750

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  751  YRIKVNAIQMKETVEENTS  769


 Score =   160 bits (404),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  767  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  826

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  827  DREYLERDKNNPQIYNYLA  845



>ref|XP_010056896.1| PREDICTED: cullin-4 [Eucalyptus grandis]
Length=838

 Score =   259 bits (663),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQ+SLGHCVLKA+FPKGRKELAVS FQTVVLMLFN+
Sbjct  624  HELNVYQDIFKEFYLSKYSGRRLMWQSSLGHCVLKADFPKGRKELAVSLFQTVVLMLFND  683

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDI+++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+F FN+ F+APL
Sbjct  684  AQKLSFQDIRDSTGIEDKELRRTLQSLACGKVRVLQKVPKGRDVEDDDSFEFNEAFSAPL  743

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  744  YRIKVNAIQMKETVEENTS  762


 Score =   159 bits (403),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  760  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  819

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  820  DREYLERDKNNPQIYNYLA  838



>ref|XP_003593912.1| Cullin [Medicago truncatula]
 gb|AES64163.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=792

 Score =   260 bits (664),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLM FN+
Sbjct  578  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMQFND  637

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D+FVFND FTAPL
Sbjct  638  AEKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDYDSFVFNDTFTAPL  697

Query  407  YRIKVNAIQMKETVEE  360
            YRIKVNAIQ+KETVEE
Sbjct  698  YRIKVNAIQLKETVEE  713


 Score =   159 bits (402),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NT+TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  714  NTNTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  773

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQ+YNYLA
Sbjct  774  DREYLERDKSNPQVYNYLA  792



>gb|KJB69827.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=821

 Score =   260 bits (665),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+
Sbjct  607  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQTVVLMLFND  666

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+F+FN+ FTAPL
Sbjct  667  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFIFNEGFTAPL  726

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  727  YRIKVNAIQMKETVEENTS  745


 Score =   158 bits (400),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELF+QLKFPIKPADLKKRIESLI
Sbjct  743  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFEQLKFPIKPADLKKRIESLI  802

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  803  DREYLERDKNNPQIYNYLA  821



>ref|XP_003593911.1| Cullin [Medicago truncatula]
Length=794

 Score =   259 bits (663),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLM FN+
Sbjct  580  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMQFND  639

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D+FVFND FTAPL
Sbjct  640  AEKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDYDSFVFNDTFTAPL  699

Query  407  YRIKVNAIQMKETVEE  360
            YRIKVNAIQ+KETVEE
Sbjct  700  YRIKVNAIQLKETVEE  715


 Score =   159 bits (402),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NT+TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  716  NTNTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  775

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQ+YNYLA
Sbjct  776  DREYLERDKSNPQVYNYLA  794



>gb|KCW73810.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   259 bits (662),  Expect(2) = 7e-108, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQ+SLGHCVLKA+FPKGRKELAVS FQTVVLMLFN+
Sbjct  587  HELNVYQDIFKEFYLSKYSGRRLMWQSSLGHCVLKADFPKGRKELAVSLFQTVVLMLFND  646

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDI+++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+F FN+ F+APL
Sbjct  647  AQKLSFQDIRDSTGIEDKELRRTLQSLACGKVRVLQKVPKGRDVEDDDSFEFNEAFSAPL  706

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  707  YRIKVNAIQMKETVEENTS  725


 Score =   159 bits (402),  Expect(2) = 7e-108, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  723  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  782

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  783  DREYLERDKNNPQIYNYLA  801



>ref|XP_006352972.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=797

 Score =   263 bits (671),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELN+YQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ VVLMLFN+
Sbjct  583  HELNIYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQAVVLMLFND  642

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SF D++EA  IEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFT PL
Sbjct  643  AEKLSFLDMREATRIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTTPL  702

Query  407  YRIKVNAIQMKETVEET  357
            YRIKVNAIQMKETVEE 
Sbjct  703  YRIKVNAIQMKETVEEN  719


 Score =   155 bits (392),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NT+TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFP+KPADLKKRIESLI
Sbjct  719  NTNTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPVKPADLKKRIESLI  778

Query  180  DREYLERDKSNPQIYNYLA  124
            +REYLERDK+NPQ+YNYLA
Sbjct  779  EREYLERDKNNPQVYNYLA  797



>ref|XP_008809585.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
 ref|XP_008809586.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
Length=841

 Score =   258 bits (658),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLG CVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  627  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGQCVLKAEFPKGKKELAVSLFQTVVLMLFND  686

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
             +K SFQDIK++ GI+DKELRRTLQSLACGKVRVLQKIPKGR+VEDDD FVFN++F+APL
Sbjct  687  TQKLSFQDIKDSTGIDDKELRRTLQSLACGKVRVLQKIPKGREVEDDDAFVFNEEFSAPL  746

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  747  YRIKVNAIQMKETVEENTS  765


 Score =   160 bits (404),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  763  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  822

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  823  DREYLERDKNNPQIYNYLA  841



>ref|XP_009398338.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=842

 Score =   257 bits (657),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKY GRRLMWQNSLGHCVLKAEFPKG+KEL+VS FQTVVLMLFN+
Sbjct  628  HELNVYQDIFKEFYLSKYHGRRLMWQNSLGHCVLKAEFPKGKKELSVSLFQTVVLMLFND  687

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
             +K SFQDIK++ GI+DKELRRTLQSLACGKVRVLQKIPKGR++EDDD+FVFN++F+APL
Sbjct  688  TQKLSFQDIKDSTGIDDKELRRTLQSLACGKVRVLQKIPKGREIEDDDSFVFNEEFSAPL  747

Query  407  YRIKVNAIQMKETVEETRA  351
            YR+KVNAIQMKETVEE  +
Sbjct  748  YRLKVNAIQMKETVEENTS  766


 Score =   159 bits (403),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  764  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  823

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  824  DREYLERDKNNPQIYNYLA  842



>ref|XP_009360892.1| PREDICTED: cullin-4 [Pyrus x bretschneideri]
Length=831

 Score =   257 bits (656),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  617  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  676

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S +DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D DTF FND F APL
Sbjct  677  AEKLSLEDIKDSTGIEDKELRRTLQSLACGKVRVLQKFPKGRDVDDGDTFTFNDTFIAPL  736

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  737  YRIKVNAIQMKETVEENTS  755


 Score =   159 bits (402),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  753  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  812

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  813  DREYLERDKNNPQIYNYLA  831



>gb|KCW73811.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   257 bits (656),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQ+SLGHCVLKA+FPKGRKELAVS FQ +VLMLFN+
Sbjct  587  HELNVYQDIFKEFYLSKYSGRRLMWQSSLGHCVLKADFPKGRKELAVSLFQAIVLMLFND  646

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDI+++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+F FN+ F+APL
Sbjct  647  AQKLSFQDIRDSTGIEDKELRRTLQSLACGKVRVLQKVPKGRDVEDDDSFEFNEAFSAPL  706

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  707  YRIKVNAIQMKETVEENTS  725


 Score =   159 bits (402),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  723  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  782

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  783  DREYLERDKNNPQIYNYLA  801



>ref|XP_004981510.1| PREDICTED: cullin-4-like isoform X2 [Setaria italica]
Length=831

 Score =   258 bits (658),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQ+VVLMLFN+
Sbjct  617  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQSVVLMLFND  676

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIK++ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED D FVFN++F+APL
Sbjct  677  AQKLSFLDIKDSTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDKDEFVFNEEFSAPL  736

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  737  YRIKVNAIQMKETVEENTS  755


 Score =   158 bits (400),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAEL+QQLKFP+KPAD+KKRIESLI
Sbjct  753  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELYQQLKFPVKPADIKKRIESLI  812

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  813  DREYLERDRSNPQIYNYLA  831



>gb|KHG21020.1| Cullin-4 -like protein [Gossypium arboreum]
Length=786

 Score =   256 bits (654),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+
Sbjct  572  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFND  631

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++  IEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APL
Sbjct  632  AEKLSFQDIKDSTAIEDKELRRTLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPL  691

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  692  YRIKVNAIQMKETVEENTS  710


 Score =   159 bits (403),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  708  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  767

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  768  DREYLERDKNNPQIYNYLA  786



>gb|KJB68318.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=786

 Score =   256 bits (654),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+
Sbjct  572  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFND  631

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++  IEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APL
Sbjct  632  AEKLSFQDIKDSTAIEDKELRRTLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPL  691

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  692  YRIKVNAIQMKETVEENTS  710


 Score =   159 bits (402),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  708  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  767

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  768  DREYLERDKNNPQIYNYLA  786



>gb|KJB68316.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=614

 Score =   256 bits (654),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+
Sbjct  400  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFND  459

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++  IEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APL
Sbjct  460  AEKLSFQDIKDSTAIEDKELRRTLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPL  519

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  520  YRIKVNAIQMKETVEENTS  538


 Score =   159 bits (402),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  536  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  595

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  596  DREYLERDKNNPQIYNYLA  614



>gb|EEC76292.1| hypothetical protein OsI_13805 [Oryza sativa Indica Group]
Length=744

 Score =   259 bits (661),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+
Sbjct  530  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFND  589

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIKE+ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D FVFN++F+APL
Sbjct  590  AQKLSFLDIKESTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPL  649

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  650  YRIKVNAIQMKETVEENTS  668


 Score =   156 bits (394),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKP+D+KKRIESLI
Sbjct  666  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLI  725

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  726  DREYLERDRSNPQIYNYLA  744



>ref|XP_006650698.1| PREDICTED: cullin-4-like [Oryza brachyantha]
Length=829

 Score =   259 bits (661),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+
Sbjct  615  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFND  674

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIKE+ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D FVFN++F+APL
Sbjct  675  AQKLSFLDIKESTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPL  734

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  735  YRIKVNAIQMKETVEENTS  753


 Score =   156 bits (394),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKP+D+KKRIESLI
Sbjct  751  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLI  810

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  811  DREYLERDRSNPQIYNYLA  829



>gb|AAT75245.1| putative cullin protein [Oryza sativa Japonica Group]
Length=813

 Score =   258 bits (660),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+
Sbjct  599  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFND  658

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIKE+ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D FVFN++F+APL
Sbjct  659  AQKLSFLDIKESTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPL  718

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  719  YRIKVNAIQMKETVEENTS  737


 Score =   156 bits (394),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKP+D+KKRIESLI
Sbjct  735  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLI  794

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  795  DREYLERDRSNPQIYNYLA  813



>gb|KJB68317.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=540

 Score =   255 bits (652),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+
Sbjct  326  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFND  385

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++  IEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APL
Sbjct  386  AEKLSFQDIKDSTAIEDKELRRTLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPL  445

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  446  YRIKVNAIQMKETVEENTS  464


 Score =   159 bits (402),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  462  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  521

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  522  DREYLERDKNNPQIYNYLA  540



>gb|EEE60060.1| hypothetical protein OsJ_12866 [Oryza sativa Japonica Group]
Length=804

 Score =   258 bits (660),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+
Sbjct  590  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFND  649

