BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001H24

Length=752
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...    168   2e-45   Theobroma cacao [chocolate]
ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    163   2e-43   Citrus sinensis [apfelsine]
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg             163   3e-43   Citrus clementina [clementine]
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    162   3e-43   Vitis vinifera
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     161   1e-42   Populus euphratica
ref|XP_002311458.2|  zinc finger family protein                         160   2e-42   Populus trichocarpa [western balsam poplar]
gb|KJB16228.1|  hypothetical protein B456_002G218400                    160   2e-42   Gossypium raimondii
ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    159   5e-42   Nicotiana sylvestris
emb|CDO98435.1|  unnamed protein product                                159   6e-42   Coffea canephora [robusta coffee]
ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    157   2e-41   Nicotiana tomentosiformis
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein              156   7e-41   Gossypium arboreum [tree cotton]
gb|AFX73409.1|  constans-like protein 5                                 155   9e-41   Gossypium hirsutum [American cotton]
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    155   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16               154   5e-40   Morus notabilis
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    154   6e-40   Populus euphratica
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    153   7e-40   Nelumbo nucifera [Indian lotus]
ref|XP_002531628.1|  conserved hypothetical protein                     154   1e-39   Ricinus communis
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6                152   2e-39   
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg             150   4e-39   Citrus clementina [clementine]
ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    151   5e-39   Nicotiana tomentosiformis
gb|AGM20692.1|  COL6-2                                                  151   8e-39   Populus tomentosa [Chinese white poplar]
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    150   1e-38   Nicotiana sylvestris
gb|AHI45078.1|  COL domain class transcription factor                   150   1e-38   Boehmeria nivea [Chinese silk-plant]
gb|KHN05568.1|  Zinc finger protein CONSTANS-LIKE 16                    145   1e-38   Glycine soja [wild soybean]
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   3e-38   Solanum lycopersicum
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    148   3e-38   Citrus sinensis [apfelsine]
emb|CDP00619.1|  unnamed protein product                                149   3e-38   Coffea canephora [robusta coffee]
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   5e-38   Populus euphratica
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like          147   8e-38   Glycine max [soybeans]
ref|NP_001239992.1|  uncharacterized protein LOC100802113               146   9e-38   
ref|XP_002533412.1|  transcription factor, putative                     147   1e-37   Ricinus communis
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    147   2e-37   Eucalyptus grandis [rose gum]
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    146   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135402.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    146   3e-37   
gb|KGN52081.1|  hypothetical protein Csa_5G609670                       146   3e-37   Cucumis sativus [cucumbers]
gb|AEF12203.1|  CONSTANS-like zinc finger protein                       145   6e-37   Glycine max [soybeans]
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    145   6e-37   Vitis vinifera
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    145   7e-37   Solanum tuberosum [potatoes]
emb|CAN73757.1|  hypothetical protein VITISV_026326                     145   1e-36   Vitis vinifera
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    144   2e-36   Cucumis melo [Oriental melon]
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    143   3e-36   Glycine max [soybeans]
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                    143   3e-36   Glycine soja [wild soybean]
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    144   4e-36   Eucalyptus grandis [rose gum]
gb|KDP20116.1|  hypothetical protein JCGZ_05885                         143   5e-36   Jatropha curcas
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   5e-36   Nicotiana sylvestris
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g             142   5e-36   Phaseolus vulgaris [French bean]
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   5e-36   Nicotiana tomentosiformis
gb|AHI45077.1|  COL domain class transcription factor                   143   6e-36   Boehmeria nivea [Chinese silk-plant]
ref|XP_003637430.1|  Zinc finger protein CONSTANS-like protein          136   7e-36   
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   1e-35   
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   1e-35   Solanum lycopersicum
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    141   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    141   2e-35   
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   3e-35   Elaeis guineensis
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                     139   4e-35   Lagerstroemia indica [crape-myrtle]
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   4e-35   Pyrus x bretschneideri [bai li]
gb|KDP29405.1|  hypothetical protein JCGZ_18326                         140   4e-35   Jatropha curcas
ref|XP_006829901.1|  hypothetical protein AMTR_s00073p00061640          139   5e-35   Amborella trichopoda
gb|AEF12205.1|  CONSTANS-like zinc finger protein                       140   5e-35   Glycine max [soybeans]
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    139   7e-35   Phoenix dactylifera
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g             139   7e-35   
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg             139   1e-34   
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   2e-34   Solanum tuberosum [potatoes]
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   2e-34   Prunus mume [ume]
ref|XP_007036519.1|  Transcription factor, putative                     138   2e-34   
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    138   3e-34   Solanum lycopersicum
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein              137   4e-34   Gossypium arboreum [tree cotton]
gb|KEH44219.1|  zinc finger constans-like protein                       137   5e-34   Medicago truncatula
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     137   5e-34   Malus domestica [apple tree]
gb|KJB34354.1|  hypothetical protein B456_006G061600                    137   6e-34   Gossypium raimondii
gb|KJB34352.1|  hypothetical protein B456_006G061600                    137   7e-34   Gossypium raimondii
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   9e-34   
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    136   1e-33   Populus euphratica
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     136   1e-33   Sesamum indicum [beniseed]
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    136   2e-33   Fragaria vesca subsp. vesca
gb|ADK63396.1|  B-box type zinc finger protein                          132   3e-33   Brassica rapa
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   3e-33   Solanum tuberosum [potatoes]
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   4e-33   
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   4e-33   
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   4e-33   
ref|XP_004164163.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   6e-33   
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g             134   6e-33   Phaseolus vulgaris [French bean]
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                     134   7e-33   Lagerstroemia indica [crape-myrtle]
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   1e-32   Tarenaya hassleriana [spider flower]
emb|CDY07383.1|  BnaA07g24620D                                          130   1e-32   Brassica napus [oilseed rape]
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    133   2e-32   Cicer arietinum [garbanzo]
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    132   3e-32   Fragaria vesca subsp. vesca
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16               132   4e-32   Morus notabilis
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   6e-32   Cucumis melo [Oriental melon]
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                    131   6e-32   Arabis alpina [alpine rockcress]
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg             131   7e-32   Prunus persica
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   7e-32   Cucumis sativus [cucumbers]
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg             131   7e-32   Eutrema salsugineum [saltwater cress]
emb|CDY44890.1|  BnaA02g13920D                                          130   1e-31   Brassica napus [oilseed rape]
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     130   1e-31   Brassica rapa
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   1e-31   Prunus mume [ume]
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE59794.1|  hypothetical protein OsJ_12314                          125   2e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDX81527.1|  BnaC02g18310D                                          129   2e-31   
gb|KJB23747.1|  hypothetical protein B456_004G113000                    130   3e-31   Gossypium raimondii
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     130   3e-31   
emb|CDY03851.1|  BnaC07g10760D                                          129   3e-31   
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   3e-31   
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   5e-31   
emb|CDY53119.1|  BnaCnng24470D                                          128   6e-31   Brassica napus [oilseed rape]
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   6e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002888669.1|  zinc finger (B-box type) family protein            128   7e-31   Arabidopsis lyrata subsp. lyrata
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg                128   9e-31   Erythranthe guttata [common monkey flower]
emb|CDY04230.1|  BnaC06g25850D                                          124   2e-30   
ref|XP_006656860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    126   2e-30   
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...    126   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                   126   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg             126   5e-30   Capsella rubella
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    126   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   7e-30   Camelina sativa [gold-of-pleasure]
emb|CDY65591.1|  BnaC05g50730D                                          124   8e-30   Brassica napus [oilseed rape]
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   8e-30   Camelina sativa [gold-of-pleasure]
ref|NP_001051053.1|  Os03g0711100                                       125   9e-30   
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg             125   9e-30   Capsella rubella
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg             125   9e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   1e-29   Camelina sativa [gold-of-pleasure]
emb|CDX77359.1|  BnaC08g04040D                                          120   1e-29   
gb|AAM61001.1|  putative B-box zinc finger protein                      125   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABF98510.1|  CCT motif family protein, expressed                     124   2e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CDY51133.1|  BnaA07g37160D                                          124   2e-29   Brassica napus [oilseed rape]
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     124   3e-29   Brachypodium distachyon [annual false brome]
gb|AFK49208.1|  unknown                                                 119   5e-29   Medicago truncatula
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS53816.1|  Zinc finger protein CONSTANS-LIKE 16                    120   2e-28   Triticum urartu
emb|CDY67920.1|  BnaAnng25560D                                          120   2e-28   Brassica napus [oilseed rape]
gb|EAZ36554.1|  hypothetical protein OsJ_20892                          122   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   2e-28   
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   2e-28   Cicer arietinum [garbanzo]
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   3e-28   Camelina sativa [gold-of-pleasure]
gb|AAG50803.1|AC079281_5  zinc finger protein, putative                 121   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   3e-28   Brassica rapa
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                  121   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13173.1|  unknown protein                                         121   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420          121   3e-28   Sorghum bicolor [broomcorn]
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829             120   3e-28   
gb|EMT27110.1|  hypothetical protein F775_43077                         120   4e-28   
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   5e-28   Setaria italica
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   5e-28   Brassica rapa
ref|XP_006649016.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   6e-28   Oryza brachyantha
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     120   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                  119   9e-28   Medicago truncatula
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   1e-27   
gb|KGN63817.1|  hypothetical protein Csa_1G023050                       118   2e-27   Cucumis sativus [cucumbers]
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                   118   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg                118   2e-27   Erythranthe guttata [common monkey flower]
gb|ACX42573.1|  CONSTANS-like zinc finger protein                       118   2e-27   Glycine max [soybeans]
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    118   3e-27   
gb|EAZ00428.1|  hypothetical protein OsI_22452                          118   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    117   4e-27   Cucumis melo [Oriental melon]
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g             117   5e-27   Phaseolus vulgaris [French bean]
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g             117   5e-27   Phaseolus vulgaris [French bean]
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   6e-27   
gb|AEF12200.1|  CONSTANS-like zinc finger protein                       117   6e-27   Glycine max [soybeans]
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg             117   9e-27   Capsella rubella
dbj|BAK01505.1|  predicted protein                                      116   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFX97569.1|  K                                                       112   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002887511.1|  zinc finger (B-box type) family protein            115   2e-26   
gb|AFK37106.1|  unknown                                                 115   2e-26   Medicago truncatula
dbj|BAK04456.1|  predicted protein                                      115   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001149548.1|  CCT motif family protein                           115   3e-26   Zea mays [maize]
gb|AFX97570.1|  K                                                       111   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    115   4e-26   Brachypodium distachyon [annual false brome]
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    115   4e-26   
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    115   5e-26   
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   6e-26   
gb|EPS73837.1|  hypothetical protein M569_00919                         114   8e-26   Genlisea aurea
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg                114   9e-26   Erythranthe guttata [common monkey flower]
ref|NP_001048022.1|  Os02g0731700                                       112   1e-25   
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    113   2e-25   Phoenix dactylifera
gb|EEC73943.1|  hypothetical protein OsI_08813                          112   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    112   3e-25   Elaeis guineensis
gb|ACL53155.1|  unknown                                                 108   3e-25   Zea mays [maize]
ref|NP_001057333.2|  Os06g0264200                                       112   4e-25   
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16               112   4e-25   Zea mays [maize]
dbj|BAD15937.1|  zinc finger protein-like                               112   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                    112   5e-25   
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920          112   8e-25   
emb|CDY24402.1|  BnaCnng04690D                                          110   9e-25   Brassica napus [oilseed rape]
gb|ACF84125.1|  unknown                                                 108   1e-24   Zea mays [maize]
dbj|BAJ87752.1|  predicted protein                                      111   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGI62036.1|  CONSTANS-like 12                                        110   1e-24   Erycina pusilla
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   2e-24   Zea mays [maize]
ref|XP_009381104.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480          109   5e-24   Sorghum bicolor [broomcorn]
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   1e-23   
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000             107   2e-23   Selaginella moellendorffii
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834             107   3e-23   Selaginella moellendorffii
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    107   3e-23   
ref|NP_001140584.1|  uncharacterized protein LOC100272654               107   3e-23   Zea mays [maize]
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    106   4e-23   Setaria italica
ref|XP_001771896.1|  predicted protein                                  107   4e-23   
ref|XP_001769011.1|  predicted protein                                  106   9e-23   
gb|EMT01944.1|  hypothetical protein F775_21198                         101   1e-21   
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   3e-21   Tarenaya hassleriana [spider flower]
emb|CBI15893.3|  unnamed protein product                              95.5    4e-21   Vitis vinifera
ref|XP_008354841.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.2    7e-21   
ref|XP_009354295.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.4    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_010519196.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_010685899.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   96.3    4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006488582.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  96.3    4e-20   Citrus sinensis [apfelsine]
ref|XP_004294775.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   95.9    5e-20   Fragaria vesca subsp. vesca
ref|XP_008384739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  95.9    5e-20   Malus domestica [apple tree]
ref|XP_009369559.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  95.9    5e-20   Pyrus x bretschneideri [bai li]
gb|KDP45740.1|  hypothetical protein JCGZ_17347                       95.5    6e-20   Jatropha curcas
ref|XP_006425148.1|  hypothetical protein CICLE_v10029146mg           95.5    7e-20   Citrus clementina [clementine]
ref|XP_007016977.1|  CCT motif family protein isoform 2               94.7    1e-19   
ref|XP_002274679.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   94.4    1e-19   Vitis vinifera
ref|XP_011003377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   93.6    2e-19   Populus euphratica
ref|XP_008797174.1|  PREDICTED: uncharacterized protein LOC103712429  94.4    2e-19   Phoenix dactylifera
ref|XP_008799931.1|  PREDICTED: uncharacterized protein LOC103714457  94.4    3e-19   Phoenix dactylifera
ref|XP_008665284.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  95.9    3e-19   Zea mays [maize]
ref|XP_008354834.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.6    3e-19   
gb|KHN40106.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                93.2    3e-19   Glycine soja [wild soybean]
ref|XP_003544900.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.6    3e-19   Glycine max [soybeans]
ref|XP_009125969.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.7    3e-19   
ref|XP_001769217.1|  predicted protein                                96.7    4e-19   
ref|XP_006574444.1|  PREDICTED: uncharacterized protein LOC100803...  92.8    5e-19   
ref|XP_007206389.1|  hypothetical protein PRUPE_ppa018053mg           93.2    5e-19   Prunus persica
ref|XP_009354286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.8    5e-19   Pyrus x bretschneideri [bai li]
ref|XP_011010948.1|  PREDICTED: uncharacterized protein LOC105115687  93.6    7e-19   Populus euphratica
ref|XP_008233500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   92.8    7e-19   Prunus mume [ume]
ref|XP_010938521.1|  PREDICTED: uncharacterized protein LOC105057575  92.4    8e-19   Elaeis guineensis
ref|XP_008799492.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  94.0    1e-18   
ref|XP_003615824.1|  Zinc finger protein CONSTANS-like protein        91.7    1e-18   Medicago truncatula
ref|XP_002298500.1|  CONSTANS-like family protein                     91.7    1e-18   
ref|XP_001765504.1|  predicted protein                                94.7    1e-18   
ref|XP_006453246.1|  hypothetical protein CICLE_v10008308mg           94.0    1e-18   Citrus clementina [clementine]
ref|XP_010927568.1|  PREDICTED: uncharacterized protein LOC105049568  91.7    1e-18   
ref|XP_009383142.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.8    1e-18   
gb|KFK25676.1|  hypothetical protein AALP_AA8G144900                  92.8    1e-18   Arabis alpina [alpine rockcress]