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIKE+ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D FVFN++F+APL
Sbjct  650  AQKLSFLDIKESTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPL  709

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  710  YRIKVNAIQMKETVEENTS  728


 Score =   156 bits (394),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKP+D+KKRIESLI
Sbjct  726  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLI  785

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  786  DREYLERDRSNPQIYNYLA  804



>gb|ABF99238.1| Cullin-4B, putative, expressed [Oryza sativa Japonica Group]
Length=836

 Score =   258 bits (660),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+
Sbjct  622  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFND  681

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIKE+ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D FVFN++F+APL
Sbjct  682  AQKLSFLDIKESTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPL  741

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  742  YRIKVNAIQMKETVEENTS  760


 Score =   156 bits (394),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKP+D+KKRIESLI
Sbjct  758  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLI  817

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  818  DREYLERDRSNPQIYNYLA  836



>ref|XP_008644442.1| PREDICTED: cullin-4 [Zea mays]
 gb|AFW67428.1| hypothetical protein ZEAMMB73_322823 [Zea mays]
Length=831

 Score =   257 bits (656),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQ+VVLMLFN+
Sbjct  617  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQSVVLMLFND  676

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIK++ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED D FVFN+ F+APL
Sbjct  677  AQKLSFIDIKDSTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDKDEFVFNEDFSAPL  736

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  737  YRIKVNAIQMKETVEENTS  755


 Score =   157 bits (397),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI EL+QQLKFP+KPAD+KKRIESLI
Sbjct  753  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELYQQLKFPVKPADIKKRIESLI  812

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  813  DREYLERDRSNPQIYNYLA  831



>ref|XP_002466340.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
 gb|EER93338.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
Length=834

 Score =   257 bits (656),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQ+VVLMLFN+
Sbjct  620  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQSVVLMLFND  679

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIK++ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED D FVFN+ F+APL
Sbjct  680  AQKLSFLDIKDSTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDKDEFVFNEDFSAPL  739

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  740  YRIKVNAIQMKETVEENTS  758


 Score =   157 bits (396),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI EL+QQLKFP+KPAD+KKRIESLI
Sbjct  756  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELYQQLKFPVKPADIKKRIESLI  815

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  816  DREYLERDRSNPQIYNYLA  834



>ref|XP_004233125.1| PREDICTED: cullin-4 [Solanum lycopersicum]
Length=802

 Score =   258 bits (659),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELN+YQDIFKEFYL+KYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ VVLMLFN+
Sbjct  588  HELNIYQDIFKEFYLNKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQAVVLMLFND  647

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SF D+ EA  IEDKELRRTLQSLACGKVRVLQKIPKGRDVED+DTFVFNDQFT PL
Sbjct  648  AEKLSFLDMMEATRIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDNDTFVFNDQFTTPL  707

Query  407  YRIKVNAIQMKETVEET  357
            YRIKVNAIQMKETVEE 
Sbjct  708  YRIKVNAIQMKETVEEN  724


 Score =   155 bits (392),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NT+TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFP+KPADLKKRIESLI
Sbjct  724  NTNTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPVKPADLKKRIESLI  783

Query  180  DREYLERDKSNPQIYNYLA  124
            +REYLERDK+NPQ+YNYLA
Sbjct  784  EREYLERDKNNPQVYNYLA  802



>ref|XP_003558082.1| PREDICTED: cullin-4 [Brachypodium distachyon]
Length=830

 Score =   255 bits (652),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK EFPKGRKEL+VS FQ+VVLMLFN+
Sbjct  616  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKVEFPKGRKELSVSLFQSVVLMLFND  675

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D FVFND+F+APL
Sbjct  676  AQKLSFLDIKDSTGIEDKELRRTLQSLACGKVRVLQKTPKGRDVDDKDEFVFNDEFSAPL  735

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  736  YRIKVNAIQMKETVEENTS  754


 Score =   157 bits (397),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKPAD+KKRIESLI
Sbjct  752  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPADMKKRIESLI  811

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  812  DREYLERDRSNPQIYNYLA  830



>dbj|BAK02870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=832

 Score =   254 bits (650),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK EFPKGRKELAVS FQ+VVLMLFN+
Sbjct  618  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKVEFPKGRKELAVSLFQSVVLMLFND  677

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIKE+ GIEDKELRRTLQSLACGKVRVLQK PKGRD++D D FVFN+ F+APL
Sbjct  678  AQKLSFVDIKESTGIEDKELRRTLQSLACGKVRVLQKTPKGRDIDDKDEFVFNEDFSAPL  737

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  738  YRIKVNAIQMKETVEENTS  756


 Score =   157 bits (398),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKPAD+KKRIESLI
Sbjct  754  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPADMKKRIESLI  813

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  814  DREYLERDRSNPQIYNYLA  832



>gb|EMT18857.1| Cullin-4B [Aegilops tauschii]
Length=758

 Score =   254 bits (650),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK EFPKGRKELAVS FQ+VVLMLFN+
Sbjct  544  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKVEFPKGRKELAVSLFQSVVLMLFND  603

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIKE+ GIEDKELRRTLQSLACGKVRVLQK PKGRD++D D FVFN+ F+APL
Sbjct  604  AQKLSFVDIKESTGIEDKELRRTLQSLACGKVRVLQKTPKGRDIDDKDEFVFNEDFSAPL  663

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  664  YRIKVNAIQMKETVEENTS  682


 Score =   157 bits (397),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKPAD+KKRIESLI
Sbjct  680  NTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPADMKKRIESLI  739

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+SNPQIYNYLA
Sbjct  740  DREYLERDRSNPQIYNYLA  758



>ref|XP_008366025.1| PREDICTED: cullin-4-like [Malus domestica]
Length=299

 Score =   253 bits (646),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  85   HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  144

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK S +DIK++  IEDKELRRTLQSLACGKVRVLQK PKGRDV+D DTF FND F APL
Sbjct  145  AEKLSLEDIKDSTXIEDKELRRTLQSLACGKVRVLQKFPKGRDVDDGDTFTFNDTFIAPL  204

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  205  YRIKVNAIQMKETVEENTS  223


 Score =   159 bits (401),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  221  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  280

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  281  DREYLERDKNNPQIYNYLA  299



>ref|XP_006449702.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62942.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=804

 Score =   251 bits (641),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  590  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  649

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPL
Sbjct  650  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPL  709

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  710  YRIKVNAIQMKETVEENTS  728


 Score =   159 bits (402),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  726  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  785

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  786  DREYLERDKNNPQIYNYLA  804



>ref|XP_006449701.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62941.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=662

 Score =   251 bits (640),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  448  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  507

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPL
Sbjct  508  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPL  567

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  568  YRIKVNAIQMKETVEENTS  586


 Score =   159 bits (403),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  584  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  643

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  644  DREYLERDKNNPQIYNYLA  662



>ref|XP_010518764.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Tarenaya hassleriana]
Length=788

 Score =   250 bits (639),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HEL VYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQ VVLMLFN+
Sbjct  574  HELIVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQAVVLMLFND  633

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SFQDIK++  IEDKELRRTLQSLACGKVRVL K+PKGRDVED D FVFND FTAPL
Sbjct  634  AHKLSFQDIKDSTSIEDKELRRTLQSLACGKVRVLSKVPKGRDVEDGDEFVFNDGFTAPL  693

Query  407  YRIKVNAIQMKETVEETRA  351
            +RIKVNAIQMKETVEE  +
Sbjct  694  FRIKVNAIQMKETVEENTS  712


 Score =   160 bits (404),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  710  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  769

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  770  DREYLERDKTNPQIYNYLA  788



>ref|XP_006449704.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62944.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=540

 Score =   251 bits (640),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  326  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  385

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPL
Sbjct  386  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPL  445

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  446  YRIKVNAIQMKETVEENTS  464


 Score =   159 bits (402),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  462  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  521

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  522  DREYLERDKNNPQIYNYLA  540



>ref|XP_004486019.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cicer arietinum]
Length=787

 Score =   250 bits (638),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  573  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  632

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQD+K++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDV+DDD+FVFND FTAPL
Sbjct  633  AEKLSFQDMKDSTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVDDDDSFVFNDTFTAPL  692

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  693  YRIKVNAIQLKETVEENTS  711


 Score =   159 bits (402),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  709  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  768

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK NPQ+YNYLA
Sbjct  769  DREYLERDKGNPQVYNYLA  787



>emb|CDX77644.1| BnaC07g18980D [Brassica napus]
Length=767

 Score =   249 bits (635),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  553  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  612

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND FTAPL
Sbjct  613  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPL  672

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  673  YRIKVNAIQMKETVEENTS  691


 Score =   160 bits (404),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAI+RIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  689  NTSTTERVFQDRQYQIDAAIIRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  748

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  749  DREYLERDKSNPQIYNYLA  767



>ref|XP_006398308.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39761.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=793

 Score =   249 bits (636),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  579  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  638

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND FTAPL
Sbjct  639  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPL  698

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  699  YRIKVNAIQMKETVEENTS  717


 Score =   159 bits (401),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  715  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  774

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  775  DREYLERDKNNPQIYNYLA  793



>ref|XP_009101534.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=783

 Score =   248 bits (632),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA F KG+KELAVS FQ VVLMLFN+
Sbjct  569  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAGFSKGKKELAVSLFQAVVLMLFND  628

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND FTAPL
Sbjct  629  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKYPKGRDVQDRDEFDFNDTFTAPL  688

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  689  YRIKVNAIQMKETVEENTS  707


 Score =   160 bits (405),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  705  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  764

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  765  DREYLERDKSNPQIYNYLA  783



>emb|CDY33461.1| BnaA06g36120D [Brassica napus]
Length=761

 Score =   248 bits (632),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA F KG+KELAVS FQ VVLMLFN+
Sbjct  547  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAGFSKGKKELAVSLFQAVVLMLFND  606

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND FTAPL
Sbjct  607  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPL  666

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  667  YRIKVNAIQMKETVEENTS  685


 Score =   160 bits (405),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  683  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  742

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  743  DREYLERDKSNPQIYNYLA  761



>emb|CDY03235.1| BnaC09g19210D [Brassica napus]
Length=790

 Score =   249 bits (635),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  576  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  635

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND FTAPL
Sbjct  636  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPL  695

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  696  YRIKVNAIQMKETVEENTS  714


 Score =   159 bits (402),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  712  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  771

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  772  DREYLERDKTNPQIYNYLA  790



>gb|KFK31486.1| cullin [Arabis alpina]
Length=793

 Score =   247 bits (631),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK +F KG+KELAVS FQ VVLMLFN+
Sbjct  579  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKTDFSKGKKELAVSLFQAVVLMLFND  638

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGK+RVLQK PKGRDV+D D F FND FTAPL
Sbjct  639  ATKLSFEDIKDSTGIEDKELRRTLQSLACGKIRVLQKYPKGRDVQDGDEFDFNDSFTAPL  698

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  699  YRIKVNAIQMKETVEENTS  717


 Score =   160 bits (405),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  715  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  774

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  775  DREYLERDKSNPQIYNYLA  793



>ref|XP_009114369.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=786

 Score =   248 bits (634),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  572  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  631

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND FTAPL
Sbjct  632  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPL  691

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  692  YRIKVNAIQMKETVEENTS  710


 Score =   159 bits (402),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  708  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  767

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  768  DREYLERDKTNPQIYNYLA  786



>emb|CDY35152.1| BnaA09g17890D [Brassica napus]
Length=786

 Score =   248 bits (634),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  572  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  631

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND FTAPL
Sbjct  632  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPL  691

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  692  YRIKVNAIQMKETVEENTS  710


 Score =   159 bits (401),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  708  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  767

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  768  DREYLERDKTNPQIYNYLA  786



>ref|XP_006836434.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
 gb|ERM99287.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
Length=822

 Score =   248 bits (632),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  608  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  667

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
              K SFQDIK+A  IEDKELRRTLQSLACGKVRVLQK+PKGRDVED+D+F+FN++F+APL
Sbjct  668  TSKLSFQDIKDATCIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDEDSFLFNEEFSAPL  727

Query  407  YRIKVNAIQMK  375
            YR+KVNAIQMK
Sbjct  728  YRLKVNAIQMK  738


 Score =   160 bits (404),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NT+TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  744  NTTTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  803

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  804  DREYLERDKSNPQIYNYLA  822



>ref|XP_008787803.1| PREDICTED: cullin-4-like isoform X1 [Phoenix dactylifera]
Length=871

 Score =   251 bits (640),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 134/164 (82%), Gaps = 25/164 (15%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSK+SGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  632  HELNVYQDIFKEFYLSKHSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  691

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GI+DKELRRTLQSLACGKVRVLQKIPKGR+VEDDDTFVFN++FTAPL
Sbjct  692  AQKLSFQDIKDSTGIDDKELRRTLQSLACGKVRVLQKIPKGREVEDDDTFVFNEEFTAPL  751

Query  407  YRIK-------------------------VNAIQMKETVEETRA  351
            YRIK                         VNAIQMKETVEE  +
Sbjct  752  YRIKVSSPLFKSVLWNFKRAARANISCYQVNAIQMKETVEENTS  795


 Score =   155 bits (393),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRK+LSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  793  NTSTTERVFQDRQYQVDAAIVRIMKTRKILSHTLLITELFQQLKFPIKPADLKKRIESLI  852

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+N QIYNYLA
Sbjct  853  DREYLERDKNNSQIYNYLA  871



>emb|CAN75926.1| hypothetical protein VITISV_010491 [Vitis vinifera]
Length=806

 Score =   247 bits (631),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 6/144 (4%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  588  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  647

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKG-----RDVEDDDTFVFNDQ  423
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+ +G     R+VEDDD+F+FN+ 
Sbjct  648  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKV-RGYGRNWREVEDDDSFMFNEG  706

Query  422  FTAPLYRIKVNAIQMKETVEETRA  351
            FTAPLYRIKVNAIQMKETVEE  +
Sbjct  707  FTAPLYRIKVNAIQMKETVEENTS  730


 Score =   159 bits (402),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  728  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  787

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  788  DREYLERDKNNPQIYNYLA  806



>emb|CAC85265.1| cullin 4 [Arabidopsis thaliana]
Length=742

 Score =   246 bits (629),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  528  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  587

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++  IEDKELRRTLQSLACGKVRVLQK PKGRDVED D F FND+F APL
Sbjct  588  AMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPL  647

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  648  YRIKVNAIQMKETVEENTS  666


 Score =   159 bits (401),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  664  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  723

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  724  DREYLEREKSNPQIYNYLA  742



>ref|XP_010923712.1| PREDICTED: cullin-4-like isoform X1 [Elaeis guineensis]
Length=870

 Score =   245 bits (625),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 132/164 (80%), Gaps = 25/164 (15%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLG CVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  631  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGQCVLKAEFPKGKKELAVSLFQTVVLMLFND  690

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
             +K SFQDIK++ GI+DKELRRTLQSLACGKVRVLQKIPKGR+VEDDD+FVFN++F+APL
Sbjct  691  TQKLSFQDIKDSTGIDDKELRRTLQSLACGKVRVLQKIPKGREVEDDDSFVFNEEFSAPL  750

Query  407  YRIK-------------------------VNAIQMKETVEETRA  351
            YRIK                         VNAIQMKETVEE  +
Sbjct  751  YRIKVRFSLLKSVLWNFKHVTRANMSCYQVNAIQMKETVEENTS  794


 Score =   160 bits (405),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  792  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  851

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  852  DREYLERDKNNPQIYNYLA  870



>gb|AAM14063.1| putative cullin [Arabidopsis thaliana]
Length=792

 Score =   246 bits (628),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  578  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  637

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++  IEDKELRRTLQSLACGKVRVLQK PKGRDVED D F FND+F APL
Sbjct  638  AMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPL  697

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  698  YRIKVNAIQMKETVEENTS  716


 Score =   159 bits (401),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  714  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  773

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  774  DREYLEREKSNPQIYNYLA  792



>ref|NP_568658.1| cullin4 [Arabidopsis thaliana]
 sp|Q8LGH4.1|CUL4_ARATH RecName: Full=Cullin-4; Short=AtCUL4 [Arabidopsis thaliana]
 gb|AAM60859.1| cullin [Arabidopsis thaliana]
 gb|AED95353.1| cullin4 [Arabidopsis thaliana]
Length=792

 Score =   246 bits (628),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  578  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  637

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++  IEDKELRRTLQSLACGKVRVLQK PKGRDVED D F FND+F APL
Sbjct  638  AMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPL  697

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  698  YRIKVNAIQMKETVEENTS  716


 Score =   159 bits (401),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  714  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  773

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  774  DREYLEREKSNPQIYNYLA  792



>ref|XP_009408525.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=847

 Score =   248 bits (634),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKY GRRLMWQ+SLGHCVLKAEFP+G+KEL+VS FQ VVLMLFN+
Sbjct  633  HELNVYQDIFKEFYLSKYHGRRLMWQSSLGHCVLKAEFPRGKKELSVSLFQAVVLMLFND  692

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
             ++ S QDIK++ GI+D+ELRRTLQSLACGKVRVLQKIPKGR++ED+D+FVFN++FTAPL
Sbjct  693  TQRLSLQDIKDSTGIDDRELRRTLQSLACGKVRVLQKIPKGREIEDEDSFVFNEEFTAPL  752

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  753  YRIKVNAIQMKETVEENTS  771


 Score =   156 bits (394),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKP DLKKRIESLI
Sbjct  769  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPVDLKKRIESLI  828

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYL+RDK+NPQIYNYLA
Sbjct  829  DREYLDRDKNNPQIYNYLA  847



>ref|XP_009128848.1| PREDICTED: cullin-4 [Brassica rapa]
Length=785

 Score =   244 bits (622),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F K +KELAVS FQ VVLMLFN+
Sbjct  571  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKAKKELAVSLFQAVVLMLFND  630

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVR+L K PKGRDV+D D F FND FTAPL
Sbjct  631  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRILHKYPKGRDVQDGDEFDFNDTFTAPL  690

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  691  YRIKVNAIQMKETVEENTS  709


 Score =   160 bits (404),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  707  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  766

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  767  DREYLERDKSNPQIYNYLA  785



>emb|CDX87735.1| BnaC02g32140D [Brassica napus]
Length=780

 Score =   244 bits (622),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F K +KELAVS FQ VVLMLFN+
Sbjct  566  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKAKKELAVSLFQAVVLMLFND  625

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVR+L K PKGRDV+D D F FND FTAPL
Sbjct  626  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRILHKYPKGRDVQDGDEFDFNDTFTAPL  685

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  686  YRIKVNAIQMKETVEENTS  704


 Score =   160 bits (404),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  702  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  761

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  762  DREYLERDKSNPQIYNYLA  780



>emb|CDY43957.1| BnaA02g24350D [Brassica napus]
Length=776

 Score =   244 bits (622),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F K +KELAVS FQ VVLMLFN+
Sbjct  562  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKAKKELAVSLFQAVVLMLFND  621

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++ GIEDKELRRTLQSLACGKVR+L K PKGRDV+D D F FND FTAPL
Sbjct  622  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRILHKYPKGRDVQDGDEFDFNDTFTAPL  681

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  682  YRIKVNAIQMKETVEENTS  700


 Score =   160 bits (404),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  698  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  757

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  758  DREYLERDKSNPQIYNYLA  776



>ref|XP_002984123.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
 gb|EFJ14633.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   247 bits (631),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFK+FYLSK+SGRRLMWQNSLGHCVLKAEFPKG++EL+VS FQTVVLMLFN+
Sbjct  552  HELNVYQDIFKQFYLSKHSGRRLMWQNSLGHCVLKAEFPKGKRELSVSLFQTVVLMLFND  611

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            + + SFQDIK++ GIEDKELRRTLQSLACGKVR+LQK PKGR+VEDDD F FN+ FTAPL
Sbjct  612  SLRLSFQDIKDSTGIEDKELRRTLQSLACGKVRILQKQPKGREVEDDDVFTFNEDFTAPL  671

Query  407  YRIKVNAIQMKETVEE  360
            +RIKVNAIQ+KETVEE
Sbjct  672  FRIKVNAIQLKETVEE  687


 Score =   156 bits (395),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            N STTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  688  NASTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  747

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQ+YNYLA
Sbjct  748  DREYLERDKNNPQVYNYLA  766



>ref|XP_002972211.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
 gb|EFJ26297.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   247 bits (631),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFK+FYLSK+SGRRLMWQNSLGHCVLKAEFPKG++EL+VS FQTVVLMLFN+
Sbjct  552  HELNVYQDIFKQFYLSKHSGRRLMWQNSLGHCVLKAEFPKGKRELSVSLFQTVVLMLFND  611

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            + + SFQDIK++ GIEDKELRRTLQSLACGKVR+LQK PKGR+VEDDD F FN+ FTAPL
Sbjct  612  SLRLSFQDIKDSTGIEDKELRRTLQSLACGKVRILQKQPKGREVEDDDVFTFNEDFTAPL  671

Query  407  YRIKVNAIQMKETVEE  360
            +RIKVNAIQ+KETVEE
Sbjct  672  FRIKVNAIQLKETVEE  687


 Score =   156 bits (395),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            N STTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  688  NASTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  747

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQ+YNYLA
Sbjct  748  DREYLERDKNNPQVYNYLA  766



>ref|XP_002863417.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39676.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
Length=791

 Score =   244 bits (624),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F +G+KELAVS FQ VVLMLFN+
Sbjct  577  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSRGKKELAVSLFQAVVLMLFND  636

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++  IEDKELRRTLQSLACGKVRVLQK PKGRDVED D F FND F APL
Sbjct  637  AMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDDFAAPL  696

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  697  YRIKVNAIQMKETVEENTS  715


 Score =   158 bits (400),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  713  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  772

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  773  DREYLEREKSNPQIYNYLA  791



>ref|XP_006281916.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
 gb|EOA14814.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
Length=791