emb|CDX70561.1|  BnaC03g06450D                                        89.7    2e-18   
ref|XP_006286526.1|  hypothetical protein CARUB_v10001375mg           92.4    2e-18   
ref|XP_007142158.1|  hypothetical protein PHAVU_008G257300g           91.3    2e-18   Phaseolus vulgaris [French bean]
ref|XP_010046933.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.8    2e-18   Eucalyptus grandis [rose gum]
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   91.7    3e-18   
emb|CDY09849.1|  BnaC09g43120D                                        91.7    3e-18   Brassica napus [oilseed rape]
emb|CDX91067.1|  BnaC02g05300D                                        91.7    3e-18   
ref|XP_004490653.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  90.1    3e-18   Cicer arietinum [garbanzo]
ref|XP_010539413.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  92.8    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_010111554.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           92.8    3e-18   
gb|EPS70097.1|  hypothetical protein M569_04667                       86.7    3e-18   Genlisea aurea
ref|XP_010927244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    4e-18   Elaeis guineensis
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg           91.3    4e-18   
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg           91.3    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009420122.1|  PREDICTED: uncharacterized protein LOC103999941  91.3    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI17712.3|  unnamed protein product                              90.9    5e-18   Vitis vinifera
ref|XP_010273555.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    5e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002268929.1|  PREDICTED: uncharacterized protein LOC100254358  90.9    5e-18   Vitis vinifera
ref|XP_010264549.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   90.1    5e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009121672.1|  PREDICTED: uncharacterized protein LOC103846490  90.9    6e-18   Brassica rapa
emb|CDX69586.1|  BnaA10g19350D                                        90.9    6e-18   
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  90.9    6e-18   Arabis alpina [alpine rockcress]
emb|CDX78575.1|  BnaA03g04870D                                        90.5    6e-18   
ref|XP_008230480.1|  PREDICTED: uncharacterized protein LOC103329755  90.9    6e-18   Prunus mume [ume]
gb|AGI62031.1|  CONSTANS-like 7                                       90.5    7e-18   Erycina pusilla
ref|XP_010690879.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.7    7e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002268213.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.3    7e-18   Vitis vinifera
emb|CAN72725.1|  hypothetical protein VITISV_015092                   91.3    7e-18   Vitis vinifera
emb|CAN75558.1|  hypothetical protein VITISV_028190                   90.1    1e-17   Vitis vinifera
ref|XP_010557193.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   89.0    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_011017668.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.7    1e-17   Populus euphratica
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757           90.1    1e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_007014423.1|  Chloroplast import apparatus 2, putative iso...  90.9    1e-17   
emb|CBI40095.3|  unnamed protein product                              90.5    1e-17   Vitis vinifera
gb|KJB56256.1|  hypothetical protein B456_009G113000                  88.6    1e-17   Gossypium raimondii
emb|CDP09243.1|  unnamed protein product                              86.7    1e-17   
gb|KDP41094.1|  hypothetical protein JCGZ_03224                       90.9    1e-17   
ref|XP_006399947.1|  hypothetical protein EUTSA_v10014044mg           89.7    1e-17   
ref|XP_010248760.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   89.7    2e-17   
emb|CDX85600.1|  BnaA02g02130D                                        89.4    2e-17   
ref|XP_010932278.1|  PREDICTED: uncharacterized protein LOC105052987  89.0    2e-17   
ref|XP_010492239.1|  PREDICTED: uncharacterized protein LOC104769672  89.4    2e-17   
gb|KDP46366.1|  hypothetical protein JCGZ_10206                       89.4    2e-17   
gb|AAM63153.1|  unknown                                               89.0    2e-17   
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.0    2e-17   
ref|NP_568300.1|  CCT motif family protein                            89.4    2e-17   
ref|XP_001759088.1|  predicted protein                                91.3    2e-17   
ref|XP_002324691.2|  hypothetical protein POPTR_0018s13890g           90.5    2e-17   
ref|XP_009340847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.7    3e-17   
ref|XP_010420071.1|  PREDICTED: uncharacterized protein LOC104705709  89.0    3e-17   
ref|XP_006362450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    3e-17   
ref|XP_009131400.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.2    4e-17   
gb|EMS51379.1|  Zinc finger protein CONSTANS-LIKE 6                   87.8    4e-17   
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    4e-17   
gb|KGN61175.1|  hypothetical protein Csa_2G061540                     89.7    4e-17   
ref|XP_010453557.1|  PREDICTED: uncharacterized protein LOC104735456  88.2    5e-17   
ref|XP_004242804.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.4    5e-17   
ref|XP_006447220.1|  hypothetical protein CICLE_v10015864mg           88.2    5e-17   
ref|XP_008451201.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.0    6e-17   
ref|XP_008379178.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   87.8    7e-17   
ref|XP_007216840.1|  hypothetical protein PRUPE_ppa022528mg           87.4    7e-17   
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           87.4    7e-17   
ref|XP_010487064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    8e-17   
ref|XP_010457868.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    9e-17   
gb|EMS59726.1|  Zinc finger protein CONSTANS-LIKE 6                   85.5    9e-17   
ref|XP_010929359.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  88.6    9e-17   
ref|XP_004138344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    9e-17   
emb|CDY52734.1|  BnaC09g53340D                                        87.8    1e-16   
ref|XP_004507897.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    1e-16   
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    1e-16   
ref|XP_009590839.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    1e-16   
ref|XP_009593986.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    2e-16   
ref|XP_009801175.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    2e-16   
ref|XP_003543009.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    2e-16   
ref|XP_009370323.1|  PREDICTED: uncharacterized protein LOC103959692  86.7    2e-16   
gb|EYU18216.1|  hypothetical protein MIMGU_mgv1a007342mg              87.4    2e-16   
gb|KDO45660.1|  hypothetical protein CISIN_1g017778mg                 86.3    2e-16   
ref|XP_002873661.1|  hypothetical protein ARALYDRAFT_488277           86.3    2e-16   
ref|XP_011024893.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.1    2e-16   
ref|XP_011097346.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    2e-16   
ref|XP_010927243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    2e-16   
ref|XP_004296491.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    2e-16   
ref|XP_007016976.1|  CCT motif family protein isoform 1               85.5    2e-16   
ref|XP_007225066.1|  hypothetical protein PRUPE_ppa018578mg           87.4    3e-16   
ref|XP_002308112.2|  hypothetical protein POPTR_0006s07490g           87.8    3e-16   
ref|XP_007031686.1|  CCT motif family protein, putative               86.3    3e-16   
ref|XP_009349161.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    3e-16   
ref|XP_009371730.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   86.3    3e-16   
gb|KFK43009.1|  hypothetical protein AALP_AA1G067400                  84.3    3e-16   
gb|KHN46121.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                84.7    3e-16   
ref|XP_009410222.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.7    4e-16   
ref|XP_006425147.1|  hypothetical protein CICLE_v10029146mg           84.7    4e-16   
ref|XP_010433566.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    4e-16   
gb|EMT29986.1|  hypothetical protein F775_13638                       84.7    5e-16   
ref|XP_008223874.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.7    5e-16   
emb|CDY38274.1|  BnaA10g11220D                                        86.3    5e-16   
gb|KJB33887.1|  hypothetical protein B456_006G036400                  85.1    5e-16   
ref|XP_001752335.1|  predicted protein                                80.5    5e-16   
ref|NP_568852.2|  chloroplast import apparatus 2 protein              86.3    6e-16   
ref|XP_004231827.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  84.7    6e-16   
ref|XP_009120241.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.9    7e-16   
gb|KFK27272.1|  hypothetical protein AALP_AA8G360600                  85.9    8e-16   
ref|XP_010451861.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    8e-16   
ref|XP_007154713.1|  hypothetical protein PHAVU_003G141200g           85.5    8e-16   
ref|XP_011020038.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.9    9e-16   
dbj|BAK01784.1|  predicted protein                                    84.0    1e-15   
ref|XP_008388630.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    1e-15   
gb|KDO67019.1|  hypothetical protein CISIN_1g025320mg                 83.6    1e-15   
ref|XP_010099464.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           83.2    1e-15   
dbj|BAJ85986.1|  predicted protein                                    83.6    1e-15   
ref|XP_009359939.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    1e-15   
ref|XP_010483220.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    1e-15   
ref|XP_006401232.1|  hypothetical protein EUTSA_v10013517mg           85.5    1e-15   
ref|NP_563778.1|  CCT motif family protein                            82.4    1e-15   
ref|XP_006280489.1|  hypothetical protein CARUB_v10026429mg           85.1    1e-15   
ref|XP_002451540.1|  hypothetical protein SORBIDRAFT_04g003470        85.5    1e-15   
ref|XP_010443395.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    2e-15   
ref|XP_011094103.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    2e-15   
ref|XP_006417850.1|  hypothetical protein EUTSA_v10008808mg           82.4    2e-15   
ref|XP_008811451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.1    2e-15   
ref|XP_010448341.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    2e-15   
ref|XP_006338638.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.6    2e-15   
gb|KJB33888.1|  hypothetical protein B456_006G036400                  83.6    2e-15   
ref|XP_006646882.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.1    2e-15   
ref|XP_001751672.1|  predicted protein                                85.1    2e-15   
ref|XP_009403041.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    2e-15   
ref|XP_010690870.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    2e-15   
ref|XP_001758440.1|  predicted protein                                84.7    2e-15   
ref|XP_002892377.1|  predicted protein                                81.6    2e-15   
ref|XP_002520096.1|  hypothetical protein RCOM_1709850                78.2    3e-15   
ref|NP_567737.1|  CIA2-like transcription factor                      84.0    3e-15   
emb|CDY42238.1|  BnaC02g11770D                                        83.6    4e-15   
ref|XP_006596439.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    4e-15   
emb|CDY47926.1|  BnaA02g08300D                                        83.6    4e-15   
emb|CDY66177.1|  BnaC08g46470D                                        81.3    4e-15   
emb|CDP15779.1|  unnamed protein product                              84.0    4e-15   
gb|ABF00989.1|  putative stress resistance-related protein            84.0    4e-15   
dbj|BAJ92256.1|  predicted protein                                    83.6    4e-15   
ref|XP_009110963.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.9    4e-15   
ref|XP_006453244.1|  hypothetical protein CICLE_v10008308mg           83.6    5e-15   
ref|XP_004499509.1|  PREDICTED: uncharacterized protein LOC101500...  82.0    6e-15   
ref|XP_006453248.1|  hypothetical protein CICLE_v10008308mg           83.2    6e-15   
gb|KDO61917.1|  hypothetical protein CISIN_1g0135002mg                83.2    6e-15   
gb|KDO61918.1|  hypothetical protein CISIN_1g0135002mg                83.2    6e-15   
ref|XP_002867585.1|  hypothetical protein ARALYDRAFT_354188           82.8    6e-15   
emb|CDY10244.1|  BnaC05g04870D                                        80.5    7e-15   
ref|XP_002864503.1|  hypothetical protein ARALYDRAFT_495815           83.2    7e-15   
ref|XP_010438814.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.8    7e-15   
ref|XP_001769056.1|  predicted protein                                77.0    8e-15   
ref|NP_001147813.1|  LOC100281423                                     83.2    9e-15   
gb|KHG21982.1|  Zinc finger CONSTANS-LIKE 7 -like protein             81.6    9e-15   
ref|XP_008677196.1|  PREDICTED: LOC100281423 isoform X1               83.2    9e-15   
ref|XP_010524282.1|  PREDICTED: uncharacterized protein LOC104802388  82.0    1e-14   
ref|XP_003549301.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    1e-14   
gb|EYU34766.1|  hypothetical protein MIMGU_mgv1a008504mg              81.6    1e-14   
ref|XP_004304686.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   81.3    1e-14   
ref|XP_011467357.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    1e-14   
ref|XP_006283882.1|  hypothetical protein CARUB_v10004999mg           81.6    2e-14   
ref|XP_001754240.1|  predicted protein                                75.9    2e-14   
ref|XP_009126853.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    2e-14   
ref|XP_007140857.1|  hypothetical protein PHAVU_008G147400g           80.9    2e-14   
ref|NP_001169082.1|  uncharacterized protein LOC100382924             82.4    2e-14   
ref|XP_002964550.1|  hypothetical protein SELMODRAFT_38981            75.9    2e-14   
ref|XP_002993117.1|  hypothetical protein SELMODRAFT_136568           76.3    2e-14   
ref|XP_009410221.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    2e-14   
ref|XP_004142772.1|  PREDICTED: uncharacterized protein LOC101217596  80.5    2e-14   
ref|XP_004156700.1|  PREDICTED: uncharacterized LOC101217596          80.5    2e-14   
ref|XP_007142159.1|  hypothetical protein PHAVU_008G257300g           79.0    3e-14   
ref|XP_008458850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   80.1    3e-14   
ref|XP_010236261.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    3e-14   
emb|CDY06672.1|  BnaA10g04510D                                        78.6    3e-14   
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           79.3    3e-14   
ref|XP_009119001.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    3e-14   
ref|XP_008645243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.3    4e-14   
ref|XP_010487055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  78.2    4e-14   
ref|XP_006850881.1|  hypothetical protein AMTR_s00025p00156240        80.9    5e-14   
ref|XP_007014424.1|  Chloroplast import apparatus 2, putative iso...  80.5    5e-14   
ref|XP_010323337.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.5    6e-14   
ref|XP_002526951.1|  hypothetical protein RCOM_0531220                78.2    8e-14   
ref|XP_004490652.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.2    9e-14   
gb|AAF69700.1|AC016041_5  F27J15.10                                   78.6    9e-14   
ref|XP_008811450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    9e-14   
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8              78.6    9e-14   
ref|XP_006362451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    1e-13   
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                 78.6    1e-13   
ref|XP_008363941.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    1e-13   
emb|CAB87776.1|  putative protein                                     78.6    1e-13   
ref|XP_010029065.1|  PREDICTED: uncharacterized protein LOC104419187  78.6    1e-13   
ref|XP_004149511.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    2e-13   
ref|XP_003622266.1|  CONSTANS-like zinc finger protein                77.8    2e-13   
emb|CDX94392.1|  BnaC01g17920D                                        78.2    3e-13   
ref|XP_008451210.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    3e-13   
emb|CDX89377.1|  BnaA01g15160D                                        78.2    3e-13   
ref|XP_011098790.1|  PREDICTED: uncharacterized protein LOC105177...  76.6    4e-13   
gb|KJB56255.1|  hypothetical protein B456_009G113000                  75.5    4e-13   
ref|XP_006413244.1|  hypothetical protein EUTSA_v10025322mg           77.8    4e-13   
ref|XP_002518229.1|  CIL, putative                                    77.4    5e-13   
gb|EYU38741.1|  hypothetical protein MIMGU_mgv1a008071mg              77.0    6e-13   
gb|EMT06010.1|  hypothetical protein F775_08552                       77.0    6e-13   
ref|XP_007154712.1|  hypothetical protein PHAVU_003G141200g           76.3    1e-12   
ref|XP_006305953.1|  hypothetical protein CARUB_v10011200mg           73.9    1e-12   
ref|XP_011462373.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.6    1e-12   
emb|CDP16632.1|  unnamed protein product                              75.9    2e-12   
ref|XP_003553886.1|  PREDICTED: uncharacterized protein LOC100811815  75.5    2e-12   
ref|XP_009139739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.5    2e-12   
ref|XP_011020039.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.5    3e-12   
ref|NP_851201.1|  chloroplast import apparatus 2 protein              75.5    3e-12   
ref|XP_009120242.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.1    4e-12   
ref|XP_004145240.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.6    5e-12   
ref|XP_003547688.2|  PREDICTED: DNA topoisomerase 1-like isoform X1   74.3    5e-12   
gb|EPS64862.1|  hypothetical protein M569_09916                       69.3    8e-12   
ref|XP_006599067.1|  PREDICTED: DNA topoisomerase 1-like isoform X2   73.2    1e-11   
ref|XP_006401233.1|  hypothetical protein EUTSA_v10013517mg           73.6    1e-11   
ref|NP_849445.1|  CIA2-like transcription factor                      73.6    1e-11   
ref|XP_011097348.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  72.4    1e-11   
emb|CAB39664.1|  putative protein                                     73.2    1e-11   
gb|KJB53720.1|  hypothetical protein B456_009G002400                  73.2    1e-11   
ref|XP_001776067.1|  predicted protein                                67.8    2e-11   
gb|KDO45661.1|  hypothetical protein CISIN_1g017778mg                 72.4    2e-11   
ref|XP_004499508.1|  PREDICTED: uncharacterized protein LOC101500...  71.6    3e-11   
emb|CDY36106.1|  BnaA08g19420D                                        72.0    3e-11   
gb|KHG01643.1|  chloroplast import apparatus 2 -like protein          72.0    4e-11   
ref|XP_011467358.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.6    6e-11   
emb|CDY42769.1|  BnaA03g47700D                                        69.3    7e-11   
ref|XP_009137564.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.9    9e-11   
ref|XP_010111661.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           69.7    2e-10   
ref|XP_006379128.1|  hypothetical protein POPTR_0009s08080g           66.6    2e-10   
gb|EMT12233.1|  hypothetical protein F775_25319                       66.2    3e-10   
emb|CDX92740.1|  BnaC07g39980D                                        69.3    3e-10   
ref|XP_008804437.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  69.3    3e-10   
ref|XP_009126854.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.9    4e-10   
ref|XP_010048577.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.6    6e-10   
gb|ABG57263.1|  CONSTANS-like 1                                       67.4    9e-10   
ref|XP_003560384.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  67.4    1e-09   
gb|AFV78277.1|  constans-like 1                                       67.0    2e-09   
gb|KHM99279.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                64.7    2e-09   
gb|AFK31575.1|  Hd1                                                   67.0    2e-09   
gb|AAD22518.1|AF001136_1  zinc finger protein                         66.6    2e-09   
gb|AFV79556.1|  constans-like 1                                       66.6    2e-09   
ref|XP_004972989.1|  PREDICTED: uncharacterized protein LOC101775441  66.2    2e-09   
gb|AFW86339.1|  constans1                                             62.8    2e-09   
ref|NP_001046074.2|  Os02g0178100                                     64.3    3e-09   
dbj|BAD36814.1|  zinc finger protein-like                             63.2    3e-09   
gb|AAX47173.1|  CONSTANS-LIKE b                                       66.2    3e-09   
gb|ACF79190.1|  unknown                                               63.2    3e-09   
gb|ACF81408.1|  unknown                                               63.5    3e-09   
gb|AAX20015.1|  CONSTANS-like b                                       65.9    3e-09   
gb|EEC84137.1|  hypothetical protein OsI_30489                        62.8    3e-09   
ref|XP_008348263.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  62.8    3e-09   
ref|XP_011098789.1|  PREDICTED: uncharacterized protein LOC105177...  65.9    3e-09   
ref|XP_003610054.1|  Zinc finger protein CONSTANS-like protein        66.2    3e-09   
emb|CAK26108.1|  constans-like 1                                      66.2    3e-09   
ref|NP_001140225.1|  uncharacterized protein LOC100272264             63.5    3e-09   
emb|CAK26141.1|  constans-like 1                                      66.2    3e-09   
ref|XP_010545431.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  65.9    3e-09   
emb|CAK26123.1|  constans-like 1                                      66.2    3e-09   