 Score =   244 bits (622),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+
Sbjct  577  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFND  636

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++  IEDKELRRTLQSLACGKVRVLQK PKGRDV+D D F FND F APL
Sbjct  637  AMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKHPKGRDVDDGDEFEFNDDFAAPL  696

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  697  YRIKVNAIQMKETVEENTS  715


 Score =   158 bits (400),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  713  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  772

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  773  DREYLEREKSNPQIYNYLA  791



>ref|XP_006414121.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
 gb|ESQ55574.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
Length=789

 Score =   247 bits (631),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNS GHCVLKAEFPKGRKELAVS FQ VVLMLFN+
Sbjct  575  HELNVYQDIFKEFYLSKYSGRRLMWQNSSGHCVLKAEFPKGRKELAVSLFQAVVLMLFND  634

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF+DIK++  IEDKELRRTLQSLACGK+RVL K+PKG+DVED D FVFN+ FTA L
Sbjct  635  AQKLSFEDIKDSTNIEDKELRRTLQSLACGKIRVLVKVPKGKDVEDGDEFVFNEDFTASL  694

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  695  YRIKVNAIQMKETVEENAS  713


 Score =   154 bits (388),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            N STTE+VF DRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  711  NASTTEKVFHDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  770

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  771  DREYLERDKNNPQIYNYLA  789



>ref|XP_001776334.1| predicted protein [Physcomitrella patens]
 gb|EDQ58833.1| predicted protein [Physcomitrella patens]
Length=768

 Score =   241 bits (614),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSK+SGRRLMWQNSLGHCVLKA FPKG+KEL+VS FQTVVLMLFN+
Sbjct  554  HELNVYQDIFKEFYLSKHSGRRLMWQNSLGHCVLKANFPKGKKELSVSLFQTVVLMLFND  613

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+  SFQ+IK+   IEDKELRRTLQSLACGKVRVL K PKGR+VEDDD FVFN+ F APL
Sbjct  614  AQSQSFQEIKDTTAIEDKELRRTLQSLACGKVRVLNKQPKGREVEDDDIFVFNEDFVAPL  673

Query  407  YRIKVNAIQMKETVEETRA  351
            +RIKVNAIQ+KETVEE  +
Sbjct  674  FRIKVNAIQLKETVEENTS  692


 Score =   159 bits (402),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  690  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  749

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  750  DREYLERDKANPQIYNYLA  768



>ref|XP_010441611.1| PREDICTED: cullin-4 [Camelina sativa]
Length=791

 Score =   240 bits (613),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F +G+KELAVS FQ VVLMLFN+
Sbjct  577  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSRGKKELAVSLFQAVVLMLFND  636

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A K SF+DIK++  IEDKELRRTLQSLACGKVRVL K PKGRDV+D D F FND F APL
Sbjct  637  AMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLLKHPKGRDVDDGDEFEFNDDFAAPL  696

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  697  YRIKVNAIQMKETVEENTS  715


 Score =   159 bits (401),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  713  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  772

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  773  DREYLEREKSNPQIYNYLA  791



>ref|XP_010529158.1| PREDICTED: cullin-4 [Tarenaya hassleriana]
Length=788

 Score =   253 bits (646),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQ VVLMLFN+
Sbjct  574  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQAVVLMLFND  633

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVL K+PKGRDV D D FVFN+ FTAPL
Sbjct  634  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLLKVPKGRDVGDGDEFVFNEGFTAPL  693

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  694  YRIKVNAIQMKETVEENTS  712


 Score =   145 bits (365),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTER  Q RQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  710  NTSTTERGRQFRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  769

Query  180  DREYLERDKSNPQIYNYLA  124
            +R+YLERDK+NPQIYNYLA
Sbjct  770  ERDYLERDKNNPQIYNYLA  788



>gb|KDO78190.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=792

 Score =   238 bits (607),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 121/139 (87%), Gaps = 12/139 (9%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQ         
Sbjct  590  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQ---------  640

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
                SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  641  ---LSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  697

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  698  YRIKVNAIQMKETVEENTS  716


 Score =   159 bits (402),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  714  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  773

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDK+NPQIYNYLA
Sbjct  774  DREYLERDKNNPQIYNYLA  792



>ref|XP_006585082.1| PREDICTED: cullin-4-like isoform X2 [Glycine max]
Length=757

 Score =   233 bits (595),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 118/139 (85%), Gaps = 12/139 (9%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGR LMWQNSLGHCVLKAEFPKGRKELAVS FQ         
Sbjct  555  HELNVYQDIFKEFYLSKYSGRHLMWQNSLGHCVLKAEFPKGRKELAVSLFQ---------  605

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
                S QDIK+A GIEDKELRR LQSLACGKVRVLQK+PKGRDVEDDD+FVFND FTAPL
Sbjct  606  ---LSLQDIKDATGIEDKELRRILQSLACGKVRVLQKMPKGRDVEDDDSFVFNDGFTAPL  662

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQ+KETVEE  +
Sbjct  663  YRIKVNAIQLKETVEENTS  681


 Score =   159 bits (402),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAA+VRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  679  NTSTTERVFQDRQYQIDAALVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  738

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERDKSNPQIYNYLA
Sbjct  739  DREYLERDKSNPQIYNYLA  757



>gb|KFK28509.1| cullin 4 [Arabis alpina]
Length=782

 Score =   238 bits (608),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKY+GRRLMWQNS GHCVLK EFPKGRKELAVS FQ VVLMLFN+
Sbjct  568  HELNVYQDIFKEFYLSKYNGRRLMWQNSSGHCVLKTEFPKGRKELAVSLFQAVVLMLFND  627

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF+DIK+A  IE+KELRRTLQSLACGKVRVL K PKG+DVED D FVFND F+  L
Sbjct  628  AQKLSFEDIKDATNIEEKELRRTLQSLACGKVRVLLKEPKGKDVEDGDEFVFNDGFSHSL  687

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  688  YRIKVNAIQMKETVEENAS  706


 Score =   152 bits (383),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            N STTE+VF DRQYQ+DAAIVRIMKTRK+LSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  704  NASTTEKVFHDRQYQIDAAIVRIMKTRKILSHTLLITELFQQLKFPIKPADLKKRIESLI  763

Query  180  DREYLERDKSNPQIYNYLA  124
             REYLERDKSNPQIYNYLA
Sbjct  764  QREYLERDKSNPQIYNYLA  782



>gb|KHG10035.1| Cullin-4 -like protein [Gossypium arboreum]
Length=823

 Score =   264 bits (675),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  602  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  661

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+F+FN+ FTAPL
Sbjct  662  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFIFNEGFTAPL  721

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  722  YRIKVNAIQMKETVEENTS  740


 Score =   125 bits (314),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELF+QLKFPIKPADLKKRIESLI
Sbjct  738  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFEQLKFPIKPADLKKRIESLI  797

Query  180  DRE  172
            DRE
Sbjct  798  DRE  800



>ref|XP_001764780.1| predicted protein [Physcomitrella patens]
 gb|EDQ70479.1| predicted protein [Physcomitrella patens]
Length=745

 Score =   230 bits (586),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            ELNVYQDIFKEFYLSK+SGRRLMWQNSLGHCVLKA FPKG+KEL+VS FQT+VLMLFN+A
Sbjct  532  ELNVYQDIFKEFYLSKHSGRRLMWQNSLGHCVLKANFPKGKKELSVSLFQTLVLMLFNDA  591

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            +  +F DIK+   IEDKELRRTLQSLACGK+RVL KIPKGR+VED+DTFVFN+ F APL+
Sbjct  592  QSLTFHDIKDTSAIEDKELRRTLQSLACGKIRVLNKIPKGREVEDEDTFVFNEDFVAPLF  651

Query  404  RIKVNAIQMK  375
            RIKVNAIQ+K
Sbjct  652  RIKVNAIQLK  661


 Score =   147 bits (371),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 70/73 (96%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = -3

Query  342  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE  163
            RVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLIDREYLE
Sbjct  673  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  732

Query  162  RDKSNPQIYNYLA  124
            RDK+NPQIYNYLA
Sbjct  733  RDKANPQIYNYLA  745



>dbj|BAB08502.1| cullin [Arabidopsis thaliana]
Length=617

 Score =   217 bits (552),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 116/142 (82%), Gaps = 3/142 (2%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQ   +     
Sbjct  400  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQVSQIFFPPP  459

Query  587  AEKFSF---QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFT  417
                SF   +DIK++  IEDKELRRTLQSLACGKVRVLQK PKGRDVED D F FND+F 
Sbjct  460  PLLSSFLSSRDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFA  519

Query  416  APLYRIKVNAIQMKETVEETRA  351
            APLYRIKVNAIQMKETVEE  +
Sbjct  520  APLYRIKVNAIQMKETVEENTS  541


 Score =   158 bits (400),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  539  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  598

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  599  DREYLEREKSNPQIYNYLA  617



>ref|XP_010484784.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=784

 Score =   196 bits (497),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 112/140 (80%), Gaps = 10/140 (7%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F +G+KELAVS FQ VVLMLFN+
Sbjct  578  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSRGKKELAVSLFQAVVLMLFND  637

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKI-PKGRDVEDDDTFVFNDQFTAP  411
            A K SF+DIK++ GIEDKELRRTLQSLACGKVRVL K+ PK           FN    + 
Sbjct  638  AMKLSFEDIKDSTGIEDKELRRTLQSLACGKVRVLLKVRPKS---------PFNXPILSF  688

Query  410  LYRIKVNAIQMKETVEETRA  351
            +  ++VNAIQMKETVEE  +
Sbjct  689  VSCVQVNAIQMKETVEENTS  708


 Score =   159 bits (402),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            NTSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLI
Sbjct  706  NTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLI  765

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLER+KSNPQIYNYLA
Sbjct  766  DREYLEREKSNPQIYNYLA  784



>gb|KDO78191.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=805

 Score =   267 bits (682),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  590  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  649

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  650  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  709

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  710  YRIKVNAIQMKETVEENTS  728


 Score = 86.7 bits (213),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPI  220
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQ+  P+
Sbjct  726  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQVLPPV  772



>ref|XP_002519675.1| cullin, putative [Ricinus communis]
 gb|EEF42648.1| cullin, putative [Ricinus communis]
Length=807

 Score =   264 bits (674),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEF KG+KELAVS FQTVVLMLFN+
Sbjct  616  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFSKGKKELAVSLFQTVVLMLFND  675

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPL
Sbjct  676  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPL  735

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  736  YRIKVNAIQMKETVEENTS  754


 Score = 88.2 bits (217),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 1/48 (2%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLK-FPI  220
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQ K FP+
Sbjct  752  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQAKCFPL  799



>gb|KJB66936.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=788

 Score =   264 bits (675),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+
Sbjct  602  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFND  661

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED+D+F+FND FTAPL
Sbjct  662  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDNDSFIFNDGFTAPL  721

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  722  YRIKVNAIQMKETVEENTS  740


 Score = 85.1 bits (209),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL  232
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQ+
Sbjct  738  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQV  780



>gb|KJB69828.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=786

 Score =   261 bits (666),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+
Sbjct  607  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQTVVLMLFND  666

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVEDDD+F+FN+ FTAPL
Sbjct  667  AQKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFIFNEGFTAPL  726

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  727  YRIKVNAIQMKETVEENTS  745


 Score = 84.0 bits (206),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL  232
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELF+Q+
Sbjct  743  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFEQV  785



>ref|XP_003593913.1| Cullin [Medicago truncatula]
 gb|AES64164.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=768

 Score =   260 bits (664),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLM FN+
Sbjct  578  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMQFND  637

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++ GIEDKELRRTLQSLACGKVRVLQK+PKGRDVED D+FVFND FTAPL
Sbjct  638  AEKLSFQDIKDSTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDYDSFVFNDTFTAPL  697

Query  407  YRIKVNAIQMKETVEE  360
            YRIKVNAIQ+KETVEE
Sbjct  698  YRIKVNAIQLKETVEE  713


 Score = 84.0 bits (206),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL  232
            NT+TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQ+
Sbjct  714  NTNTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQV  756



>ref|XP_004981509.1| PREDICTED: cullin-4-like isoform X1 [Setaria italica]
Length=839

 Score =   258 bits (658),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+FPKG+KELAVS FQ+VVLMLFN+
Sbjct  617  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFPKGKKELAVSLFQSVVLMLFND  676

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SF DIK++ GIEDKELRRTLQSLACGKVRVLQKIPKGRDVED D FVFN++F+APL
Sbjct  677  AQKLSFLDIKDSTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDKDEFVFNEEFSAPL  736

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  737  YRIKVNAIQMKETVEENTS  755


 Score = 85.9 bits (211),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL  232
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAEL+QQ+
Sbjct  753  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELYQQV  795



>gb|KJB68319.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=759

 Score =   256 bits (654),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+
Sbjct  572  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFND  631

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            AEK SFQDIK++  IEDKELRRTLQSLACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APL
Sbjct  632  AEKLSFQDIKDSTAIEDKELRRTLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPL  691

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  692  YRIKVNAIQMKETVEENTS  710


 Score = 85.5 bits (210),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL  232
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQ+
Sbjct  708  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQV  750



>ref|XP_006449703.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62943.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=805

 Score =   251 bits (641),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  590  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  649

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPL
Sbjct  650  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPL  709

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  710  YRIKVNAIQMKETVEENTS  728


 Score = 86.7 bits (213),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPI  220
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQ+  P+
Sbjct  726  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQVLPPV  772



>ref|XP_006449705.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62945.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=541

 Score =   251 bits (641),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  767  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE  588
            HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+
Sbjct  326  HELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFND  385

Query  587  AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  408
            A+K SFQDIK+A GIEDKELRRTLQSLACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPL
Sbjct  386  AQKLSFQDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPL  445

Query  407  YRIKVNAIQMKETVEETRA  351
            YRIKVNAIQMKETVEE  +
Sbjct  446  YRIKVNAIQMKETVEENTS  464


 Score = 86.7 bits (213),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPI  220
            NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQ+  P+
Sbjct  462  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQVLPPV  508



>ref|XP_005644988.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20444.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=733

 Score =   209 bits (531),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            EL  YQ +FKEFYLSK+SGRRL+W NS GHC ++A FPKG KEL+VS FQTVVLMLFN+A
Sbjct  520  ELTQYQSVFKEFYLSKHSGRRLVWHNSQGHCTVRAHFPKGAKELSVSLFQTVVLMLFNDA  579

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            +  SF+DIK A GIED+ELRRTLQSLACGK+R + K PKGR+V+D D F FN  F+A L+
Sbjct  580  DALSFEDIKAASGIEDRELRRTLQSLACGKIRAITKEPKGREVDDGDMFRFNGDFSAQLF  639

Query  404  RIKVNAIQMKETVEETR  354
            RIK+NAIQMKETVEE +
Sbjct  640  RIKINAIQMKETVEENK  656


 Score =   127 bits (319),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  360  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLI  181
            N  T ++V QDRQYQ+DAAIVR+MKTRK LSH LL++EL  QLKFP+K +DLKKRIESLI
Sbjct  655  NKKTNDQVLQDRQYQIDAAIVRVMKTRKSLSHKLLVSELLTQLKFPMKQSDLKKRIESLI  714

Query  180  DREYLERDKSNPQIYNYLA  124
            DREYLERD+ NP +YNYLA
Sbjct  715  DREYLERDRDNPNVYNYLA  733



>ref|XP_006003900.1| PREDICTED: cullin-4B [Latimeria chalumnae]
Length=845

 Score =   196 bits (498),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  637  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  696

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  697  EEIKQATGIEDGELRRTLQSLACGKARVLTKTPKGKDVEDGDKFTCNDDFKHKLFRIKIN  756

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  757  QIQMKETVEE  766


 Score =   137 bits (345),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
            TSTTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  768  TSTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  827

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  828  RDYMERDKENPNQYNYVA  845



>gb|EGW01006.1| Cullin-4B [Cricetulus griseus]
Length=834

 Score =   197 bits (502),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  626  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  685

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            +DIK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  686  EDIKQATGIEDGELRRTLQSLACGKARVLTKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  745

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  746  QIQMKETVEE  755


 Score =   135 bits (340),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  757  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  816

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  817  RDYMERDKENPNQYNYIA  834



>ref|XP_007610124.1| PREDICTED: cullin-4B isoform X2 [Cricetulus griseus]
Length=911

 Score =   197 bits (501),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  703  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  762

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            +DIK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  763  EDIKQATGIEDGELRRTLQSLACGKARVLTKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  822

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  823  QIQMKETVEE  832


 Score =   135 bits (340),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  834  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  893

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  894  RDYMERDKENPNQYNYIA  911



>ref|XP_007647173.1| PREDICTED: cullin-4B isoform X1 [Cricetulus griseus]
Length=905

 Score =   197 bits (501),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  697  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  756

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            +DIK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  757  EDIKQATGIEDGELRRTLQSLACGKARVLTKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  816

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  817  QIQMKETVEE  826


 Score =   135 bits (340),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  828  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  887

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  888  RDYMERDKENPNQYNYIA  905



>ref|XP_003774810.1| PREDICTED: cullin-4B [Sarcophilus harrisii]
Length=902

 Score =   198 bits (503),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS 
Sbjct  694  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSL  753

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            +DIK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  754  EDIKQATGIEDGELRRTLQSLACGKARVLTKNPKGKDVEDGDKFTCNDDFRHKLFRIKIN  813

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  814  QIQMKETVEE  823


 Score =   134 bits (337),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK L H LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKALGHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>gb|ELK27187.1| Cullin-4B, partial [Myotis davidii]
Length=896

 Score =   196 bits (498),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  688  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  747

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  748  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  807

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  808  QIQMKETVEE  817


 Score =   135 bits (341),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  819  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  878

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  879  RDYMERDKENPNQYNYIA  896



>ref|XP_009088610.1| PREDICTED: cullin-4B [Serinus canaria]
Length=887

 Score =   196 bits (499),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  679  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  738

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            +DIK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  739  EDIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKIN  798

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  799  QIQMKETVEE  808


 Score =   135 bits (339),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  810  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  869

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  870  RDYMERDKENPNQYNYIA  887



>gb|EPQ19199.1| Cullin-4B [Myotis brandtii]
Length=947

 Score =   196 bits (498),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  739  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  798

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  799  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  858

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  859  QIQMKETVEE  868


 Score =   135 bits (341),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  870  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  929

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  930  RDYMERDKENPNQYNYIA  947



>ref|XP_005413716.1| PREDICTED: cullin-4B isoform X4 [Chinchilla lanigera]
Length=781

 Score =   196 bits (498),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  573  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  632

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  633  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  692

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  693  QIQMKETVEE  702


 Score =   135 bits (340),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  704  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  763

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  764  RDYMERDKENPNQYNYIA  781



>ref|XP_006144939.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Tupaia chinensis]
Length=895

 Score =   196 bits (499),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFIXNDDFRHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (339),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_006877534.1| PREDICTED: cullin-4B isoform X1 [Chrysochloris asiatica]
Length=898

 Score =   196 bits (498),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  690  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  749

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  750  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  809

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  810  QIQMKETVEE  819


 Score =   135 bits (340),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  821  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  880

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  881  RDYMERDKENPNQYNYIA  898



>ref|XP_004587715.1| PREDICTED: cullin-4B [Ochotona princeps]
Length=895

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDVEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_005884739.1| PREDICTED: cullin-4B [Myotis brandtii]
Length=900

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  692  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  751

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  752  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  811

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  812  QIQMKETVEE  821


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  823  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  882

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  883  RDYMERDKENPNQYNYIA  900



>gb|EAX11878.1| cullin 4B, isoform CRA_c [Homo sapiens]
Length=843

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  635  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  694

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  695  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  754

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  755  QIQMKETVEE  764


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  766  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  825

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  826  RDYMERDKENPNQYNYIA  843



>ref|XP_005413714.1| PREDICTED: cullin-4B isoform X2 [Chinchilla lanigera]
Length=910

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  702  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  761

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  762  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  821

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  822  QIQMKETVEE  831


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  833  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  892

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  893  RDYMERDKENPNQYNYIA  910



>ref|XP_003797087.1| PREDICTED: cullin-4B-like [Otolemur garnettii]
Length=879

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  671  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  730

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  731  EEIKQATGIEDGELRRTLQSLACGKARVLSKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  790

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  791  QIQMKETVEE  800


 Score =   135 bits (339),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  802  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  861

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  862  RDYMERDKENPNQYNYIA  879



>ref|XP_006082210.1| PREDICTED: cullin-4B isoform X1 [Myotis lucifugus]
Length=903

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  695  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  754

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  755  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  814

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  815  QIQMKETVEE  824


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  826  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  885

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  886  RDYMERDKENPNQYNYIA  903



>ref|XP_006082211.1| PREDICTED: cullin-4B isoform X2 [Myotis lucifugus]
Length=901

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  693  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  752

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  753  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  812

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  813  QIQMKETVEE  822


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  824  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  883

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  884  RDYMERDKENPNQYNYIA  901



>ref|NP_001100421.1| cullin-4B [Rattus norvegicus]
 gb|EDM10867.1| cullin 4B (predicted) [Rattus norvegicus]
Length=971

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  758  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  817

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  818  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  877

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  878  RIKINQIQMKETVEE  892


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  894  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  953

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  954  RDYMERDKENPNQYNYIA  971



>gb|AAK16812.1|AF212995_1 cullin CUL4B [Homo sapiens]
Length=782

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  574  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  633

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  634  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  693

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  694  QIQMKETVEE  703


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  705  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  764

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  765  RDYMERDKENPNQYNYIA  782



>ref|XP_005262538.1| PREDICTED: cullin-4B isoform X1 [Homo sapiens]
Length=915

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  702  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  761

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  762  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  821

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  822  RIKINQIQMKETVEE  836


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  838  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  897