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 93/126 (74%), Gaps = 6/126 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMM  458
            KK ++LLSLNYE VI+AWASQG PWT G RP FDP+ CWPD MG G    HH Y   + M
Sbjct  314  KKRKILLSLNYESVITAWASQGSPWTSGGRPDFDPDECWPDCMGTGGTEVHHTYSDLIGM  373

Query  457  RR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  374  GAHQALGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFLAGP  433

Query  289  P-PFPN  275
              PF N
Sbjct  434  AFPFVN  439



>ref|XP_006468698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO76999.1| hypothetical protein CISIN_1g012558mg [Citrus sinensis]
Length=461

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 91/124 (73%), Gaps = 9/124 (7%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----GDHHHHHPYGSAMMM  458
            +LLSL+YE VI+ WASQG PWT G RP+FDP+ CWPD MG     G  +  HPYG    +
Sbjct  332  ILLSLDYEAVINTWASQGSPWTTGDRPNFDPDECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  457  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392  GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  289  PPFP  278
            P FP
Sbjct  452  PAFP  455



>ref|XP_006448477.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
 gb|ESR61717.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
Length=461

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 91/124 (73%), Gaps = 9/124 (7%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----GDHHHHHPYGSAMMM  458
            +LLSL+YE VI +WASQG PWT+G RP+FDP  CWPD MG     G  +  HPYG    +
Sbjct  332  ILLSLDYESVIKSWASQGSPWTNGDRPNFDPEECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  457  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392  GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  289  PPFP  278
            P FP
Sbjct  452  PAFP  455



>ref|XP_002282578.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
 emb|CBI27020.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 97/131 (74%), Gaps = 9/131 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMM  458
            KK+++LL L+YE +I+AWASQG PWT+G RP  DP+ CWPD +G      HHPYG    M
Sbjct  305  KKNKILLRLDYEAIITAWASQGSPWTNGHRPELDPDDCWPDCLGTCGIQVHHPYGEFGGM  364

Query  457  RR-----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F  
Sbjct  365  GEQQAAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FGG  423

Query  292  PPPFPNYLLNR  260
            P  FP  LLN+
Sbjct  424  PAAFP--LLNK  432



>ref|XP_011022115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Populus euphratica]
Length=440

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 92/120 (77%), Gaps = 14/120 (12%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS-----  470
            K ++LLSL+YE V++AWASQG PWT+G RP FDP+ CWPD MG      HHPYG      
Sbjct  322  KRKILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCMGICGAQLHHPYGDMISGL  381

Query  469  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                AMM    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  382  GAHPAMM----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTL  437



>ref|XP_002311458.2| zinc finger family protein [Populus trichocarpa]
 gb|ABK95116.1| unknown [Populus trichocarpa]
 gb|EEE88825.2| zinc finger family protein [Populus trichocarpa]
Length=444

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 91/116 (78%), Gaps = 6/116 (5%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMMR  455
            K ++LLSL+YE V++AWASQG PWT+G RP FDP+ CWPD MG      HHPYG  +   
Sbjct  326  KRKILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCMGICGAQLHHPYGDMISGL  385

Query  454  RS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  386  GAHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTL  441



>gb|KJB16228.1| hypothetical protein B456_002G218400 [Gossypium raimondii]
Length=421

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 93/131 (71%), Gaps = 9/131 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMM  458
            KK + LLSL+YE VI+AWA+QG PWT G +P  DP+ CWPD MG G       Y   M M
Sbjct  294  KKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMGNGGTEVQQSYSGLMGM  353

Query  457  -----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F  
Sbjct  354  GGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FLT  412

Query  292  PPPFPNYLLNR  260
             P FP  LLN+
Sbjct  413  GPAFP--LLNK  421



>ref|XP_009798338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Nicotiana 
sylvestris]
Length=417

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 97/130 (75%), Gaps = 13/130 (10%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM------GGDHHHHHPYGS  470
            K RMLL LNYEEVISAW +Q  PWT+G RPHF+P+ CWPDF+      GG    H PYG 
Sbjct  294  KRRMLLRLNYEEVISAWPNQSSPWTNGIRPHFNPDDCWPDFLETCIGEGG----HQPYGG  349

Query  469  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
              +      GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR++ F   
Sbjct  350  GNVRGGD-GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRTTSFS-A  407

Query  289  PPFPNYLLNR  260
            P FP YL+N+
Sbjct  408  PGFP-YLMNK  416



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHH-HHPYGSAMMMRRS-  449
            M L LNYEEVI+AWASQG PW DGT+P F+   CWPDFMG   +  HHP G+      S 
Sbjct  312  MHLKLNYEEVITAWASQGSPWADGTKPEFNLGDCWPDFMGMSLNELHHPNGAGGGRVSSH  371

Query  448  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  281
            DE REARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P  P+
Sbjct  372  DEEREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFAGPSFPY  427



>ref|XP_009603861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 105/156 (67%), Gaps = 11/156 (7%)
 Frame = -2

Query  718  QKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPH  539
            QKV MT  + F        +     +   K R+LL LNYE VISAW +Q  PWT+G RPH
Sbjct  272  QKVNMTAATEF-----VPSAECGGSKADAKRRLLLRLNYEAVISAWPNQSSPWTNGIRPH  326

Query  538  FDPNHCWPDFMG---GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYE  368
            F+P+ CWPDF+    G+   H PYG   +      GRE RVSRYREKRRTRLFSKKIRY+
Sbjct  327  FNPDDCWPDFLETCIGEGGVHQPYGGGKVRGGD-GGREERVSRYREKRRTRLFSKKIRYQ  385

Query  367  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  260
            VRKLNAEKRPRLKGRFVKR++ F  PP FP YL+N+
Sbjct  386  VRKLNAEKRPRLKGRFVKRTTSFS-PPGFP-YLMNK  419



>gb|KHG17662.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=417

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 92/131 (70%), Gaps = 9/131 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-GGDHHHHHPYGSAMMM  458
            KK + LLSL+YE VI+AWA+QG PWT G +P  DP+ CWPD M  G       Y   + M
Sbjct  290  KKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMRNGGTEVQQSYSGLIGM  349

Query  457  -----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F  
Sbjct  350  GGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FLA  408

Query  292  PPPFPNYLLNR  260
             P FP  LLN+
Sbjct  409  GPAFP--LLNK  417



>gb|AFX73409.1| constans-like protein 5 [Gossypium hirsutum]
Length=423

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 92/131 (70%), Gaps = 9/131 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-GGDHHHHHPYGSAMMM  458
            KK + LLSL+YE VI+AWA+QG PWT G +P  DP+ CWPD M  G       Y   + M
Sbjct  296  KKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMRNGGTEVQQSYSGLIGM  355

Query  457  -----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F  
Sbjct  356  GGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FLA  414

Query  292  PPPFPNYLLNR  260
             P FP  LLN+
Sbjct  415  GPAFP--LLNK  423



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGG---DHHHHHPYG  473
            ++ K  + L LNYE VI AWAS+G PWT G RP F+P+  CWPD MG    + +HHHPYG
Sbjct  322  MSSKISLRLRLNYEGVICAWASKGSPWTTGERPQFNPDDDCWPDCMGTYPMEVYHHHPYG  381

Query  472  S----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                    +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  382  EMGGVGGHVTMGNGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  441

Query  304  LFQPPPPFP  278
            L     PFP
Sbjct  442  LMGVAAPFP  450



>ref|XP_010103762.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB97040.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=464

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 90/129 (70%), Gaps = 10/129 (8%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG---DHHHHHPYGSAMMMRR  452
            +LL L+YE VI+AWASQG PWT G RP FDP+ CWPD MG       HHH Y     +  
Sbjct  338  ILLRLDYEAVITAWASQGSPWTTGDRPDFDPDACWPDCMGTYYPTQLHHHQYMDLSGVEL  397

Query  451  -----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  287
                 +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV R+S     P
Sbjct  398  NPAILADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVNRASF--AGP  455

Query  286  PFPNYLLNR  260
             FP  L+ +
Sbjct  456  TFPAMLITK  464



>ref|XP_011007910.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Populus euphratica]
Length=445

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYG-----  473
            KK R LLSL+Y+ V++AWASQG PWT+G RP FD + CWPD MG      H PYG     
Sbjct  326  KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDCMGICGAQLHQPYGDVSGL  385

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  AAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  442



>ref|XP_010265147.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nelumbo 
nucifera]
Length=439

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 87/116 (75%), Gaps = 8/116 (7%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG----DHHHHHPYGS----AMM  461
            L L+YE +ISAWA++G PWT G RP F+P+ CWPD MG     + HH+HPYG        
Sbjct  319  LKLDYEAIISAWANKGLPWTTGDRPLFNPDDCWPDCMGTCPMTEVHHYHPYGEMGGVGGH  378

Query  460  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            +   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  379  VTAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASCTGP  434



>ref|XP_002531628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30756.1| conserved hypothetical protein [Ricinus communis]
Length=468

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 91/130 (70%), Gaps = 11/130 (8%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMM  461
            KK ++LLSL+YE VI+AWA+QG  PWTDGTR   DP+ CW D MG      HHPYG    
Sbjct  335  KKRKILLSLDYEAVITAWATQGTSPWTDGTRRDVDPDECWQDCMGTCGAEFHHPYGDTNG  394

Query  460  MRR---------SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
            +           +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  395  LGGVGGGGNPAMAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  454

Query  307  SLFQPPPPFP  278
            +    P  FP
Sbjct  455  TFAGGPSAFP  464



>ref|XP_002315940.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
 gb|EEF02111.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
Length=447

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD--FMG-GDHHHHHPYGSAM  464
            KK R LLSL+YE V++AWASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326  KKRRTLLSLDYEAVMTAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  463  MMRR-----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             +        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLGAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 84/114 (74%), Gaps = 6/114 (5%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMMMRR-  452
            + L LNY+ VI+AWASQGCPWT G+RP  + NHCWP   G      HHH  G   ++R  
Sbjct  280  VCLKLNYDAVITAWASQGCPWTAGSRPEINLNHCWPHCTGLCCKDVHHHTCGGGAVLRGC  339

Query  451  ---SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
               +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  340  HLGAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFM  393



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 93/128 (73%), Gaps = 16/128 (13%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-----S  470
            +K ++LL+L+YE V++AWA Q  PWT+G RP  D N CWPD MG +    HPYG     +
Sbjct  328  EKKKILLNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMG-NCGTIHPYGIMNGHT  386

Query  469  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
             M+    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+L    
Sbjct  387  TMI----DRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNL----  438

Query  289  PPFPNYLL  266
               PNY L
Sbjct  439  --VPNYPL  444



>gb|AGM20692.1| COL6-2 [Populus tomentosa]
Length=447

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD--FMG-GDHHHHHPYGSAM  464
            KK R LLSL+YE V+SAWASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326  KKRRTLLSLDYEAVMSAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  463  MMRRS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             +        D  REARVSRYREKRRTRLFSKK+RYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLGADPAALVDGAREARVSRYREKRRTRLFSKKLRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 93/126 (74%), Gaps = 12/126 (10%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            +K ++LL+L+YE V++AWA Q  PWT+G RP  D N CWPD MG +    HPYG  +M  
Sbjct  329  EKKKILLNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMG-NCGTIHPYG--IMNG  385

Query  454  RS---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  284
             +   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+L      
Sbjct  386  HTTIIDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNL------  439

Query  283  FPNYLL  266
             PNY L
Sbjct  440  VPNYPL  445



>gb|AHI45078.1| COL domain class transcription factor [Boehmeria nivea]
Length=458

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 86/116 (74%), Gaps = 9/116 (8%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG----DHHHHHPYGSAMMM-  458
            +LL LNYE VI+ WASQG PWT G RP FDP+ CWP+ MG      HHHHH    + ++ 
Sbjct  339  ILLRLNYEAVITEWASQGSPWTTGDRPDFDPDTCWPNCMGTFDTQLHHHHHYMDLSGLVG  398

Query  457  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                  +D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  399  GNPAALADGGREARVSRYREKRRNRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  454



>gb|KHN05568.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=242

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 91/131 (69%), Gaps = 9/131 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS---  470
             K+ ++ L L+YE +I AWASQ  PWT   +P+ DP+ CW   MG  +  +HHP G    
Sbjct  116  VKRKKVSLQLDYEAIIIAWASQKSPWTTADKPNLDPDECWKQCMGSCETAYHHPCGEMGG  175

Query  469  -AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
              +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    
Sbjct  176  FGIHPVIIDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--A  233

Query  292  PPPFPNYLLNR  260
            PP FP  LLN+
Sbjct  234  PPTFP--LLNK  242



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 105/157 (67%), Gaps = 13/157 (8%)
 Frame = -2

Query  718  QKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPH  539
            QKVM    +  +  +S+ E      +  +K+R+ LSLN+E VISAW +Q  PWT+G RPH
Sbjct  260  QKVMAADAAVTEFIASAEEYSGSSTKSDEKNRLFLSLNHEAVISAWPNQSSPWTNGIRPH  319

Query  538  FDPNHCWPDFMG----GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRY  371
            F+P+  WPDF      G++  H        +R  D GREARVSRYREKR+ RLFSKKIRY
Sbjct  320  FNPDDYWPDFFSETSVGNYGGH--------VRCGDGGREARVSRYREKRQNRLFSKKIRY  371

Query  370  EVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  260
            EVRKLNAEKRPRLKGRF+KRSS     P F +Y++N+
Sbjct  372  EVRKLNAEKRPRLKGRFIKRSSSLFSVPGF-SYMMNK  407



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMMMRR---  452
            L LNY+ VI+AWASQGCPWT G+RP  + NHCWP   G      HHH  G   ++R    
Sbjct  282  LKLNYDAVITAWASQGCPWTAGSRPEINLNHCWPYCTGLCCKGVHHHTCGGGAVLRGCHL  341

Query  451  -SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
             +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  342  GAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFM  393



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMM  461
            +    ++LLSL+YE VISAWA Q  PWT G RP  D N CWPD +G     H+ YG   M
Sbjct  319  INTNKKILLSLDYEGVISAWADQRSPWTTGERPELDSNDCWPDCLGTCGTIHNLYGEVGM  378

Query  460  M---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
                   D GREARVSRYREKRRTRLF KKIRYEVRKLNAEKRPR+KGRFVKR++     
Sbjct  379  FGHPAMMDGGREARVSRYREKRRTRLFCKKIRYEVRKLNAEKRPRMKGRFVKRATFSAAA  438

Query  289  PPFP  278
              FP
Sbjct  439  AAFP  442



>ref|XP_011007901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=447

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD--FMG-GDHHHHHPYG---  473
            KK R LLSL+Y+ V++AWASQG PWT+G RP FD + CWPD   MG      H PYG   
Sbjct  326  KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDPDCMGICGAQLHQPYGDVS  385

Query  472  --SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLAAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|NP_001278940.1| zinc finger protein CONSTANS-LIKE 16-like [Glycine max]
 gb|AEF12204.1| CONSTANS-like zinc finger protein [Glycine max]
Length=419

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 92/130 (71%), Gaps = 9/130 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS----  470
            KK+++ L L+YE VI AWASQ  PWT   +P+ DP+ CW   MG  +  +HHP G     
Sbjct  294  KKNKISLQLDYEAVIIAWASQKSPWTTADKPNLDPDECWKQCMGSCETAYHHPCGEMGGF  353

Query  469  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
             +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  354  GIHPVIIDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--AP  411

Query  289  PPFPNYLLNR  260
            P FP  LLN+
Sbjct  412  PTFP--LLNK  419



>ref|NP_001239992.1| uncharacterized protein LOC100802113 [Glycine max]
 gb|ACU23240.1| unknown [Glycine max]
Length=350

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRP-HFDPNHCWPDFMGGDHHH-HHPYGSA  467
            V  K  + L LNYEEVI+AWASQG PWT+GT P  F+ + CW DF+G +  +    YG+ 
Sbjct  227  VGTKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLDFLGSNGGNVQCCYGAV  286

Query  466  MMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
              +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  287  GSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  340



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHPYGSAM  464
             K +  LL LNYE+VI+AWASQG PWT G+RP  + + CWPD M       HHHPYG   
Sbjct  306  TKSTASLLRLNYEDVINAWASQGSPWTSGSRPELNSDDCWPDCMDICLKDGHHHPYGGMG  365

Query  463  MMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  287
               R   G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S      
Sbjct  366  GHTRGGNGAREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFMGNGF  425

Query  286  PFPN  275
            P+ N
Sbjct  426  PYMN  429



>ref|XP_010066724.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Eucalyptus grandis]
 gb|KCW64739.1| hypothetical protein EUGRSUZ_G02322 [Eucalyptus grandis]
Length=463

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 90/127 (71%), Gaps = 8/127 (6%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMMRRS-  449
            + L L+YE VISAWA QG PWT G RP F P++CWPDFMG       + YG A +     
Sbjct  339  IFLRLDYEAVISAWAGQGSPWTTGERPDFSPDNCWPDFMGMSGLEFQNLYGEAGVHGGHV  398

Query  448  ---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR-SSLFQPPPPF  281
               D GREA+VSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR SS     P F
Sbjct  399  GMGDAGREAKVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASSASSSAPAF  458

Query  280  PNYLLNR  260
            P  LLN+
Sbjct  459  P--LLNK  463



>ref|XP_009397482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 85/117 (73%), Gaps = 5/117 (4%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFM----GGDHHHHHPY  476
             A K R +L L+YE VI+AW+S GC PWTDG RP FDP+  W DF+    GG       Y
Sbjct  283  AATKRRPILRLDYEAVIAAWSSNGCSPWTDGERPQFDPSDAWADFLVAEAGGGGEVQGMY  342

Query  475  GSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
              A  M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK+++
Sbjct  343  QQAGHMAAVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKQAA  399



>ref|XP_004135402.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=403

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHPYG--  473
            V  K ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      ++ PYG  
Sbjct  272  VKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPYGEF  331

Query  472  SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
             + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKRSS
Sbjct  332  GSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSS  391

Query  304  LFQPPP  287
             F PPP
Sbjct  392  CFAPPP  397



>gb|KGN52081.1| hypothetical protein Csa_5G609670 [Cucumis sativus]
Length=403

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHPYG--  473
            V  K ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      ++ PYG  
Sbjct  272  VKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPYGEF  331

Query  472  SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
             + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKRSS
Sbjct  332  GSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSS  391

Query  304  LFQPPP  287
             F PPP
Sbjct  392  CFAPPP  397



>gb|AEF12203.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN20727.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=427

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHF-DPNHCWPDFMGGDHHH-HHPYGSA  467
            V  K  + L LNYEEVI+AWASQG PWT+GT P F + + CW DF+G +  +    YG+ 
Sbjct  304  VGTKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLDFLGSNGGNVQCCYGAV  363

Query  466  MMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
              +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  364  GSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  417



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMM  461
            V  + ++ LSLNYE+VI+AWASQG PWT G RP FDPN  WPD+MG    + H     + 
Sbjct  281  VEMRRKISLSLNYEDVITAWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGPCGDVG  340

Query  460  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  296
                + G     REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F 
Sbjct  341  GVGGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FA  399

Query  295  PPPPFPNYLLN  263
              P FP  +LN
Sbjct  400  AGPCFP--ILN  408



>ref|XP_006341612.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=402

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 92/126 (73%), Gaps = 4/126 (3%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            +K+R+ L LN+E VISAW +Q  PWT+G RPHF+P+  WPDF      +   YG    +R
Sbjct  279  EKNRLFLRLNHEAVISAWPNQSSPWTNGIRPHFNPDDYWPDFSETCGGNLGYYGG--HVR  336

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFP  278
              D GREARV RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF+KR+S      P FP
Sbjct  337  SGDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFIKRNSSSSFSVPGFP  396

Query  277  NYLLNR  260
             Y++N+
Sbjct  397  -YMMNK  401



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMM  461
            V  + ++ LSLNYE+VI+AWASQG PWT G RP FDPN  WPD+MG    + H     + 
Sbjct  346  VEMRRKISLSLNYEDVITAWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGPCGDVG  405

Query  460  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  296
                + G     REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F 
Sbjct  406  GVGGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FA  464

Query  295  PPPPFPNYLLN  263
              P FP  +LN
Sbjct  465  AGPCFP--ILN  473



>ref|XP_008446600.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 
6-like [Cucumis melo]
Length=402

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 91/124 (73%), Gaps = 8/124 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHPYG--SA  467
            K+ ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      ++ PYG   +
Sbjct  273  KQKKISLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPYGEFGS  332

Query  466  MMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
             + R +  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKRSS F
Sbjct  333  GIGRHAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSSCF  392

Query  298  QPPP  287
             PPP
Sbjct  393  APPP  396



>ref|XP_003555902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Glycine 
max]
Length=418

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 89/131 (68%), Gaps = 9/131 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS---  470
             K+ ++ L L+YE +I AWASQ  PWT   + + DP+ CW   MG      HHPYG    
Sbjct  292  VKRKKVSLQLDYEAIIIAWASQKSPWTTADKQNLDPDECWHQCMGSCGTAFHHPYGELGG  351

Query  469  -AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
              +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    
Sbjct  352  FGIHSVIVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--A  409

Query  292  PPPFPNYLLNR  260
            PP FP  LLN+
Sbjct  410  PPTFP--LLNK  418



>gb|KHN11420.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=417

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 89/131 (68%), Gaps = 9/131 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS---  470
             K+ ++ L L+YE +I AWASQ  PWT   + + DP+ CW   MG      HHPYG    
Sbjct  291  VKRKKVSLQLDYEAIIIAWASQKSPWTTADKQNLDPDECWHQCMGSCGTAFHHPYGELGG  350

Query  469  -AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
              +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    
Sbjct  351  FGIHSVIVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--A  408

Query  292  PPPFPNYLLNR  260
            PP FP  LLN+
Sbjct  409  PPTFP--LLNK  417



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 88/120 (73%), Gaps = 8/120 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDF-MGGDHH---HHHPYGSA  467
            KK +MLL LNYE V++AWASQG PWT G RP F+ +  WP+  MG   H   +H P+  A
Sbjct  342  KKRKMLLRLNYEGVMAAWASQGSPWTTGDRPDFELDEGWPNSNMGTASHSLKYHLPFAEA  401

Query  466  MMMRR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
            M +R      D GREARVSRYREKRRTR+FSKKIRY+VRKLNAEKRPR+KGRFVKR S  
Sbjct  402  MGLRAHVGAEDGGREARVSRYREKRRTRMFSKKIRYQVRKLNAEKRPRMKGRFVKRMSFI  461



>gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHPYGSAMMM  458
            K  + L LNYE VI+AWAS G PWT GTRP  +P+ CWPD +G      HHHPY      
Sbjct  316  KRDVSLRLNYEAVITAWASHGSPWTTGTRPELNPDDCWPDCLGTCPKDGHHHPYRGHNGG  375

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                 GREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRL+GRFVKR+S 
Sbjct  376  GNG--GREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRLQGRFVKRTSF  425



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 91/130 (70%), Gaps = 9/130 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            +K +++LL+L+Y  V++AWA Q  PWT G RP  D N CWP  MG +    H YG   +M
Sbjct  281  SKNNKILLNLDYGGVLNAWADQRSPWTTGERPQVDSNDCWPVCMG-NCGQIHAYGDMEIM  339

Query  457  R----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
                   DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAE RPR+KGRFVKR++    P
Sbjct  340  TGHGPMIDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEMRPRMKGRFVKRTNF--AP  397

Query  289  PPFPNYLLNR  260
             PFP+  LNR
Sbjct  398  TPFPS--LNR  405



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHH-HHPYGSAMMMR  455
            K  M L LNYE+VI+AWASQGCPWT GT P+F+ +   P F+G +       YG    +R
Sbjct  287  KKEMFLRLNYEDVIAAWASQGCPWTTGTPPNFNSDDFLPGFLGSNGEDVLCCYGEMRSLR  346

Query  454  -RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP--PP  284
              +D GREARV RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+S       PP
Sbjct  347  GHADGGREARVLRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTSFLGATVLPP  406



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 91/130 (70%), Gaps = 9/130 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
             K +++LL+L+Y  V++AWA Q  PWT G RP  D N CWP  MG +   +H YG    M
Sbjct  270  TKNNKILLNLDYGGVLNAWADQRSPWTTGERPEVDFNDCWPVCMG-NCGKNHLYGDMGTM  328

Query  457  R----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
                   DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P
Sbjct  329  TGHGPTVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--AP  386

Query  289  PPFPNYLLNR  260
             PFP+  LNR
Sbjct  387  TPFPS--LNR  394



>gb|AHI45077.1| COL domain class transcription factor [Boehmeria nivea]
Length=453

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDH----HHHHPYGSA  467
            KK  +LL LNYE VI+AWASQG PWT G RP   P H WPD M   H      +  +   
Sbjct  311  KKRDILLRLNYEAVIAAWASQGSPWTTGIRPEVKPEHGWPDCMDMCHPDFSQINGDWRGL  370

Query  466  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PP  290
            +   R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S      
Sbjct  371  VGSGRRDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFMGINN  430

Query  289  PPFPN  275
              FPN
Sbjct  431  STFPN  435



>ref|XP_003637430.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
Length=166

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 85/124 (69%), Gaps = 9/124 (7%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHH-----PYG  473
            K ++ L L+Y+ VI AW SQ CPWT+G +P  D +  WPD MG  G   H+       YG
Sbjct  43   KRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGGYG  102

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
               +M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  103  CHPVM--VDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVP  160

Query  292  PPPF  281
              P 
Sbjct  161  TFPL  164



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 85/124 (69%), Gaps = 11/124 (9%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            K ++LL+L+YE V+ AWA Q CPWT+G RP  D N  WPD MG        Y   M    
Sbjct  308  KKKILLNLDYEGVLKAWADQRCPWTNGERPELDSNESWPDCMGN-------YMGIMNENV  360

Query  451  S--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
            +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        P
Sbjct  361  TIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFVTTST--P  418

Query  277  NYLL  266
            NY L
Sbjct  419  NYPL  422



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 85/124 (69%), Gaps = 11/124 (9%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            K ++LL+L+YE V+ AWA Q CPWT+G RP  D N  WPD MG        Y   M    
Sbjct  321  KKKILLNLDYEGVLKAWADQRCPWTNGERPELDSNESWPDCMGN-------YMGIMNENV  373

Query  451  S--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
            +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        P
Sbjct  374  TIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFVTTST--P  431

Query  277  NYLL  266
            NY L
Sbjct  432  NYPL  435



>ref|XP_009347093.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=441

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 82/116 (71%), Gaps = 4/116 (3%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYG  473
            V K+  + L L+YE VI+AWASQG PWT GTRP  +P+  W D MG      H  H    
Sbjct  301  VMKRKNICLKLDYEAVITAWASQGSPWTTGTRPELNPDEGWLDCMGMWPTEIHQAHGDSA  360

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
              +  R  D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  361  GCVSGRGDDPRREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  416



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 81/121 (67%), Gaps = 6/121 (5%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMM  461
            V    R+ L L+YE V+SAW  Q  PWT G RP  D   CWPD MG      H YG   M
Sbjct  313  VHDSKRIFLRLDYEGVLSAWDDQKSPWTTGERPDLDSAGCWPDCMG-TCGTVHVYGEMGM  371

Query  460  M-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  296
            M        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L  
Sbjct  372  MIGHAVAVGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANLVA  431

Query  295  P  293
            P
Sbjct  432  P  432



>ref|XP_010916170.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 84/120 (70%), Gaps = 7/120 (6%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHH------  482
            VA   RM L L+YE VI+AW+ + C PWTDG RP F+P+ CWPDF G             
Sbjct  293  VAAGRRMTLRLDYEAVIAAWSCKDCSPWTDGERPQFNPDDCWPDFTGMMWGGAGGGREVA  352

Query  481  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            P    + M   D GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  353  PVYGELGMVAGDGGREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAAF  412



>gb|AIE41597.1| zinc finger protein CONSTANS-LIKE 6 [Lagerstroemia indica]
Length=376

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 86/124 (69%), Gaps = 6/124 (5%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            K RMLL LNYE VI++WA+QG PWTDG RP F+ +      +GG       Y    + R 
Sbjct  259  KKRMLLRLNYEAVIASWATQGSPWTDGIRPQFNLDEFMVACLGG-----SCYELGGLSRA  313

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  272
               GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+ F      P  
Sbjct  314  KIGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSTTFS-GSSLPYQ  372

Query  271  LLNR  260
            L+N+
Sbjct  373  LINK  376



>ref|XP_009360161.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=447

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGSA  467
            K+ ++ L L+YE VI+AWASQG PWT+GTRP  +P+  W D MG         H      
Sbjct  309  KRKKICLRLDYETVITAWASQGSPWTNGTRPELNPDDGWLDCMGMWPTEIPQPHGDTAGC  368

Query  466  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            +  R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  369  VSGRGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  422



>gb|KDP29405.1| hypothetical protein JCGZ_18326 [Jatropha curcas]
Length=438

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 7/116 (6%)
 Frame = -2

Query  607  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGS-----AMMMRRS  449
            +YE VI+AWASQG PW  G +P  +P+ CW D MG  G    HH YG       +    +
Sbjct  320  DYEAVITAWASQGSPWITGNQPDINPDDCWLDCMGIYGAEVLHHSYGDHNGGIGIQPAMT  379

Query  448  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  281
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++   P  P 
Sbjct  380  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFAAPVFPL  435



>ref|XP_006829901.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 83/122 (68%), Gaps = 5/122 (4%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD-FMGGDHHHHHPYGSAM  464
            +  +  + L L+YE VISAW     PWT G RP F+P+ CWPD F G        Y    
Sbjct  272  IVLEKSISLRLDYEAVISAWGRS--PWTTGQRPEFNPDDCWPDPFTGNCVPEMSTYSEVG  329

Query  463  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  284
                SD GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   PP P
Sbjct  330  NATASDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF--PPTP  387

Query  283  FP  278
            +P
Sbjct  388  YP  389



>gb|AEF12205.1| CONSTANS-like zinc finger protein [Glycine max]
Length=430

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHF-DPNHCWPDFMGGDHHHHHPYGSAMMM  458
             K  + L LNYEEVI+AWASQG PWT GT P F + + CW D           YG    +
Sbjct  302  NKKDIFLRLNYEEVITAWASQGSPWTTGTPPKFFNSDDCWLDLGSNGGGVQCYYGEVRSL  361

Query  457  R-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  281
            R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVK   L +P    
Sbjct  362  RVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKSVPLLEPLLCQ  421

Query  280  PNY  272
             NY
Sbjct  422  LNY  424



>ref|XP_008775153.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=420

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 88/131 (67%), Gaps = 15/131 (11%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHH------  482
            VA   RM L L+YE VI+AW+ +GC PWTDG RP F+P+ CWPDF G             
Sbjct  294  VAAGRRMTLRLDYEAVIAAWSCKGCSPWTDGERPQFNPDDCWPDFAGMMWGGAGGGGGGG  353

Query  481  ---PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
               P    + M   + GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  354  EVAPVYGEVGMVAGNGGREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  413

Query  310  SSLFQPPPPFP  278
            ++      PFP
Sbjct  414  AAA-----PFP  419