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  898  RDYMERDKENPNQYNYIA  915



>ref|NP_003579.3| cullin-4B isoform 1 [Homo sapiens]
 sp|Q13620.4|CUL4B_HUMAN RecName: Full=Cullin-4B; Short=CUL-4B [Homo sapiens]
 dbj|BAG37520.1| unnamed protein product [Homo sapiens]
Length=913

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  700  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  759

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  760  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  819

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  820  RIKINQIQMKETVEE  834


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  836  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  895

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  896  RDYMERDKENPNQYNYIA  913



>ref|XP_005413713.1| PREDICTED: cullin-4B isoform X1 [Chinchilla lanigera]
Length=912

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  704  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  763

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  764  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  823

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  824  QIQMKETVEE  833


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  835  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  894

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  895  RDYMERDKENPNQYNYIA  912



>ref|XP_010287736.1| PREDICTED: cullin-4B [Phaethon lepturus]
Length=887

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS 
Sbjct  679  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSL  738

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  739  EEIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKIN  798

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  799  QIQMKETVEE  808


 Score =   135 bits (339),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  810  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  869

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  870  RDYMERDKENPNQYNYIA  887



>ref|XP_004762115.1| PREDICTED: cullin-4B isoform X2 [Mustela putorius furo]
 ref|XP_004816694.1| PREDICTED: cullin-4B isoform X2 [Mustela putorius furo]
Length=913

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  705  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  764

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  765  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  824

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  825  QIQMKETVEE  834


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  836  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  895

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  896  RDYMERDKENPNQYNYIA  913



>ref|XP_008832150.1| PREDICTED: cullin-4B [Nannospalax galili]
Length=894

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  686  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  745

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  746  EEIKQATGIEDGELRRTLQSLACGKARVLSKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  805

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  806  QIQMKETVEE  815


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  817  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  876

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  877  RDYMERDKENPNQYNYIA  894



>ref|XP_005358493.1| PREDICTED: cullin-4B [Microtus ochrogaster]
Length=967

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  759  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  818

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  819  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  878

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  879  QIQMKETVEE  888


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  354  STTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDR  175
            STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR
Sbjct  891  STTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDR  950

Query  174  EYLERDKSNPQIYNYLA  124
            +Y+ERDK NP  YNY+A
Sbjct  951  DYMERDKENPNQYNYIA  967



>ref|XP_009196468.1| PREDICTED: cullin-4B isoform X1 [Papio anubis]
Length=915

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  707  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  766

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  767  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  826

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  827  QIQMKETVEE  836


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  838  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  897

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  898  RDYMERDKENPNQYNYIA  915



>ref|NP_001103612.1| cullin-4B [Mus musculus]
 ref|NP_082564.3| cullin-4B [Mus musculus]
 sp|A2A432.1|CUL4B_MOUSE RecName: Full=Cullin-4B; Short=CUL-4B [Mus musculus]
 gb|EDL29019.1| cullin 4B [Mus musculus]
Length=970

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  757  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEG  816

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  817  EEFSLEEIKHATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  876

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  877  RIKINQIQMKETVEE  891


 Score =   135 bits (341),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  893  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  952

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  953  RDYMERDKENPNQYNYIA  970



>ref|XP_008154341.1| PREDICTED: cullin-4B isoform X1 [Eptesicus fuscus]
Length=914

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  706  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  765

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  766  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  825

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  826  QIQMKETVEE  835


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  837  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  896

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  897  RDYMERDKENPNQYNYIA  914



>ref|XP_006746270.1| PREDICTED: cullin-4B [Leptonychotes weddellii]
Length=912

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  704  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  763

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  764  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  823

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  824  QIQMKETVEE  833


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  835  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  894

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  895  RDYMERDKENPNQYNYIA  912



>ref|XP_006981625.1| PREDICTED: cullin-4B isoform X1 [Peromyscus maniculatus bairdii]
Length=901

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  693  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  752

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  753  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  812

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  813  QIQMKETVEE  822


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  824  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  883

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  884  RDYMERDKENPNQYNYIA  901



>gb|ELK07572.1| Cullin-4B [Pteropus alecto]
Length=788

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  580  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  639

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  640  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  699

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  700  QIQMKETVEE  709


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  711  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  770

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  771  RDYMERDKENPNQYNYIA  788



>ref|XP_001086195.1| PREDICTED: cullin-4B isoform 1 [Macaca mulatta]
 ref|XP_009196469.1| PREDICTED: cullin-4B isoform X2 [Papio anubis]
 gb|EHH31046.1| hypothetical protein EGK_20888 [Macaca mulatta]
 gb|EHH61197.1| hypothetical protein EGM_19145 [Macaca fascicularis]
Length=913

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  705  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  764

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  765  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  824

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  825  QIQMKETVEE  834


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  836  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  895

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  896  RDYMERDKENPNQYNYIA  913



>ref|XP_005413715.1| PREDICTED: cullin-4B isoform X3 [Chinchilla lanigera]
Length=901

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  693  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  752

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  753  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  812

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  813  QIQMKETVEE  822


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  824  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  883

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  884  RDYMERDKENPNQYNYIA  901



>ref|XP_004762116.1| PREDICTED: cullin-4B isoform X3 [Mustela putorius furo]
 ref|XP_004816695.1| PREDICTED: cullin-4B isoform X3 [Mustela putorius furo]
Length=911

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  703  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  762

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  763  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  822

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  823  QIQMKETVEE  832


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  834  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  893

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  894  RDYMERDKENPNQYNYIA  911



>ref|XP_003262326.2| PREDICTED: LOW QUALITY PROTEIN: cullin-4B isoform 1 [Nomascus 
leucogenys]
Length=921

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  713  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  772

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  773  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  832

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  833  QIQMKETVEE  842


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  844  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  903

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  904  RDYMERDKENPNQYNYIA  921



>ref|XP_004899937.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Heterocephalus glaber]
Length=905

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  697  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  756

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  757  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  816

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  817  QIQMKETVEE  826


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  828  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  887

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  888  RDYMERDKENPNQYNYIA  905



>ref|XP_002720454.2| PREDICTED: cullin-4B isoform X2 [Oryctolagus cuniculus]
Length=910

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  702  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  761

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  762  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  821

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  822  QIQMKETVEE  831


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  833  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  892

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  893  RDYMERDKENPNQYNYIA  910



>ref|XP_005594545.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Macaca fascicularis]
Length=921

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  713  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  772

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  773  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  832

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  833  QIQMKETVEE  842


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  844  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  903

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  904  RDYMERDKENPNQYNYIA  921



>dbj|BAA31670.2| KIAA0695 protein [Homo sapiens]
Length=781

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  573  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  632

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  633  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  692

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  693  QIQMKETVEE  702


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  704  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  763

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  764  RDYMERDKENPNQYNYIA  781



>ref|XP_008974985.1| PREDICTED: cullin-4B isoform X1 [Pan paniscus]
Length=913

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  705  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  764

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  765  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  824

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  825  QIQMKETVEE  834


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  836  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  895

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  896  RDYMERDKENPNQYNYIA  913



>ref|XP_004762114.1| PREDICTED: cullin-4B isoform X1 [Mustela putorius furo]
 ref|XP_004816693.1| PREDICTED: cullin-4B isoform X1 [Mustela putorius furo]
Length=913

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  705  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  764

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  765  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  824

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  825  QIQMKETVEE  834


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  836  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  895

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  896  RDYMERDKENPNQYNYIA  913



>ref|XP_864628.3| PREDICTED: cullin-4B isoform 3 [Canis lupus familiaris]
Length=912

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  704  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  763

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  764  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  823

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  824  QIQMKETVEE  833


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  835  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  894

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  895  RDYMERDKENPNQYNYIA  912



>ref|XP_006191372.1| PREDICTED: cullin-4B-like isoform X1 [Camelus ferus]
 ref|XP_009437855.1| PREDICTED: cullin-4B isoform X1 [Pan troglodytes]
 ref|XP_010340010.1| PREDICTED: cullin-4B isoform X3 [Saimiri boliviensis boliviensis]
Length=782

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  574  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  633

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  634  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  693

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  694  QIQMKETVEE  703


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  705  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  764

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  765  RDYMERDKENPNQYNYIA  782



>ref|XP_006191373.1| PREDICTED: cullin-4B-like isoform X2 [Camelus ferus]
 ref|XP_009437856.1| PREDICTED: cullin-4B isoform X2 [Pan troglodytes]
Length=780

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  572  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  631

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  632  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  691

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  692  QIQMKETVEE  701


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  703  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  762

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  763  RDYMERDKENPNQYNYIA  780



>ref|XP_011277733.1| PREDICTED: cullin-4B isoform X1 [Felis catus]
Length=901

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  693  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  752

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  753  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  812

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  813  QIQMKETVEE  822


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  824  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  883

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  884  RDYMERDKENPNQYNYIA  901



>ref|XP_011277734.1| PREDICTED: cullin-4B isoform X2 [Felis catus]
Length=899

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  691  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  750

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  751  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  810

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  811  QIQMKETVEE  820


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  822  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  881

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  882  RDYMERDKENPNQYNYIA  899



>ref|XP_006082213.1| PREDICTED: cullin-4B isoform X4 [Myotis lucifugus]
Length=896

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  688  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  747

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  748  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  807

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  808  QIQMKETVEE  817


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  819  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  878

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  879  RDYMERDKENPNQYNYIA  896



>ref|XP_011376545.1| PREDICTED: cullin-4B isoform X2 [Pteropus vampyrus]
Length=782

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  574  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  633

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  634  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  693

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  694  QIQMKETVEE  703


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  705  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  764

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  765  RDYMERDKENPNQYNYIA  782



>ref|NP_001041617.1| cullin-4B [Felis catus]
 gb|ABC59460.1| CUL4BX [Felis catus]
Length=782

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  574  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  633

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  634  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  693

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  694  QIQMKETVEE  703


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  705  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  764

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  765  RDYMERDKENPNQYNYIA  782



>ref|XP_008271384.1| PREDICTED: cullin-4B isoform X5 [Oryctolagus cuniculus]
Length=781

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  573  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  632

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  633  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  692

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  693  QIQMKETVEE  702


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  704  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  763

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  764  RDYMERDKENPNQYNYIA  781



>ref|XP_008017652.1| PREDICTED: cullin-4B isoform X5 [Chlorocebus sabaeus]
Length=933

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  725  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  784

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  785  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  844

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  845  QIQMKETVEE  854


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  856  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  915

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  916  RDYMERDKENPNQYNYIA  933



>ref|XP_011227401.1| PREDICTED: cullin-4B isoform X1 [Ailuropoda melanoleuca]
Length=902

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  689  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  748

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  749  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  808

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  809  RIKINQIQMKETVEE  823


 Score =   135 bits (339),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>ref|XP_004685823.1| PREDICTED: cullin-4B isoform X1 [Condylura cristata]
Length=912

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  704  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  763

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  764  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  823

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  824  QIQMKETVEE  833


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  835  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  894

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  895  RDYMERDKENPNQYNYIA  912



>ref|XP_004762117.1| PREDICTED: cullin-4B isoform X4 [Mustela putorius furo]
 ref|XP_004816696.1| PREDICTED: cullin-4B isoform X4 [Mustela putorius furo]
Length=902

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  694  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  753

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  754  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  813

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  814  QIQMKETVEE  823


 Score =   135 bits (339),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>ref|XP_006257551.1| PREDICTED: cullin-4B isoform X1 [Rattus norvegicus]
Length=909

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  696  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  755

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  756  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  815

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  816  RIKINQIQMKETVEE  830


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  832  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  891

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  892  RDYMERDKENPNQYNYIA  909



>ref|XP_007122105.1| PREDICTED: cullin-4B-like isoform X1 [Physeter catodon]
Length=905

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  697  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  756

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  757  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  816

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  817  QIQMKETVEE  826


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  828  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  887

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  888  RDYMERDKENPNQYNYIA  905



>ref|XP_006082212.1| PREDICTED: cullin-4B isoform X3 [Myotis lucifugus]
Length=898

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  690  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  749

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  750  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  809

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  810  QIQMKETVEE  819


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  821  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  880

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  881  RDYMERDKENPNQYNYIA  898



>ref|XP_010819678.1| PREDICTED: cullin-4B isoform X5 [Bos taurus]
Length=781

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  573  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  632

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  633  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  692

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  693  QIQMKETVEE  702


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  704  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  763

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  764  RDYMERDKENPNQYNYIA  781



>ref|XP_008271380.1| PREDICTED: cullin-4B isoform X1 [Oryctolagus cuniculus]
 ref|XP_008271381.1| PREDICTED: cullin-4B isoform X1 [Oryctolagus cuniculus]
Length=912

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  704  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  763

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  764  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  823

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  824  QIQMKETVEE  833


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  835  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  894

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  895  RDYMERDKENPNQYNYIA  912



>ref|XP_011227402.1| PREDICTED: cullin-4B isoform X2 [Ailuropoda melanoleuca]
Length=900

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  687  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  746

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  747  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  806

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  807  RIKINQIQMKETVEE  821


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  823  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  882

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  883  RDYMERDKENPNQYNYIA  900



>gb|KFQ77299.1| Cullin-4B [Phaethon lepturus]
Length=887

 Score =   196 bits (498),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS 
Sbjct  679  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSL  738

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  739  EEIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKIN  798

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  799  QIQMKETVEE  808


 Score =   135 bits (339),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  810  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  869

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  870  RDYMERDKENPNQYNYIA  887



>ref|XP_008988096.1| PREDICTED: cullin-4B isoform X4 [Callithrix jacchus]
Length=921

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  713  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  772

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  773  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  832

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  833  QIQMKETVEE  842


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  844  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  903

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  904  RDYMERDKENPNQYNYIA  921



>ref|XP_008988093.1| PREDICTED: cullin-4B isoform X1 [Callithrix jacchus]
Length=913

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  700  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  759

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  760  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  819

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  820  RIKINQIQMKETVEE  834


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  836  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  895

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  896  RDYMERDKENPNQYNYIA  913



>ref|XP_008017651.1| PREDICTED: cullin-4B isoform X4 [Chlorocebus sabaeus]
Length=935

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  727  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  786

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  787  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  846

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  847  QIQMKETVEE  856


 Score =   135 bits (340),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  858  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  917

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  918  RDYMERDKENPNQYNYIA  935



>ref|XP_008585583.1| PREDICTED: cullin-4B isoform X1 [Galeopterus variegatus]
Length=895

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_007076302.1| PREDICTED: cullin-4B isoform X2 [Panthera tigris altaica]
Length=905

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  697  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  756

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  757  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  816

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  817  QIQMKETVEE  826


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  828  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  887

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  888  RDYMERDKENPNQYNYIA  905



>ref|XP_008271382.1| PREDICTED: cullin-4B isoform X3 [Oryctolagus cuniculus]
Length=902

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  694  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  753

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  754  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  813

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  814  QIQMKETVEE  823


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>ref|XP_004647716.1| PREDICTED: cullin-4B [Octodon degus]
Length=895

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_011376543.1| PREDICTED: cullin-4B isoform X1 [Pteropus vampyrus]
Length=932

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  724  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  783

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  784  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  843

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  844  QIQMKETVEE  853


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  855  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  914

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  915  RDYMERDKENPNQYNYIA  932



>ref|XP_007076301.1| PREDICTED: cullin-4B isoform X1 [Panthera tigris altaica]
Length=907

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  699  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  758

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  759  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  818

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  819  QIQMKETVEE  828


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  830  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  889

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  890  RDYMERDKENPNQYNYIA  907



>ref|XP_007076303.1| PREDICTED: cullin-4B isoform X3 [Panthera tigris altaica]
Length=896

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  688  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  747

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  748  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  807

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  808  QIQMKETVEE  817


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  819  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  878

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  879  RDYMERDKENPNQYNYIA  896



>ref|XP_006981626.1| PREDICTED: cullin-4B isoform X2 [Peromyscus maniculatus bairdii]
Length=894

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  686  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  745

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  746  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  805

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  806  QIQMKETVEE  815


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  817  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  876

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  877  RDYMERDKENPNQYNYIA  894



>ref|XP_008988094.1| PREDICTED: cullin-4B isoform X2 [Callithrix jacchus]
 ref|XP_010340008.1| PREDICTED: cullin-4B isoform X1 [Saimiri boliviensis boliviensis]
Length=902

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  689  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  748

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  749  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  808

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  809  RIKINQIQMKETVEE  823


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>ref|XP_006724847.1| PREDICTED: cullin-4B isoform X2 [Homo sapiens]
 ref|XP_008974986.1| PREDICTED: cullin-4B isoform X2 [Pan paniscus]
 ref|XP_009196471.1| PREDICTED: cullin-4B isoform X4 [Papio anubis]
 ref|XP_010353041.1| PREDICTED: cullin-4B isoform X1 [Rhinopithecus roxellana]
Length=902

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  689  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  748

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  749  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  808

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  809  RIKINQIQMKETVEE  823


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>ref|XP_005319406.1| PREDICTED: cullin-4B isoform X1 [Ictidomys tridecemlineatus]
Length=902

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  694  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  753

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  754  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  813

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  814  QIQMKETVEE  823


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>ref|XP_008271383.1| PREDICTED: cullin-4B isoform X4 [Oryctolagus cuniculus]
Length=901

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  693  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  752

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  753  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  812

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  813  QIQMKETVEE  822


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  824  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  883

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  884  RDYMERDKENPNQYNYIA  901



>ref|XP_010627872.1| PREDICTED: cullin-4B isoform X1 [Fukomys damarensis]
Length=896

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  683  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  742

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  743  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  802

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  803  RIKINQIQMKETVEE  817


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  819  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  878

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  879  RDYMERDKENPNQYNYIA  896



>ref|XP_004406978.1| PREDICTED: cullin-4B [Odobenus rosmarus divergens]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_004874660.1| PREDICTED: cullin-4B isoform X2 [Heterocephalus glaber]
Length=891

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  683  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  742

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  743  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  802

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  803  QIQMKETVEE  812


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  814  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  873

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  874  RDYMERDKENPNQYNYIA  891



>ref|XP_008585584.1| PREDICTED: cullin-4B isoform X2 [Galeopterus variegatus]
Length=893

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  685  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  744

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  745  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  804

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  805  QIQMKETVEE  814


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  816  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  875

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  876  RDYMERDKENPNQYNYIA  893



>ref|XP_005673911.1| PREDICTED: cullin-4B, partial [Sus scrofa]
Length=349

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  141  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  200

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  201  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  260

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  261  QIQMKETVEE  270


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  272  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  331

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  332  RDYMERDKENPNQYNYIA  349



>ref|XP_008017648.1| PREDICTED: cullin-4B isoform X1 [Chlorocebus sabaeus]
Length=974

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  761  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  820

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  821  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  880

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  881  RIKINQIQMKETVEE  895


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  897  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  956

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  957  RDYMERDKENPNQYNYIA  974



>ref|XP_004606393.1| PREDICTED: cullin-4B isoform X1 [Sorex araneus]
Length=894

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  681  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  740

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  741  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  800

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  801  RIKINQIQMKETVEE  815


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  817  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  876

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  877  RDYMERDKENPNQYNYIA  894



>ref|XP_004478393.1| PREDICTED: cullin-4B [Dasypus novemcinctus]
Length=831

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  623  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  682

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  683  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  742

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  743  QIQMKETVEE  752


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  754  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  813

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  814  RDYMERDKENPNQYNYIA  831



>ref|XP_006724848.1| PREDICTED: cullin-4B isoform X3 [Homo sapiens]
 ref|XP_008974987.1| PREDICTED: cullin-4B isoform X3 [Pan paniscus]
 ref|XP_009196473.1| PREDICTED: cullin-4B isoform X6 [Papio anubis]
 ref|XP_010353042.1| PREDICTED: cullin-4B isoform X2 [Rhinopithecus roxellana]
 gb|EAX11880.1| cullin 4B, isoform CRA_e [Homo sapiens]
Length=900

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  692  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  751

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  752  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  811

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  812  QIQMKETVEE  821


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  823  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  882

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  883  RDYMERDKENPNQYNYIA  900



>emb|CAD97843.1| hypothetical protein [Homo sapiens]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>gb|EFB16493.1| hypothetical protein PANDA_011593 [Ailuropoda melanoleuca]
Length=891

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  683  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  742

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  743  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  802

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  803  QIQMKETVEE  812


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  814  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  873

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  874  RDYMERDKENPNQYNYIA  891



>ref|XP_004437389.1| PREDICTED: cullin-4B [Ceratotherium simum simum]
Length=889

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  681  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  740

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  741  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  800

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  801  QIQMKETVEE  810


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  812  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  871

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  872  RDYMERDKENPNQYNYIA  889



>ref|XP_010819677.1| PREDICTED: cullin-4B isoform X3 [Bos taurus]
Length=918

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  710  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  769

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  770  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  829

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  830  QIQMKETVEE  839


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  841  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  900

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  901  RDYMERDKENPNQYNYIA  918



>ref|NP_001073341.1| cullin-4B isoform 2 [Homo sapiens]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_008988095.1| PREDICTED: cullin-4B isoform X3 [Callithrix jacchus]
 ref|XP_010340009.1| PREDICTED: cullin-4B isoform X2 [Saimiri boliviensis boliviensis]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_008538115.1| PREDICTED: cullin-4B isoform X1 [Equus przewalskii]
Length=891

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  683  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  742

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  743  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  802

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  803  QIQMKETVEE  812


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  814  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  873

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  874  RDYMERDKENPNQYNYIA  891



>ref|XP_010210224.1| PREDICTED: cullin-4B [Tinamus guttatus]
Length=883

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  675  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  734

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  735  EEIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKIN  794

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  795  QIQMKETVEE  804


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  806  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  865

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  866  RDYMERDKENPNQYNYIA  883