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMMR  455
            K  + L L+YE VI AWA+QGCPWT G+RP  +P+  W D MG      ++PYG      
Sbjct  307  KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNPDDSWTDSMGACPKDVNNPYGGLGSHT  366

Query  454  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
            R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL 
Sbjct  367  RGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSLM  419



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 80/109 (73%), Gaps = 14/109 (13%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            K ++ L L+YE +I+AWA+QG PWT GTRP  +P+  W D MGG              R 
Sbjct  339  KRKICLRLDYEAIITAWANQGSPWTTGTRPELNPDDGWLDCMGG--------------RG  384

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
             D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  385  DDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  433



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 87/122 (71%), Gaps = 8/122 (7%)
 Frame = -2

Query  628  SRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR-  452
            ++++L+L+YE V+ +WA +  PWT G RP  D N CWP  MG +    H YG   ++ R 
Sbjct  306  NKIMLNLDYESVLKSWADKRSPWTMGERPEVDFNDCWPVCMG-NCGKIHSYGDIGIVNRH  364

Query  451  ----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  284
                 DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P P
Sbjct  365  GGGGVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTP  422

Query  283  FP  278
            FP
Sbjct  423  FP  424



>ref|XP_008240273.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=480

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 83/115 (72%), Gaps = 7/115 (6%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYG-----  473
            K ++ L L+YE +I+AWA+QG PWT GTRP  +P+  W D MG  G    H  +G     
Sbjct  339  KRKICLRLDYEAIITAWANQGSPWTTGTRPELNPDDGWLDCMGMWGSDQIHQSHGHGESA  398

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
              +  R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  399  GCVGGRGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  453



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 86/126 (68%), Gaps = 11/126 (9%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGD----HHHHHPYGSAM  464
            K  MLL LNYE VI+AWA QG PWT G+RP F+P+    DFMG +    HH     G   
Sbjct  310  KRNMLLRLNYESVITAWARQGSPWTAGSRPEFNPD----DFMGSNLKEGHHLSGGIGGIY  365

Query  463  MMR---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
             ++    +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    
Sbjct  366  SLQGRGNTDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFVGT  425

Query  292  PPPFPN  275
               + N
Sbjct  426  AFTYIN  431



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 85/122 (70%), Gaps = 8/122 (7%)
 Frame = -2

Query  628  SRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR--  455
            ++++L+L+YE V+ +W  +  PWT G RP  D N CWP  MG +    H YG   +M   
Sbjct  306  NKIMLNLDYESVLKSWGDKRFPWTTGVRPEVDFNDCWPVCMG-NCGKIHSYGDIAIMNGH  364

Query  454  ---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  284
                 DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P P
Sbjct  365  GGGVVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTP  422

Query  283  FP  278
            FP
Sbjct  423  FP  424



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 84/112 (75%), Gaps = 5/112 (4%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK  MLL L+YE VI+AWA+QG PWT GTRP F+P+    DFMG + +       +   R
Sbjct  298  KKRSMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPNEGIGGICSQGKR  353

Query  454  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
               +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  354  NITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  405



>gb|KEH44219.1| zinc finger constans-like protein [Medicago truncatula]
Length=436

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 85/124 (69%), Gaps = 9/124 (7%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHH-----PYG  473
            K ++ L L+Y+ VI AW SQ CPWT+G +P  D +  WPD MG  G   H+       YG
Sbjct  313  KRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGGYG  372

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
               +M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  373  CHPVM--VDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVP  430

Query  292  PPPF  281
              P 
Sbjct  431  TFPL  434



>ref|XP_008374747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=442

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 85/117 (73%), Gaps = 5/117 (4%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYG-SA  467
            V K+  + L L+YE VI+AWASQG  WT GTRP  + +  W D MG      H P+G SA
Sbjct  301  VMKRKNICLKLDYEAVITAWASQGSQWTTGTRPELNADEGWLDCMGMWPTEIHQPHGDSA  360

Query  466  MMMRRS---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
              + R    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  361  GCVSRGKGDDPGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  417



>gb|KJB34354.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=404

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK  MLL L+YE VI+AWA+QG PWT GTRP F+P+    DFMG +         +   R
Sbjct  286  KKRNMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPKEGIGGICSQGKR  341

Query  454  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
               +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  342  NITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  393



>gb|KJB34352.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=414

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK  MLL L+YE VI+AWA+QG PWT GTRP F+P+    DFMG +         +   R
Sbjct  296  KKRNMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPKEGIGGICSQGKR  351

Query  454  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
               +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  352  NITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  403



>ref|XP_008802436.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Phoenix 
dactylifera]
Length=440

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA-  467
            VA    M+L L+YE VI+AW+  GC PWTDG RP F+P+ C P F G         G A 
Sbjct  296  VAAGRGMILKLDYEAVIAAWSCNGCSPWTDGERPQFNPDDCCPIFTGMMWSGGVGEGDAG  355

Query  466  -MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  290
             + M     GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++     
Sbjct  356  EVGMMAGGGGREARVARYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTAFSAAG  415

Query  289  PPFPNYL  269
            P    ++
Sbjct  416  PAASPFI  422



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 2/113 (2%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHH-HHPYGSAMMMR  455
            K  + L L+YE VI AWA+QGCPWT G+RP  + +  W D MG      ++PYG      
Sbjct  308  KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNADDSWTDSMGTSPKDVNNPYGGLGSHT  367

Query  454  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
            R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL 
Sbjct  368  RGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSLM  420



>ref|XP_011072947.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Sesamum indicum]
Length=393

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            K+RM L LNYE VI+AWA+QG PWT+G RPHF+ +      + GD H      S      
Sbjct  276  KTRMFLRLNYEAVIAAWAAQGSPWTNGVRPHFNLDDFMVTCLEGDSHPSCGGRSGA----  331

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  272
            +D  REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ F      P Y
Sbjct  332  NDAEREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN-FSGSSSLP-Y  389

Query  271  LLNR  260
            L+N+
Sbjct  390  LINK  393



>ref|XP_009356271.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=454

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 85/117 (73%), Gaps = 8/117 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMM  461
            +KK +M+L L+YE VI+AW   G PWT G RP FD + C PD+MG      H+PYG    
Sbjct  331  SKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMGACGAELHYPYGEMNG  387

Query  460  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            +       D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGRFVKR+S 
Sbjct  388  LGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAQKRPRMKGRFVKRASF  444



>ref|XP_004300528.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHH----HHHPYG  473
            K+ ++ L LN+E VISAWAS+G PWT G +P  +P+  WPD MG  G +       H   
Sbjct  308  KRKKICLRLNHEAVISAWASKGSPWTTGVKPELNPDDGWPDCMGVWGTNQIMNLQGHGDS  367

Query  472  SA----MMMRRSDE---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
            SA    M MR   E   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  368  SAAAHRMGMRGDTEQRPGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  427

Query  313  RSSL  302
            R+S 
Sbjct  428  RTSF  431



>gb|ADK63396.1| B-box type zinc finger protein [Brassica rapa]
Length=265

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWP-DFM--GGDHHHHHPYGSAMMMRR  452
            +L L+YE VIS W  QG PWT    P  D N  C P D M   G   HHH Y   + +  
Sbjct  152  MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  211

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  212  GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  261



>ref|XP_009356747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=453

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 86/121 (71%), Gaps = 16/121 (13%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS---  470
            +KK + +L L+YE VI+AW   G PWT G RP FD + C PD+MG      H+PYG    
Sbjct  330  SKKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMGVCGPGLHYPYGDLNG  386

Query  469  -----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                 AM+    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS
Sbjct  387  IGVHPAMV----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSS  442

Query  304  L  302
             
Sbjct  443  F  443



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 84/124 (68%), Gaps = 11/124 (9%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            K ++LL+L+YE V++AWA Q  PWT+G RP  D N  WP  MG        Y   M    
Sbjct  331  KKKILLNLDYEGVLTAWADQRSPWTNGERPELDSNDSWPHCMGN-------YMGIMNENV  383

Query  451  S--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
            +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        P
Sbjct  384  TIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNFVTTTT--P  441

Query  277  NYLL  266
            NY L
Sbjct  442  NYPL  445



>ref|XP_008360050.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMM  461
            +KK +M+L L+YE VI+AW   G PWT G RP FD + C PD+M       H+PYG    
Sbjct  331  SKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMSACGAELHYPYGDXNG  387

Query  460  MRR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            +      +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK++S    
Sbjct  388  LGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKASFAGS  447

Query  292  PPPFP  278
              P P
Sbjct  448  AFPVP  452



>ref|XP_008389292.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMM  461
            +KK +M+L L+YE VI+AW   G PWT G RP FD + C PD+M       H+PYG    
Sbjct  331  SKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMSACGAELHYPYGDXNG  387

Query  460  MRR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            +      +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK++S    
Sbjct  388  LGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKASFAGS  447

Query  292  PPPFP  278
              P P
Sbjct  448  AFPVP  452



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 79/118 (67%), Gaps = 5/118 (4%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG----  473
            +   S+  L L+YE V+SAW  +  PWT G RP+ D   CWPD   G     H YG    
Sbjct  327  MGDSSKTFLRLDYEGVLSAWDDKKSPWTTGERPNLDSCDCWPDHCLGTSGAMHVYGEMGR  386

Query  472  -SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             S      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+ 
Sbjct  387  MSGHAAAMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNF  444



>ref|XP_004164163.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=375

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 8/111 (7%)
 Frame = -2

Query  595  VISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHPYG--SAMMMRRSDEG----  440
            V +AW S+G PWT G RP+ D ++ WPD+MG      ++ PYG   + + R++  G    
Sbjct  259  VKNAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPYGEFGSGIGRQAVTGVEGE  318

Query  439  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  287
            REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKRSS F PPP
Sbjct  319  REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSSCFAPPP  369



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 86/125 (69%), Gaps = 9/125 (7%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-----GGDHHHHHPYGSAMMM  458
            + L L+YE VI+AWASQ  PWT   +P+ DP+ CW   M     G D  +    G  +  
Sbjct  288  ISLQLDYESVITAWASQKSPWTTPHKPNLDPDECWHHCMESCGTGMDDPYGEVGGFGIHP  347

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
              +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP
Sbjct  348  MINDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP  405

Query  277  NYLLN  263
              LLN
Sbjct  406  --LLN  408



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEG  440
             L L+YE V+S+W  +  PWT G RP F+   CWPD +         YG   M+     G
Sbjct  271  FLKLDYEGVMSSWDDRKSPWTTGERPEFNSADCWPDSLVSASGAMQAYGGMAMVSGDARG  330

Query  439  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ L  P
Sbjct  331  REARVMRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRACLVAP  379



>ref|XP_010551268.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=424

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFD-PNHCWPDFMG---GDHHHHHPYGSAMMMR  455
            ++L L+YE VIS+W  QG PWT G  P  D  N  WP  MG   G  +     G  + M 
Sbjct  303  LMLRLDYESVISSWGGQGPPWTAGEPPELDLKNDSWPISMGEVNGGQYGSGICGVGLTMA  362

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  363  MGDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  413



>emb|CDY07383.1| BnaA07g24620D [Brassica napus]
Length=230

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 85/118 (72%), Gaps = 7/118 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM---GGD-HHHHHPYG  473
            K+  ++L L+YE VIS W SQG PWT       D +   C  + M   GG+ HHH+H  G
Sbjct  109  KEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDLDMLCCQTNSMCESGGEAHHHNHFPG  168

Query  472  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  169  LGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  226



>ref|XP_004497095.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=445

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 81/122 (66%), Gaps = 5/122 (4%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMMR  455
            K ++ L L+Y+ VI AW  + CPWT G +P+ D +  WPD  G       +PYG      
Sbjct  322  KRKISLQLDYDAVIIAWDGRKCPWTTGDKPNLDADETWPDCTGSCGTEVLYPYGELGGYE  381

Query  454  ----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  287
                 +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P  
Sbjct  382  CHPVMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTF  441

Query  286  PF  281
            P 
Sbjct  442  PL  443



>ref|XP_004299078.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 87/130 (67%), Gaps = 11/130 (8%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQ--GCPWTDGTRPHFDPNHCWPDFMG---GDHHHHHPYG  473
             KK ++ L L+Y+EVI+ W SQ  G P+  G RP  D + C PDFMG   G    H+PYG
Sbjct  318  CKKRKIFLRLDYDEVITKWDSQSNGSPFAFGDRPDIDYD-CLPDFMGTASGAELLHYPYG  376

Query  472  S-----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
                   +    +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  377  DLNRVIGLHPTMTDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  436

Query  307  SLFQPPPPFP  278
            S       FP
Sbjct  437  SFAATGSTFP  446



>ref|XP_010094760.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB56925.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=444

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 81/121 (67%), Gaps = 11/121 (9%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-----------GGDHH  491
             KK  ++L LNYE VI+AWASQG PWT G RP F+P+  WPD +            GD  
Sbjct  301  TKKRDIILRLNYEAVIAAWASQGSPWTTGNRPDFNPDDGWPDCLDVCHTDHVGPANGDSS  360

Query  490  HHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                    +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  361  RGGLGLGGVGGSVGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  420

Query  310  S  308
            +
Sbjct  421  T  421



>ref|XP_008445668.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
melo]
 gb|ADN34083.1| zinc finger (B-box type) family protein [Cucumis melo subsp. 
melo]
Length=335

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 85/130 (65%), Gaps = 10/130 (8%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG------GDHHHHHPYG  473
            K+  + L L+ E VI+AW +   PWT+G RP FDP+  WP+ M       G     H   
Sbjct  210  KRRVLSLRLDCEAVIAAWGNLQSPWTNGQRPDFDPDQPWPNSMEVCEVRYGQRCGEHGLR  269

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            +A M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+  F P
Sbjct  270  TAAM---GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTP-FPP  325

Query  292  PPPFPNYLLN  263
             P  P   +N
Sbjct  326  QPTLPFITIN  335



>gb|KFK44524.1| hypothetical protein AALP_AA1G267800 [Arabis alpina]
Length=407

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN--HCWPDF-MG--GDHHHHHPYGS  470
            +K+ ++L LNY+ VIS W  QG PW+ G RP  D +  + WP   MG  G   H  P+  
Sbjct  277  QKNVLMLRLNYDSVISTWGGQGPPWSPGERPELDIDIINTWPSVSMGENGGESHQKPFVG  336

Query  469  AMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSSL
Sbjct  337  GCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSL  394



>ref|XP_007222133.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
 gb|EMJ23332.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
Length=447

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 81/117 (69%), Gaps = 8/117 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMM  461
             KK  + L L+YE VI+AW   G PWT G RP F  + C PD MG      H+PYG    
Sbjct  324  GKKKEIFLRLDYEAVITAW--DGSPWTSGGRPDFS-SECLPDCMGVCGTELHYPYGDLNG  380

Query  460  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            +      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  381  LGVHPAMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  437



>ref|XP_004140861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 ref|XP_004172358.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 gb|KGN45963.1| hypothetical protein Csa_6G039540 [Cucumis sativus]
Length=334

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 10/130 (8%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG------GDHHHHHPYG  473
            K+  + L L+ E VI+AW +   PWT+G RP FDP+  WP+ M       G     + + 
Sbjct  209  KRRVLSLRLDCEAVIAAWGNLQSPWTNGQRPDFDPDQPWPNSMDLCEVRYGQRCGEYGFR  268

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            +A +    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+  F P
Sbjct  269  TAAI---GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTP-FAP  324

Query  292  PPPFPNYLLN  263
             P  P   +N
Sbjct  325  QPTLPIITIN  334



>ref|XP_006415872.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
 dbj|BAJ34058.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34225.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
Length=433

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGS  470
            +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP       GG+ HH   Y  
Sbjct  303  QKNVLMLRLNYDSVISTWGGQGPPWTSGDPPELDIDISGWPAISMVGNGGESHHQKQYVG  362

Query  469  AMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  363  GCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  420



>emb|CDY44890.1| BnaA02g13920D [Brassica napus]
Length=401

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWP-DFM--GGDHHHHHPYGSAMMMRR  452
            +L L+YE VIS W  QG PWT    P  D N  C P D M   G   HHH Y   + +  
Sbjct  288  MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  347

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  348  GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>ref|XP_009127638.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brassica rapa]
Length=401

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWP-DFM--GGDHHHHHPYGSAMMMRR  452
            +L L+YE VIS W  QG PWT    P  D N  C P D M   G   HHH Y   + +  
Sbjct  288  MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  347

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  348  GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>ref|XP_008243227.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=451

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 82/117 (70%), Gaps = 8/117 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMM  461
            +KK  + L L+YE VI+AW   G PWT G RP F+ + C PD MG      H PYG    
Sbjct  328  SKKKEIFLRLDYEAVITAW--DGSPWTSGGRPDFN-SECLPDCMGVCGTELHFPYGDLNG  384

Query  460  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            +      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  385  LWVHPAIADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  441



>ref|XP_009409257.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFM-----GGDHHHHHPYGSAMMMR  455
            L L+YE +I AW+SQG  PWTDG RP  + ++CWPD+M      G       +G  + + 
Sbjct  295  LRLDYESIIMAWSSQGSSPWTDGERPQINVDNCWPDYMDMWTGSGMETERACHGGEIGVY  354

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
              D  REARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  355  LGDGKREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  403



>gb|EEE59794.1| hypothetical protein OsJ_12314 [Oryza sativa Japonica Group]
Length=201

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            K+  M+L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  22   KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  78

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  79   VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  126



>emb|CDX81527.1| BnaC02g18310D [Brassica napus]
Length=401

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWP-DFM--GGDHHHHHPYGSAMMMRR  452
            +L L+YE VIS W  QG PWT    P  D N  C P D M   G   HHH Y   + +  
Sbjct  288  MLRLDYESVISTWGGQGTPWTAREPPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  347

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  348  GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>gb|KJB23747.1| hypothetical protein B456_004G113000 [Gossypium raimondii]
Length=418

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 86/129 (67%), Gaps = 13/129 (10%)
 Frame = -2

Query  640  VAKKSR-MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG----DHHHHHPY  476
            VAK  R  LL LNYE VI+AWASQG   T GTRP  +P+    DFMG     +HH +   
Sbjct  292  VAKTKRNKLLRLNYESVITAWASQG-SRTTGTRPELNPD----DFMGSYPKDEHHQNGGI  346

Query  475  GSA---MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            G     +    +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  347  GGINRPVRANNTDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  406

Query  304  LFQPPPPFP  278
                   FP
Sbjct  407  FVGLGTAFP  415



>ref|XP_008339676.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=453

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 84/120 (70%), Gaps = 16/120 (13%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS----  470
            KK + +L L+YE VI+AW   G PWT G RP FD +   PD+MG      H+PYG     
Sbjct  331  KKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SEFLPDYMGVCGPGLHYPYGDLNGI  387

Query  469  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                AM+    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  388  GVHPAMV----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>emb|CDY03851.1| BnaC07g10760D [Brassica napus]
Length=372

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 80/117 (68%), Gaps = 6/117 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYG  473
            +K+ ++L LNYE VIS W  QG PWT G  P  D +   WP   MGG+       HH  G
Sbjct  243  QKNVLMLRLNYESVISTWGGQGPPWTSGEPPERDVDISGWPVVSMGGNVRESQQKHHVGG  302

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  303  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  359



>ref|XP_008352923.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=453

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 84/120 (70%), Gaps = 16/120 (13%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS----  470
            KK + +L L+YE VI+AW   G PWT G RP FD +   PD+MG      H+PYG     
Sbjct  331  KKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SEFLPDYMGVCGPGLHYPYGDLNGI  387

Query  469  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                AM+    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  388  GVHPAMV----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 85/119 (71%), Gaps = 7/119 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM---GGD-HHHHHPYG  473
            K+  ++L L+YE VIS W SQG PWT       D +   C  + M   GG+ HHH+H  G
Sbjct  281  KEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDLDMLCCQTNSMCESGGEAHHHNHFPG  340

Query  472  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
              + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+ 
Sbjct  341  LGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSIV  399



>emb|CDY53119.1| BnaCnng24470D [Brassica napus]
Length=376

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 80/117 (68%), Gaps = 6/117 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYG  473
            KK+ ++L LNY+ VIS W  QG PWT G  P  D +   WP   MGG+       HH  G
Sbjct  247  KKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMGGNVRESQQKHHVGG  306

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  307  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  363



>ref|XP_010667660.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 79/126 (63%), Gaps = 8/126 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMM  461
            K+ ++LL L+YE +  AWAS G PW +G RP  + + CWP  M   G    H  +G   M
Sbjct  302  KRRKILLRLDYEAISDAWASHGSPWINGQRPQINSDDCWPHCMATCGLEGRHPIFGDHQM  361

Query  460  MRRSDEG------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
                         REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS  
Sbjct  362  GGMGGNRGIGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSFT  421

Query  298  QPPPPF  281
                 F
Sbjct  422  AATTAF  427



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 82/117 (70%), Gaps = 6/117 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD----HHHHHPYGS  470
            K+  ++L L+YE VIS W  QG PWTD      D +  C P    G+    HHH+H  G 
Sbjct  292  KEKALMLRLDYESVISTWNGQGIPWTDREPSEIDLDMVCCPTHSLGESGEAHHHNHFRGL  351

Query  469  AMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  352  GLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  408



>gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Erythranthe guttata]
Length=460

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 81/126 (64%), Gaps = 18/126 (14%)
 Frame = -2

Query  625  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--------GDHHHHHPYG-  473
            ++ L L+Y+ V+S+W  +  PWT G RP  D + CWPD  G        G+HHH      
Sbjct  325  KIFLRLDYDGVLSSWDERKSPWTTGERPDLDSDECWPDCSGTCGKMHVYGNHHHDMGMMM  384

Query  472  ---------SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  320
                     S  ++   D GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  385  MMMGGGGTHSGAVVASVDGGRQARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  444

Query  319  VKRSSL  302
            VKR++ 
Sbjct  445  VKRANF  450



>emb|CDY04230.1| BnaC06g25850D [Brassica napus]
Length=230

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 84/123 (68%), Gaps = 17/123 (14%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM----------GGD-HHH  488
            K+  ++L L+YE VISAW S   PWT       +P+    D +          GG+ HHH
Sbjct  109  KEKVLMLRLDYENVISAWGSHRTPWT-----ALEPSEIDLDMLRRQTNSVCESGGEAHHH  163

Query  487  HHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            +H  G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  164  NHFRGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  223

Query  310  SSL  302
            SS+
Sbjct  224  SSI  226



>ref|XP_006656860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=336

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPY  476
            A +S + LSLNYE +I +W S   PWTDG RPH   N  WP D+ G          H   
Sbjct  211  ALQSSLALSLNYEAIIESWGSS--PWTDGERPHVKLNDSWPHDYSGVWMAAAGVFGHGEE  268

Query  475  GSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
              A+  R    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  269  QQALTPRLQGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  327



>ref|XP_009410076.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 85/125 (68%), Gaps = 11/125 (9%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMG----GDHHHHHPY  476
            V +K+R  LSL+YE VI AW+S G  PWTDG RP  + + CW D  G    G       +
Sbjct  303  VTQKAR--LSLDYEAVIIAWSSHGSSPWTDGERPQINLDSCWHDCTGMWVEGADALGVGH  360

Query  475  GSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  296
            GS      +D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+    
Sbjct  361  GSDTGGGYADVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA----  416

Query  295  PPPPF  281
            P P F
Sbjct  417  PGPAF  421



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----HHHHHPYG  473
            K+  ++L L+YE VIS W  QG PWT       D +  C+P    G+     HHH+H  G
Sbjct  284  KEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRG  343

Query  472  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  344  LGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  401



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----HHHHHPYG  473
            K+  ++L L+YE VIS W  QG PWT       D +  C+P    G+     HHH+H  G
Sbjct  285  KEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRG  344

Query  472  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  345  LGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  402



>ref|XP_006302328.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
 gb|EOA35226.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
Length=410

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 81/121 (67%), Gaps = 9/121 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPY  476
            K+  ++L LNYE VIS W  QG PWT       D +   C  D MG       HH++H  
Sbjct  287  KEKALMLRLNYESVISTWGGQGIPWTAQQPSEIDLDMVCCPTDSMGESGVDQAHHYNHFR  346

Query  475  GSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            G  + M  +  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  347  GLGLRMGEAHGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSV  406

Query  301  F  299
             
Sbjct  407  V  407



>ref|XP_010499109.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Camelina sativa]
Length=419

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMMM  458
            ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGPPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  457  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010477926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Camelina 
sativa]
Length=419

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMMM  458
            ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  457  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>emb|CDY65591.1| BnaC05g50730D [Brassica napus]
Length=348

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 77/114 (68%), Gaps = 6/114 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-----CWPDFMGGDHHHHHPYGS  470
            +K+ ++LSLNYE VIS W  QG PW  G  P  D +         +  GG+ HH H  G 
Sbjct  219  QKNVLMLSLNYESVISTWGGQGQPWMSGEPPERDIDISDKPVVSMEINGGESHHKHYVGG  278

Query  469  AMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  279  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  332



>ref|XP_010460379.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMMM  458
            ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGPPWTSGEPPKLDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  457  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|NP_001051053.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|AAX95654.1| CCT motif, putative [Oryza sativa Japonica Group]
 gb|ABF98509.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12967.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|EAY91607.1| hypothetical protein OsI_13241 [Oryza sativa Indica Group]
 dbj|BAH00071.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            K+  M+L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  276  KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  332

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  333  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  380



>ref|XP_006307606.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
 gb|EOA40504.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
Length=424

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MG---GDHHHHHPYGSA  467
            K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP   MG   GD  H   Y S 
Sbjct  294  KNVLMLRLNYDSVISTWGGQGQPWTSGEPPELDIDISSWPPVSMGETKGDLSHQKQYVSV  353

Query  466  MMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  354  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  407



>ref|XP_010460378.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Camelina sativa]
Length=419

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMMM  458
            ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  457  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGDHHHHHPYGSAMM  461
            K++  +L L+Y+ VIS W  QG PWT    P  D +   C P+     HH+H       M
Sbjct  283  KENVPMLRLDYQAVISTWGGQGTPWTALEPPEIDLDMLCCSPNSTAHQHHNHFHGLGLRM  342

Query  460  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  343  GDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  395



>ref|XP_010460380.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Camelina sativa]
Length=427

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMMM  458
            ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  301  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  360

Query  457  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  361  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  411



>emb|CDX77359.1| BnaC08g04040D [Brassica napus]
Length=160

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMM  458
            KK+ ++L LNY+ VIS W  QG PWT G  P  D +   WP            +      
Sbjct  36   KKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMRKSAEASRWWMFTFE  95

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
               D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  96   WVWDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  147



>gb|AAM61001.1| putative B-box zinc finger protein [Arabidopsis thaliana]
Length=405

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----HHHHHPYG  473
            K+  ++L L+YE VIS W  QG PWT       D +  C+P    G+     HHH+H  G
Sbjct  284  KEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRG  343

Query  472  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGRFVKRSS+
Sbjct  344  LGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNADKRPRMKGRFVKRSSI  401



>gb|ABF98510.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=345

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            K+  M+L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  200  KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  256

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  257  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  304



>emb|CDY51133.1| BnaA07g37160D [Brassica napus]
Length=377

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYG  473
            +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP   MGG+       HH   
Sbjct  248  QKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMGGNVRESQQKHHVGV  307

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  308  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  364



>ref|XP_010470801.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
 ref|XP_010470802.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=413

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWT--DGTRPHFDPNHCWPDFMGGD-----HHHHHPY  476
            K+  ++L L+YE V+S W  QG PWT  + +    D   C  D MG       HH++H  
Sbjct  291  KEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGESGADQAHHYNHFR  350

Query  475  GSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  351  GLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  409



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWT--DGTRPHFDPNHCWPDFMGGD-----HHHHHPY  476
            K+  ++L L+YE V+S W  QG PWT  + +    D   C  D MG       HH++H  
Sbjct  305  KEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGETGADQAHHYNHFR  364

Query  475  GSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  365  GLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  423



>ref|XP_003559520.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brachypodium 
distachyon]
Length=423

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 81/120 (68%), Gaps = 7/120 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            +  +M+L L+YE VIS+W   G  PW  G RPH D +  W DF  G        G+A+  
Sbjct  288  RPDQMILKLDYEGVISSWTHDGASPWFYGERPHLDSSDSWLDFPAGSGRGFG-LGAAVTA  346

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++L    PP P
Sbjct  347  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAAL----PPLP  401



>gb|AFK49208.1| unknown [Medicago truncatula]
Length=197

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCP--WTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSAMMMR  455
             L LNYEEVI+ W+ QG P  WT    P F+  +  W + +G  G           +M  
Sbjct  74   FLRLNYEEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGS  133

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
              D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F
Sbjct  134  GGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACF  185



>ref|XP_009381448.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 12/121 (10%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHP-----  479
            V KK++  L L+YE VISAW+S G  PWTDG RP  + ++ WPD+MG             
Sbjct  297  VTKKAK--LRLDYEAVISAWSSYGSSPWTDGERPQINLDYYWPDYMGVRVEVGGGGRGET  354

Query  478  ----YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                +GS   +   D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  355  PGTGHGSDTGVGFVDVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  414

Query  310  S  308
            +
Sbjct  415  A  415



>gb|EMS53816.1| Zinc finger protein CONSTANS-LIKE 16 [Triticum urartu]
Length=282

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 76/121 (63%), Gaps = 23/121 (19%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR----  455
            + L+LNYE ++  W S   PW DG RPH   + CWP      H ++     A MM     
Sbjct  154  LALNLNYEAIMENWGSS--PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVG  205

Query  454  -----------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
                       R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  206  HGGEGLGTPRLRMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  265

Query  307  S  305
            +
Sbjct  266  N  266



>emb|CDY67920.1| BnaAnng25560D [Brassica napus]
Length=348

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-----CWPDFMGGDHHHHHPYGS  470
            +K+ ++LSLNYE VIS W  QG PW     P  D +         +  GG+ HH H  G 
Sbjct  219  QKNVLMLSLNYESVISTWGGQGQPWLSREPPERDIDISDKPVVSMEINGGESHHKHYVGG  278

Query  469  AMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  279  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  332



>gb|EAZ36554.1| hypothetical protein OsJ_20892 [Oryza sativa Japonica Group]
Length=448

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYG  473
            ++S + LSLNYE +I +W +   PWTDG RPH   +  WP D+ G          H    
Sbjct  321  QQSNLALSLNYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSGVWMAAAGVFGHGGEE  378

Query  472  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             A+  R   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  379  QALTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  433



>ref|XP_010527538.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=443

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 83/124 (67%), Gaps = 14/124 (11%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGS  470
            + KK+ ++L LN+E VIS W  +G PWT G  P  D  ++ W   MG  G+      YG 
Sbjct  311  IKKKNVLMLRLNHEAVISTWGGKGPPWTAGKPPELDLDDNSWHISMGENGNEVPLDRYGG  370

Query  469  --------AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
                    A MM   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  371  RFCGLGLQAAMM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  427

Query  313  RSSL  302
            R+S+
Sbjct  428  RASI  431



>ref|XP_004512860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=405

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCP--WTDGTRPHFDP-NHCWPDFMG---GDHHHHHPYGS  470
            K    L LNYE+VISAW  QG P  WT G  P F   + CW +F+G    D       G 
Sbjct  276  KRERFLRLNYEDVISAWNIQGSPSPWTTGNPPKFISHDDCWQNFLGPSGVDEEVRSLRGQ  335

Query  469  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +     D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  336  LIGNINGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  388



>ref|XP_010511849.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
Length=415

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 78/115 (68%), Gaps = 8/115 (7%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPYGSAM  464
            ++L L+YE V+S W  QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297  LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  463  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  357  HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  411



>gb|AAG50803.1|AC079281_5 zinc finger protein, putative [Arabidopsis thaliana]
Length=416

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGSA  467
            K+ ++L LNY+ VIS W  QG PW+ G  P  D +   WP F     GG+  H   Y   
Sbjct  289  KNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVENGGESTHQKQYVGG  348

Query  466  MMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  349  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>ref|XP_009115317.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=414

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-----CWPDFMGGDHHHHHPYGS  470
            +K+ ++LSLNYE VIS W  QG PW     P  D +         +  GG+ HH H  G 
Sbjct  285  QKNVLMLSLNYESVISTWGGQGQPWLSREPPERDIDISDKPVVSMEINGGESHHKHYVGG  344

Query  469  AMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  345  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  398



>ref|NP_173915.2| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
 sp|Q8RWD0.2|COL16_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 16 [Arabidopsis 
thaliana]
 gb|AAU90068.1| At1g25440 [Arabidopsis thaliana]
 dbj|BAE98579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30625.1| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
Length=417

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGSA  467
            K+ ++L LNY+ VIS W  QG PW+ G  P  D +   WP F     GG+  H   Y   
Sbjct  290  KNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVENGGESTHQKQYVGG  349

Query  466  MMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  350  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>gb|AAM13173.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGSA  467
            K+ ++L LNY+ VIS W  QG PW+ G  P  D +   WP F     GG+  H   Y   
Sbjct  290  KNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVENGGESTHQKQYVGG  349

Query  466  MMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  350  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_002466587.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
 gb|EER93585.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
Length=420

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWA-SQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            K+  M+L LNY+ VI++W    G PW  G RPH DP   W DF  G        G A+  
Sbjct  275  KRPEMILKLNYDGVIASWVRDGGSPWFHGERPHLDPYELWSDFPAGSRGL---LGGAVTA  331

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                E REARVSRYREKRRTRLF+KKIRYEVRK+NAEKRPR+KGRFVKR++
Sbjct  332  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKVNAEKRPRMKGRFVKRTT  381



>ref|XP_002890690.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66949.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGS  470
            +K+ +LL LNY+ VIS W  QG PW+ G  P  D +   WP       GG+  H   Y  
Sbjct  288  QKNVLLLRLNYDSVISTWGGQGPPWSSGVPPERDMDISGWPAVSMGENGGECTHKKQYVG  347

Query  469  AMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
              +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  348  GCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>gb|EMT27110.1| hypothetical protein F775_43077 [Aegilops tauschii]
Length=343

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 76/121 (63%), Gaps = 23/121 (19%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR----  455
            + L+LNYE ++  W S   PW DG RPH   + CWP      H ++     A MM     
Sbjct  215  LALNLNYEAIMENWGSS--PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVG  266

Query  454  -----------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
                       R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  267  HGGEGLGTPRLRMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  326

Query  307  S  305
            +
Sbjct  327  N  327



>ref|XP_004982006.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=406

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 74/108 (69%), Gaps = 5/108 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWA-SQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            K+  M+L LNY+ VI++WA   G PW  G RPH DP+  W DF  G        G  +  
Sbjct  260  KRPEMILKLNYDGVIASWARDGGSPWFHGERPHLDPHESWSDFPAGSRGL---LGGTVTA  316

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  317  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVK  363



>ref|XP_009103068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=408

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYG  473
            +K+ ++L LNY+ VIS W  Q  PWT G  P  D +   WP   MGG+       HH   
Sbjct  279  QKNVLMLRLNYDSVISTWGGQCPPWTSGEPPERDIDISNWPFVSMGGNVRESQQKHHVGV  338

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  339  CLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  395



>ref|XP_006649016.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=331

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 75/116 (65%), Gaps = 17/116 (15%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY------------G  473
            L LNYEE+I +W S   PWTDG RPH    H   DF   DHH+   +             
Sbjct  212  LRLNYEEIIESWGS--SPWTDGRRPH---GHQLDDFWPNDHHYQGLWAAGGGGHGAEAGT  266

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            + M  R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR +
Sbjct  267  TVMRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPA  322



>ref|XP_010471465.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Camelina sativa]
Length=402

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 78/124 (63%), Gaps = 13/124 (10%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHHHHP  479
            +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG       
Sbjct  274  RKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDCCLLGGNNTCPSHVMGGFDELESA  333

Query  478  YGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
             GS    +  D G     REARV RYR+KRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVK
Sbjct  334  VGSVTRQQGRDGGGSDVEREARVLRYRDKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVK  393

Query  313  RSSL  302
            R+SL
Sbjct  394  RTSL  397



>ref|XP_010416209.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=401

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 78/124 (63%), Gaps = 13/124 (10%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHHHHP  479
            +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG       
Sbjct  273  RKTTLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGGFEELASA  332

Query  478  YGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
             GS    +  D G     REAR+ RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVK
Sbjct  333  VGSVTRQQGRDRGGSDVEREARMLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVK  392

Query  313  RSSL  302
            R+SL
Sbjct  393  RTSL  396



>ref|XP_003630849.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AET05325.1| zinc finger constans-like protein [Medicago truncatula]
Length=416

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCP--WTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSAMMMR  455
             L LNYEEVI+ W+ QG P  WT    P F+  +  W + +G  G           +M  
Sbjct  293  FLRLNYEEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGS  352

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFP  278
              D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F      FP
Sbjct  353  GGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGATSFP  412

Query  277  -NY  272
             NY
Sbjct  413  TNY  415



>ref|XP_010926126.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 78/115 (68%), Gaps = 17/115 (15%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFM-----------GGDHHHHHP  479
            M+L L+YE VI+AW+  GC PWTDG RP F+ +    DFM           GG       
Sbjct  299  MMLRLDYEAVIAAWSCNGCSPWTDGERPQFNLD----DFMMMMWSGGSVREGGGWKVAPV  354

Query  478  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
            YG  + M   + GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  355  YGE-VGMAAGNGGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  408



>gb|KGN63817.1| hypothetical protein Csa_1G023050 [Cucumis sativus]
Length=360

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 77/115 (67%), Gaps = 15/115 (13%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----------GDHHHHHPYGS  470
            L LNY+ VI+AW +Q  P+T G RP FD + CW ++ G            D        +
Sbjct  249  LRLNYDAVITAWDAQSSPYTTGNRPQFDLDDCWEEWSGVCSKGGRNVVVDDQEWRGRNNN  308

Query  469  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
             +    S+E REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  309  GI----SNEEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  359



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPH--FDPNHCWPDFMGGDHHHHHPYGSAMM  461
            +K+ + L L+Y  VISAW + G PW  G +P      N C P  +GG        GS   
Sbjct  273  RKTSLFLRLDYGAVISAWDNHGSPWKTGIKPECMLGGNTCLPHVVGGYEKLMSSDGSVTR  332

Query  460  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
             +  D G     REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR+SL 
Sbjct  333  QQGRDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTSLL  391



>gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Erythranthe guttata]
Length=394

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 77/117 (66%), Gaps = 5/117 (4%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDP-NHCWPDFMGGDHH----HHHPYGS  470
              + M L LNYE VI+AWA++GCPWT+GT P FD  +    ++ GG             +
Sbjct  264  NNNNMFLRLNYEAVIAAWATKGCPWTNGTPPQFDNLDQFMDEWSGGSSEWCGGRIGGNNN  323

Query  469  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
                  +D  REARV RY+EKRRTRLFSKKIRY+VRKLNAE RPR+KGRFVKR + F
Sbjct  324  NNNNNNNDAEREARVLRYKEKRRTRLFSKKIRYQVRKLNAENRPRMKGRFVKRPTAF  380



>gb|ACX42573.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN21563.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=366

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K  + L LNY+EVI+AW+SQG  PWT    P F+ ++ +   + G        G  +   
Sbjct  251  KRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG-------VGGEVRSL  303

Query  454  RS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  281
            R   D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     F
Sbjct  304  RGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAF  362

Query  280  PNY  272
            P Y
Sbjct  363  PAY  365



>ref|XP_003525256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=365

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K  + L LNY+EVI+AW+SQG  PWT    P F+ ++ +   + G        G  +   
Sbjct  250  KRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG-------VGGEVRSL  302

Query  454  RS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  281
            R   D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     F
Sbjct  303  RGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAF  361

Query  280  PNY  272
            P Y
Sbjct  362  PAY  364



>gb|EAZ00428.1| hypothetical protein OsI_22452 [Oryza sativa Indica Group]
Length=447

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYG  473
            ++S + LSLNYE +I +W +   PWTDG RP    +  WP D+ G          H    
Sbjct  322  QQSSLALSLNYEAIIESWGTS--PWTDGERPRVKLDDSWPRDYSGVWMAAAGVFGHGGEE  379

Query  472  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             A+  R   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  380  QALTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  434



>ref|XP_008453390.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis melo]
Length=368

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 79/121 (65%), Gaps = 15/121 (12%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----------GDHHH  488
            KK+ + L LNY+ VI+AW +Q  P+T G RP FD + C  ++ G            D   
Sbjct  250  KKNIISLRLNYDAVITAWDAQSSPYTTGNRPQFDLDDCLEEWSGICSKGGRNVAVDDQEW  309

Query  487  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
               Y   +    S+  REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+
Sbjct  310  RRNYNGII----SNGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRT  365

Query  307  S  305
            +
Sbjct  366  T  366



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 80/122 (66%), Gaps = 9/122 (7%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K  + L LNY+EVISAW++QG  PWT    P F+  +   DF  G        G    +R
Sbjct  254  KRDIFLRLNYDEVISAWSTQGSSPWTTSNPPKFNSGY---DFCLG---LSGVDGEVRSLR  307

Query  454  -RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
               D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP
Sbjct  308  GHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGVNAFP  366

Query  277  NY  272
             Y
Sbjct  367  AY  368



>ref|XP_007153446.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
 gb|ESW25440.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
Length=384

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 77/121 (64%), Gaps = 10/121 (8%)
 Frame = -2

Query  607  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-----DHHHHHPYGSAMMMRRSDE  443
            +YE VI+AW SQ   WT   +P       WP  M       +H     +G    M  +D 
Sbjct  264  DYEAVITAWTSQRSLWTTSHKPDLGTTQFWPHCMRTCGVEFEHRSGELFGCDAAM--ADG  321

Query  442  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  263
            GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR SL   PP FP  LLN
Sbjct  322  GREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSL-ATPPIFP--LLN  378

Query  262  R  260
            +
Sbjct  379  K  379



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 77/124 (62%), Gaps = 13/124 (10%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHHHHP  479
            +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG       
Sbjct  275  RKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGGFEELASA  334

Query  478  YGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
              S    +  D G     REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVK
Sbjct  335  VRSVTRQQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVK  394

Query  313  RSSL  302
            R+SL
Sbjct  395  RTSL  398



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 81/122 (66%), Gaps = 9/122 (7%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K  + L LNY+EVI+AW+SQG  PWT    P F+ ++ +   + G        G    +R
Sbjct  256  KRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VDGEGRSLR  309

Query  454  -RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
               D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP
Sbjct  310  GHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFP  368

Query  277  NY  272
             Y
Sbjct  369  AY  370



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 81/122 (66%), Gaps = 9/122 (7%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K  + L LNY+EVI+AW+SQG  PWT    P F+ ++ +   + G        G    +R
Sbjct  256  KRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VDGEGRSLR  309

Query  454  -RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  278
               D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP
Sbjct  310  GHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFP  368

Query  277  NY  272
             Y
Sbjct  369  AY  370



>ref|XP_006302335.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
 gb|EOA35233.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
Length=407

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 79/123 (64%), Gaps = 12/123 (10%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC------WPD-FMGGDHHHHHPY  476
            +K+ + L L+YE VISAW + G PW    +P F+ + C      +P   MGG        
Sbjct  283  RKTSLFLRLDYEAVISAWDNHGSPWKTEIKPEFNLDDCLLEGNTYPSHVMGGFEEWTSAV  342

Query  475  GSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            GS    +  D G     REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVKR
Sbjct  343  GSVTRRQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVKR  402

Query  310  SSL  302
            +SL
Sbjct  403  TSL  405



>dbj|BAK01505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 77/121 (64%), Gaps = 23/121 (19%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR----  455
            + L+LNY+ ++  W S   PW DG RP+   + CWP      H ++  +  A MM     
Sbjct  304  LALNLNYDAIMENWGSS--PWADGERPNVKLDDCWP------HDYYSLHEGAWMMGGVVG  355

Query  454  -----------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
                       R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  356  HGGEGLGTPRPRMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  415

Query  307  S  305
            +
Sbjct  416  N  416



>gb|AFX97569.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 77/117 (66%), Gaps = 13/117 (11%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------  473
            K  + L LNYE VI++WAS   PWTDG RP   P     D +  DH      G       
Sbjct  64   KRSLDLRLNYEAVIASWAS--SPWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  472  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+ 
Sbjct  119  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTG  175



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPH--FDPNHCWPDFMGGDHHHHHPYGSAMM  461
            +K+ + LSL+YE VI+AW + G PW  G +       N C    +GG        GS   
Sbjct  272  RKTSLFLSLDYEAVITAWDNHGSPWKTGIKSECLLGGNTCPSHAVGGFDELVSTVGSVTR  331

Query  460  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
             +  D G     REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR+SL 
Sbjct  332  QQVKDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTSLL  390



>gb|AFK37106.1| unknown [Medicago truncatula]
Length=416

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCP--WTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSAMMMR  455
             L LNYEEVI+  + QG P  WT  + P F+  +  W + +G  G           +M  
Sbjct  293  FLRLNYEEVITECSRQGSPSPWTTASPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGS  352

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFP  278
              D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F      FP
Sbjct  353  GGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGATSFP  412

Query  277  -NY  272
             NY
Sbjct  413  TNY  415



>dbj|BAK04456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = -2

Query  628  SRMLLSLNYEEVISAWA-SQGCPWTDGTRPHFDP-NHCWPDFMGGDHHHHHPYGSAMMMR  455
            S M+L L+YE VI +WA   G PW  G RPH DP +  W D   G        G+A+   
Sbjct  277  SGMILKLDYERVIDSWAHDGGSPWFYGERPHIDPTDDSWLDMPAGSRGFG--LGAAVTAV  334

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
               E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  335  TGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTA  383



>ref|NP_001149548.1| CCT motif family protein [Zea mays]
 gb|ACG35795.1| CCT motif family protein [Zea mays]
 gb|AFW67846.1| CCT motif family protein [Zea mays]
 gb|AIB05334.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=413

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWA-SQGCPWTDGTRPHFDPNHCWPD-FMGGDHHHHHPYGSAMM  461
            K+  M+L LNYE VI++W    G PW  G RPH D +  W D F  G        G A+ 
Sbjct  264  KRPEMILKLNYEGVIASWVRDGGSPWFHGERPHLDCHELWSDDFTTGSREL---LGGAVT  320

Query  460  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                 E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  321  PVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  371



>gb|AFX97570.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 76/117 (65%), Gaps = 13/117 (11%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------  473
            K  + L LNYE VI +WAS   PWTDG RP   P     D +  DH      G       
Sbjct  64   KRSLDLRLNYEAVIESWASS--PWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  472  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+ 
Sbjct  119  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTG  175



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-DF------MGGDHHHHHPYGSAM  464
            + L+LNYE +I  W  +  PW DG RP    + CWP D+      MGG    H       
Sbjct  316  LSLNLNYEAIIDKW--EKSPWADGKRPDVKLDGCWPHDYSMSVWMMGGVLVGHGTEELRT  373

Query  463  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
               + D GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  374  PRTKMDGGRDARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  426



>ref|XP_004953821.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Setaria italica]
Length=441

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 74/119 (62%), Gaps = 20/119 (17%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY--------  476
            K  + L LNYE VI +W S   PWTDG RP    +  WP      HH HH          
Sbjct  313  KRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGR  364

Query  475  --GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
              G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  365  LGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  423



>ref|XP_004953820.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Setaria italica]
Length=465

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 74/119 (62%), Gaps = 20/119 (17%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY--------  476
            K  + L LNYE VI +W S   PWTDG RP    +  WP      HH HH          
Sbjct  337  KRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGR  388

Query  475  --GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
              G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389  LGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  447



>ref|XP_004953822.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Setaria italica]
Length=440

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 74/119 (62%), Gaps = 20/119 (17%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY--------  476
            K  + L LNYE VI +W S   PWTDG RP    +  WP      HH HH          
Sbjct  312  KRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGR  363

Query  475  --GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
              G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  364  LGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  422



>gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea]
Length=412

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 68/104 (65%), Gaps = 5/104 (5%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDE  443
              L L+ + ++SAW S+  PW  G +P       WPDF G        + +       D 
Sbjct  298  TFLKLDLDGILSAWNSRNTPWITGQKPDSKSIDFWPDFFGTTAARGDVWAAG-----GDG  352

Query  442  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  396



>gb|EYU29978.1| hypothetical protein MIMGU_mgv1a007591mg [Erythranthe guttata]
Length=402

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 77/123 (63%), Gaps = 17/123 (14%)
 Frame = -2

Query  625  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-WPDFMG-----------GDHHHHH  482
            + LL L+Y  V+SAW     PWT G RP    + C WP+F G           G  + + 
Sbjct  278  KTLLKLDYGGVMSAWDKHKSPWTTGERPPEPISGCHWPEFSGACGTMGVNGETGKINENI  337

Query  481  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
            P  +       D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  338  PAAAT-----GDGGREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANL  392

Query  301  FQP  293
              P
Sbjct  393  EAP  395



>ref|NP_001048022.1| Os02g0731700 [Oryza sativa Japonica Group]
 dbj|BAD15938.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16131.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF09936.1| Os02g0731700 [Oryza sativa Japonica Group]
 gb|EEE57750.1| hypothetical protein OsJ_08268 [Oryza sativa Japonica Group]
Length=323