>ref|XP_008070821.1| PREDICTED: cullin-4B [Tarsius syrichta]
Length=896

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  688  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  747

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  748  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  807

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  808  QIQMKETVEE  817


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  819  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  878

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  879  RDYMERDKENPNQYNYIA  896



>ref|XP_008017649.1| PREDICTED: cullin-4B isoform X2 [Chlorocebus sabaeus]
Length=972

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  759  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  818

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  819  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  878

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  879  RIKINQIQMKETVEE  893


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  895  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  954

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  955  RDYMERDKENPNQYNYIA  972



>ref|XP_007530424.1| PREDICTED: cullin-4B isoform X1 [Erinaceus europaeus]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_004874659.1| PREDICTED: cullin-4B isoform X1 [Heterocephalus glaber]
Length=893

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  685  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  744

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  745  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  804

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  805  QIQMKETVEE  814


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  816  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  875

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  876  RDYMERDKENPNQYNYIA  893



>ref|XP_008538116.1| PREDICTED: cullin-4B isoform X2 [Equus przewalskii]
Length=889

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  681  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  740

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  741  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  800

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  801  QIQMKETVEE  810


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  812  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  871

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  872  RDYMERDKENPNQYNYIA  889



>ref|XP_005227530.1| PREDICTED: cullin-4B isoform X2 [Bos taurus]
Length=920

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  712  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  771

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  772  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  831

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  832  QIQMKETVEE  841


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  843  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  902

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  903  RDYMERDKENPNQYNYIA  920



>dbj|BAB28222.2| unnamed protein product [Mus musculus]
Length=915

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  702  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEG  761

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  762  EEFSLEEIKHATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  821

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  822  RIKINQIQMKETVEE  836


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  838  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  897

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  898  RDYMERDKENPNQYNYIA  915



>ref|XP_008017653.1| PREDICTED: cullin-4B isoform X6 [Chlorocebus sabaeus]
Length=941

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  728  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  787

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  788  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  847

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  848  RIKINQIQMKETVEE  862


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  864  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  923

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  924  RDYMERDKENPNQYNYIA  941



>ref|XP_004285634.1| PREDICTED: cullin-4B isoform 1 [Orcinus orca]
 ref|XP_004325656.1| PREDICTED: cullin-4B-like isoform 1 [Tursiops truncatus]
 ref|XP_007464486.1| PREDICTED: cullin-4B isoform X1 [Lipotes vexillifer]
Length=897

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  689  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  748

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  749  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  808

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  809  QIQMKETVEE  818


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  820  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  879

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  880  RDYMERDKENPNQYNYIA  897



>ref|XP_004379637.1| PREDICTED: cullin-4B isoform 1 [Trichechus manatus latirostris]
Length=896

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  688  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  747

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  748  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  807

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  808  QIQMKETVEE  817


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  819  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  878

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  879  RDYMERDKENPNQYNYIA  896



>ref|XP_010627873.1| PREDICTED: cullin-4B isoform X2 [Fukomys damarensis]
Length=894

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  681  EMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  740

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  741  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  800

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  801  RIKINQIQMKETVEE  815


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  817  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  876

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  877  RDYMERDKENPNQYNYIA  894



>ref|XP_006048866.1| PREDICTED: cullin-4B isoform X3 [Bubalus bubalis]
Length=917

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  709  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  768

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  769  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  828

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  829  QIQMKETVEE  838


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  840  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  899

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  900  RDYMERDKENPNQYNYIA  917



>ref|XP_006767871.1| PREDICTED: cullin-4B [Myotis davidii]
Length=894

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  686  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  745

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  746  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  805

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  806  QIQMKETVEE  815


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  817  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  876

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  877  RDYMERDKENPNQYNYIA  894



>ref|XP_002699556.2| PREDICTED: cullin-4B isoform X4 [Bos taurus]
Length=903

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  695  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  754

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  755  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  814

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  815  QIQMKETVEE  824


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  826  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  885

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  886  RDYMERDKENPNQYNYIA  903



>ref|XP_006048867.1| PREDICTED: cullin-4B isoform X4 [Bubalus bubalis]
Length=902

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  694  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  753

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  754  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  813

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  814  QIQMKETVEE  823


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  825  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  884

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  885  RDYMERDKENPNQYNYIA  902



>ref|XP_006048864.1| PREDICTED: cullin-4B isoform X1 [Bubalus bubalis]
 ref|XP_006048865.1| PREDICTED: cullin-4B isoform X2 [Bubalus bubalis]
Length=919

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  711  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  770

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  771  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  830

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  831  QIQMKETVEE  840


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  842  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  901

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  902  RDYMERDKENPNQYNYIA  919



>ref|XP_006917880.1| PREDICTED: cullin-4B [Pteropus alecto]
Length=896

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  688  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  747

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  748  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  807

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  808  QIQMKETVEE  817


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  819  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  878

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  879  RDYMERDKENPNQYNYIA  896



>ref|XP_006885130.1| PREDICTED: cullin-4B-like isoform X1 [Elephantulus edwardii]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_007122106.1| PREDICTED: cullin-4B-like isoform X2 [Physeter catodon]
Length=898

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  690  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  749

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  750  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  809

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  810  QIQMKETVEE  819


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  821  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  880

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  881  RDYMERDKENPNQYNYIA  898



>dbj|BAK62681.1| cullin-4B [Pan troglodytes]
Length=509

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  301  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  360

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  361  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  420

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  421  QIQMKETVEE  430


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  432  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  491

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  492  RDYMERDKENPNQYNYIA  509



>ref|XP_011376546.1| PREDICTED: cullin-4B isoform X3 [Pteropus vampyrus]
Length=925

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  717  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  776

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  777  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  836

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  837  QIQMKETVEE  846


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  848  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  907

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  908  RDYMERDKENPNQYNYIA  925



>dbj|BAG53936.1| unnamed protein product [Homo sapiens]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_004606394.1| PREDICTED: cullin-4B isoform X2 [Sorex araneus]
Length=892

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  684  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  743

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  744  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  803

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  804  QIQMKETVEE  813


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  815  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  874

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  875  RDYMERDKENPNQYNYIA  892



>ref|XP_003465638.1| PREDICTED: cullin-4B [Cavia porcellus]
Length=895

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  687  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  746

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  747  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  806

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  807  QIQMKETVEE  816


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  818  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  877

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  878  RDYMERDKENPNQYNYIA  895



>ref|XP_007060188.1| PREDICTED: cullin-4B [Chelonia mydas]
Length=883

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  675  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  734

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  735  EEIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKIN  794

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  795  QIQMKETVEE  804


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  806  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  865

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  866  RDYMERDKENPNQYNYIA  883



>ref|NP_001116316.1| cullin-4B [Danio rerio]
Length=864

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  656  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  715

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            +DIK A GIED ELRRTLQSLACGK RVL KIPK +DVED D F  ND F   L+RIK+N
Sbjct  716  EDIKLATGIEDSELRRTLQSLACGKARVLTKIPKSKDVEDGDKFSCNDDFKHKLFRIKIN  775

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  776  QIQMKETVEE  785


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  787  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  846

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  847  RDYMERDKENPNQYNYVA  864



>gb|AAB67315.1| Very similar and perhaps identical to Hs-CUL-4B.; 80-100% similarity 
to partial sequence U58091 (PID:g1381150) [Homo sapiens]
Length=652

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  444  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  503

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  504  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  563

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  564  QIQMKETVEE  573


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  575  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  634

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  635  RDYMERDKENPNQYNYIA  652



>gb|AAC50548.1| Hs-CUL-4B, partial [Homo sapiens]
Length=288

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  80   QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  139

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  140  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  199

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  200  QIQMKETVEE  209


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  211  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  270

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  271  RDYMERDKENPNQYNYIA  288



>ref|XP_008171287.1| PREDICTED: cullin-4B isoform X2 [Chrysemys picta bellii]
Length=780

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  572  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  631

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  632  EEIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKIN  691

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  692  QIQMKETVEE  701


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  703  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  762

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  763  RDYMERDKENPNQYNYIA  780



>ref|XP_010592962.1| PREDICTED: cullin-4B isoform X1 [Loxodonta africana]
Length=903

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  695  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  754

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  755  EEIKHATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  814

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  815  QIQMKETVEE  824


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  826  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  885

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  886  RDYMERDKENPNQYNYIA  903



>gb|AAH36216.1| Cullin 4B [Homo sapiens]
 gb|AAX42462.1| cullin 4B [synthetic construct]
 gb|ABM85676.1| cullin 4B [synthetic construct]
 gb|AIC55412.1| CUL4B, partial [synthetic construct]
Length=913

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  764  ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA  585
            E+   Q+IFK FYL K+SGR+L WQ+++GHCVLKAEF +G+KEL VS FQT+VL++FNE 
Sbjct  700  EMVKLQEIFKTFYLGKHSGRKLQWQSTIGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEG  759

Query  584  EKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLY  405
            E+FS ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+
Sbjct  760  EEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLF  819

Query  404  RIKVNAIQMKETVEE  360
            RIK+N IQMKETVEE
Sbjct  820  RIKINQIQMKETVEE  834


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  836  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  895

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  896  RDYMERDKENPNQYNYIA  913



>ref|XP_006632966.1| PREDICTED: cullin-4B-like [Lepisosteus oculatus]
Length=860

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  652  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  711

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            +DIK+A GIED ELRRTLQSLACGK RVL K PK +DVED D F  ND F   L+RIK+N
Sbjct  712  EDIKQATGIEDSELRRTLQSLACGKARVLTKTPKSKDVEDGDKFTCNDDFRHKLFRIKIN  771

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  772  QIQMKETVEE  781


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  783  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  842

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  843  RDYMERDKENPNQYNYVA  860



>ref|XP_006215961.1| PREDICTED: cullin-4B isoform X1 [Vicugna pacos]
Length=899

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  691  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  750

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  751  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  810

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  811  QIQMKETVEE  820


 Score =   135 bits (339),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  822  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  881

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  882  RDYMERDKENPNQYNYIA  899



>ref|XP_420335.2| PREDICTED: cullin-4B [Gallus gallus]
Length=883

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  675  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  734

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+DVED D F  ND F   L+RIK+N
Sbjct  735  EEIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKIN  794

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  795  QIQMKETVEE  804


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  806  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  865

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  866  RDYMERDKENPNQYNYIA  883



>pdb|4A0L|E Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
 pdb|4A0L|H Chain H, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
Length=726

 Score =   195 bits (495),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  749  QDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF  570
            Q+IFK FYL K+SGR+L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS 
Sbjct  518  QEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSL  577

Query  569  QDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN  390
            ++IK+A GIED ELRRTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N
Sbjct  578  EEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKIN  637

Query  389  AIQMKETVEE  360
             IQMKETVEE
Sbjct  638  QIQMKETVEE  647


 Score =   135 bits (340),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  357  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID  178
             STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLID
Sbjct  649  ASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLID  708

Query  177  REYLERDKSNPQIYNYLA  124
            R+Y+ERDK NP  YNY+A
Sbjct  709  RDYMERDKENPNQYNYIA  726



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890