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 76/121 (63%), Gaps = 18/121 (15%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA---------M  464
            L LNYE +I +W +   PWTDG  PH   +  WP+    DHH+   + +          M
Sbjct  205  LRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGM  258

Query  463  MM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            M    R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    
Sbjct  259  MTVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAA  318

Query  292  P  290
            P
Sbjct  319  P  319



>ref|XP_008801158.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=381

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 8/116 (7%)
 Frame = -2

Query  625  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-WPDFMGGDHHHHHPYGSAMMMRRS  449
            ++ L L+YE ++ AW+S   PWT+G RP F+ N C WP    GD       G        
Sbjct  269  KVALRLDYEAIMEAWSSS--PWTNGERPQFNLNVCRWP----GDMGMWVGEGGEEDKGGG  322

Query  448  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  281
             +GREA+V+RYREKRRTR+F+KKIRYEVR+LNAE+RPR+KGRFVKR +   P P F
Sbjct  323  RQGREAKVTRYREKRRTRMFAKKIRYEVRRLNAEQRPRMKGRFVKR-AFVTPTPAF  377



>gb|EEC73943.1| hypothetical protein OsI_08813 [Oryza sativa Indica Group]
Length=324

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 75/122 (61%), Gaps = 19/122 (16%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA----------  467
            L LNYE +I +W +   PWTDG  PH   +  WP+    DHH+      A          
Sbjct  205  LRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSVRVVGAGGGGHGAEVG  258

Query  466  MMM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  296
            MM    R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S   
Sbjct  259  MMTVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAA  318

Query  295  PP  290
             P
Sbjct  319  AP  320



>ref|XP_010907326.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=367

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 84/127 (66%), Gaps = 10/127 (8%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-WPDFMGGDHHHHHPYGSAM  464
               + ++ L L+YE +++AW+S   PWT+G RP F+ + C WPD MG             
Sbjct  250  AVSRKKVALRLDYEAIMAAWSSS--PWTNGARPQFNLDVCSWPD-MG-----MWAGEGGE  301

Query  463  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  284
                  + RE++V+RYREKRRTRLF+KKIRYEVR+LNAEKRPR+KGRFVKR+S+  P P 
Sbjct  302  DKGGGRQERESKVTRYREKRRTRLFAKKIRYEVRRLNAEKRPRMKGRFVKRASM-APTPA  360

Query  283  FPNYLLN  263
            F   +L+
Sbjct  361  FAGPVLD  367



>gb|ACL53155.1| unknown [Zea mays]
Length=157

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDG-TRPHFDPNHCWP-DFMG--------GDHHHHH  482
            ++ + L+LNYE +I +W S   PWT G  RPH   +  WP D+          G      
Sbjct  33   QTSLSLTLNYEAIIQSWGS--SPWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDL  90

Query  481  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            P    + M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  91   PGTPRLGM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  146



>ref|NP_001057333.2| Os06g0264200 [Oryza sativa Japonica Group]
 dbj|BAD54363.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19247.2| Os06g0264200 [Oryza sativa Japonica Group]
Length=481

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 80/148 (54%), Gaps = 42/148 (28%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA----  467
            ++S + LSLNYE +I +W +   PWTDG RPH   +  WP           PY S+    
Sbjct  321  QQSNLALSLNYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSVRATPCTPYASSHRIL  378

Query  466  --------MMMRRS----------------------------DEGREARVSRYREKRRTR  395
                    ++ RR+                            D GREARVSRYREKRRTR
Sbjct  379  HNLAGTDDLLRRRAAVQGVWMAAAGVFGHGGEEQALTPRLGMDGGREARVSRYREKRRTR  438

Query  394  LFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            LFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  439  LFSKKIRYEVRKLNAEKRPRMKGRFVKR  466



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 77/124 (62%), Gaps = 21/124 (17%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWPDFM-------------GGDH  494
            ++ + L+LNYE +I +W S   PWT G  RPH   +  WP                GG+ 
Sbjct  328  QTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHGGED  385

Query  493  HHHHP-YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  317
                P  G  M     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  386  LLGTPRLGQGM----DDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  441

Query  316  KRSS  305
            KR++
Sbjct  442  KRAT  445



>dbj|BAD15937.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16130.1| zinc finger protein-like [Oryza sativa Japonica Group]
Length=452

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 76/121 (63%), Gaps = 18/121 (15%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA---------M  464
            L LNYE +I +W +   PWTDG  PH   +  WP+    DHH+   + +          M
Sbjct  334  LRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGM  387

Query  463  MM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
            M    R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    
Sbjct  388  MTVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAA  447

Query  292  P  290
            P
Sbjct  448  P  448



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 77/124 (62%), Gaps = 21/124 (17%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWPDFM-------------GGDH  494
            ++ + L+LNYE +I +W S   PWT G  RPH   +  WP                GG+ 
Sbjct  328  QTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHGGED  385

Query  493  HHHHP-YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  317
                P  G  M     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  386  LLGTPRLGQGM----DDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  441

Query  316  KRSS  305
            KR++
Sbjct  442  KRAT  445



>ref|XP_002452605.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
 gb|EES05581.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
Length=488

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 72/112 (64%), Gaps = 7/112 (6%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-----DFMGGDHHHHHPYGSA  467
            K  + LSLNYE +I +W S   PWTDG RP+   +  WP      +M G         + 
Sbjct  361  KRSLDLSLNYEAIIESWGSS--PWTDGQRPNVQLDDFWPHAHLTGWMAGGGRLGGEAAAV  418

Query  466  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                    GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  419  SPRLGMVGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  470



>emb|CDY24402.1| BnaCnng04690D [Brassica napus]
Length=369

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM----GGDHHHHHPYGSA  467
            KK+ ++LSL+Y++VIS W  QG PWT G  P  D N      +     G        G  
Sbjct  240  KKNVLMLSLDYDQVISTWGGQGLPWTSGGPPDIDINISGSPVVSKRDNGRKSRKKRRGGG  299

Query  466  MMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             +      D GREARVSRYREK++TR F+K IRYEVRKLNAE +PR+KGRFVKR+SL
Sbjct  300  RLPSSVVGDGGREARVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGRFVKRASL  356



>gb|ACF84125.1| unknown [Zea mays]
Length=226

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDG-TRPHFDPNHCWP-DFMG--------GDHHHHH  482
            ++ + L+LNYE +I +W S   PWT G  RPH   +  WP D+          G      
Sbjct  102  QTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDL  159

Query  481  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            P    + M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  160  PGTPRLGM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  215



>dbj|BAJ87752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 77/116 (66%), Gaps = 13/116 (11%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------  473
            K  + L LNYE VI++WAS   PWTDG RP   P     D +  DH      G       
Sbjct  380  KRSLDLRLNYEAVIASWASS--PWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  434

Query  472  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  435  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  490



>gb|AGI62036.1| CONSTANS-like 12 [Erycina pusilla]
Length=339

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGS  470
            V     M LSL+YE V  AW   G  PW  G RP       W + +G  G+         
Sbjct  221  VGISKGMGLSLDYEAVKEAWMVTGSSPWMTGERPRMGVEDYWHECLGKFGETGGEFIGSG  280

Query  469  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  299
              +++  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ +F
Sbjct  281  TGIIQFMDLGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTDVF  337



>ref|XP_008646195.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 gb|AFW73247.1| hypothetical protein ZEAMMB73_807545 [Zea mays]
 gb|AIB05540.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=496

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 74/114 (65%), Gaps = 12/114 (11%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-----DFMGGDHHHHHPYGSA  467
            K  + LSLNYE +I +W S   PWTDG RP    +  WP      +M G        G A
Sbjct  334  KRSLDLSLNYEAIIESWGSS--PWTDGQRPSVQLDDFWPHAHLTGWMAGGGRLG---GEA  388

Query  466  MMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             +  R     GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389  AVTPRLGMGGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  442



>ref|XP_009381104.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 83/136 (61%), Gaps = 21/136 (15%)
 Frame = -2

Query  640  VAKKSRMLLSLNYEEVISAWASQGCP-WTDGTRPHFDPNHCWPDF--------MGGDHHH  488
             A K +M+L L+YE VI+A +S     W DG RP FDPN  WPD            + H+
Sbjct  296  AAAKRKMILRLDYEAVIAACSSNVLSLWIDGVRPDFDPNDSWPDVPAMAGGAAAMKEMHY  355

Query  487  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
                  A     +DEGREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR 
Sbjct  356  QQEVAHA-----ADEGREARVSRYREKRRRRLFSKKIRYEVRKLNAEKRPRMKGRFVKR-  409

Query  307  SLFQPPPPFPNYLLNR  260
                  P FP  L  R
Sbjct  410  ------PAFPAALACR  419



>ref|XP_002436824.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
 gb|EER88191.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
Length=474

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 77/115 (67%), Gaps = 8/115 (7%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWT-DGTRPHFDPNHCWP-DFMGGDHHHHHPYGSAMMM  458
            ++ + L+LNYE +I +W S   PWT  G RPH   +  WP   M          G  +++
Sbjct  350  QTSLSLTLNYEAIIQSWGSS--PWTAGGERPHVKLDDSWPHTNMWVVGGVAGHGGEDLLL  407

Query  457  RRS----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
              +    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  408  GTARLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  462



>ref|XP_009109881.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=395

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK+ ++LSL+Y++VISAW  QG PWT G  P  D N      +       +   S    R
Sbjct  263  KKNVLMLSLDYDQVISAWGGQGLPWTSGGPPELDINISGSPVVSKVSKRDNGRKSRKKRR  322

Query  454  ---------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                       D GREA VSRYREK++TR F+K IRYEVRKLNAE +PR+KGRFVKR+ L
Sbjct  323  VGGCLPSSVVGDGGREASVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGRFVKRTPL  382



>ref|XP_010511850.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=411

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 70/107 (65%), Gaps = 8/107 (7%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPYGSAM  464
            ++L L+YE V+S W  QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297  LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  463  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  326
             M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  357  HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  403



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 19/125 (15%)
 Frame = -2

Query  625  RMLLSLNYEEVISAWASQGCPWTDGTRPH-------FDPNHCW-----PDFMGGDHHHHH  482
            ++ L L+YE+V++AW+ +G  WT+G RP        FDP         PDF   +     
Sbjct  320  KITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM-ESTEVE  378

Query  481  PYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  320
              G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRF
Sbjct  379  AVGQVPVVNFGEDRLTPQGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  319  VKRSS  305
            VKR++
Sbjct  439  VKRTN  443



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 19/125 (15%)
 Frame = -2

Query  625  RMLLSLNYEEVISAWASQGCPWTDGTRPH-------FDPNHCW-----PDFMGGDHHHHH  482
            ++ L L+YE+V++AW+ +G  WT+G RP        FDP         PDF   +     
Sbjct  320  KITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM-ESTEVE  378

Query  481  PYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  320
              G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRF
Sbjct  379  AVGQVPVVNFGEDRLTPRGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  319  VKRSS  305
            VKR++
Sbjct  439  VKRTN  443



>ref|XP_003573014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
 ref|XP_010236028.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
Length=448

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 76/120 (63%), Gaps = 12/120 (10%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY-----GSA  467
            K  + L LNYE VI  W S   PWTDG RPH        D +  DH++   +     G  
Sbjct  329  KRSLDLRLNYEAVIEGWGSS--PWTDGRRPH---GGQLDDLLLHDHYYSGMWTAAAGGGR  383

Query  466  MMMRRSDEG--REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  293
                 +D+G  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +   P
Sbjct  384  AARPAADDGGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRPAGAAP  443



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDG-TRPHFDPNHCWP-DFMG--------GDHHHHH  482
            ++ + L+LNYE +I +W S   PWT G  RPH   +  WP D+          G      
Sbjct  328  QTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDL  385

Query  481  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            P    + M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  386  PGTPRLGM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  441



>ref|XP_004965182.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=445

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 78/120 (65%), Gaps = 17/120 (14%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWT-DGTRPHFDPNHCWP-DFMG------GDHHHHHPY  476
            ++ + L+LNYE +I +W S   PWT  G RPH   +  WP D+           H     
Sbjct  321  QTSLSLTLNYEAIIQSWGSS--PWTGSGERPHVKLDGSWPHDYTSMWVVGGMVGHVGEEL  378

Query  475  GS---AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            G+    MM    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  379  GTPRLGMM----DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  434



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 5/108 (5%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGD----HHHHHPYGSAMMMRR  452
            LL LN+++V+SAW+ +   WTDG RP   P+       G D       +  Y     +  
Sbjct  365  LLRLNFDDVLSAWSDRSL-WTDGRRPQTVPDDSSEAVGGTDVGLVPDINTQYAQGATLAA  423

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
             D+GRE RV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVK++
Sbjct  424  GDKGREFRVMRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKQT  471



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 72/116 (62%), Gaps = 19/116 (16%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-----------WPDFMGGDHHHHHPYG  473
            LL LN+++V+SAW+ +   WTDG RP   P+              PD   G        G
Sbjct  385  LLRLNFDDVLSAWSDRSL-WTDGKRPQTVPDDSSEAVGGLDLGLVPDLSKGCAQGQPGTG  443

Query  472  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                    D GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR++
Sbjct  444  G-------DRGREARVLRYREKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKRTT  492



>gb|EMT01944.1| hypothetical protein F775_21198 [Aegilops tauschii]
Length=340

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 74/118 (63%), Gaps = 16/118 (14%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-  455
            K  + L LNYE V+ +W S   PWTDG RP   P     D +  DH      G     R 
Sbjct  217  KRSLDLRLNYEAVMESWGSS--PWTDGRRP---PGQL-DDLLLHDHAGMWTAGGGGGGRH  270

Query  454  ---------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
                     R+DE REARVSRYR+KRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  271  GEAAWPPRPRTDEWREARVSRYRKKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  328



>ref|XP_010519197.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X2 [Tarenaya 
hassleriana]
Length=448

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 80/122 (66%), Gaps = 11/122 (9%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGS  470
            AKK  + L L+YE V+ AW S+  PWT G  P F P++ W D +G    G        GS
Sbjct  326  AKKQSLFLRLDYEAVMIAWDSECSPWTTGRCPDFRPSNFWLDCLGFVIDGSEEATPAVGS  385

Query  469  AMMMRR-----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
              M RR     SD  REARV RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFV+R+S
Sbjct  386  --MPRRQGRGGSDGEREARVLRYREKRRRRLFAKKIRYEVRKLNAEKRPRIKGRFVRRTS  443

Query  304  LF  299
             +
Sbjct  444  SY  445



>emb|CBI15893.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 14/102 (14%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+ +G  W D          C   F    +    P     +M      R
Sbjct  6    LNLNYQEVLEAWSDRGSLWAD---------DCSLSFKNTSYMGEVP-----VMEEEKTRR  51

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  52   EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  93



>ref|XP_008354841.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Malus domestica]
Length=234

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186  EEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_009354295.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009341688.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK R+ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR KGRFVKR
Sbjct  186  DEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKR  233



>ref|XP_010519196.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X1 [Tarenaya 
hassleriana]
Length=450

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 79/122 (65%), Gaps = 9/122 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD-----FMGGDHHHHHPYG  473
            AKK  + L L+YE V+ AW S+  PWT G  P F P++ W D     F+        P  
Sbjct  326  AKKQSLFLRLDYEAVMIAWDSECSPWTTGRCPDFRPSNFWLDCLLQGFVIDGSEEATPAV  385

Query  472  SAMMMRR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
             +M  R+    SD  REARV RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFV+R+S
Sbjct  386  GSMPRRQGRGGSDGEREARVLRYREKRRRRLFAKKIRYEVRKLNAEKRPRIKGRFVRRTS  445

Query  304  LF  299
             +
Sbjct  446  SY  447



>ref|XP_010685899.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 12/109 (11%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            K+ + L+LNYEEV+ AW+++G  W     P           M  +H+     G    +  
Sbjct  126  KTSLNLNLNYEEVLEAWSNRGSLWAHNHHPSLS--------MSSNHY----MGEVPNLEE  173

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                RE  V RY+EKRR+RLFSKKIRYEVRKLNA+KRPRLKGRFVKR S
Sbjct  174  ERTRRETSVLRYKEKRRSRLFSKKIRYEVRKLNADKRPRLKGRFVKRIS  222



>ref|XP_006488582.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Citrus sinensis]
Length=246

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 12/109 (11%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            A   ++ L+LNY++V+ AW+ +G  WTD       P+H +  +MG             +M
Sbjct  149  ASSLKLNLNLNYQQVLDAWSDRGPLWTDDFSLSSVPSHSY--YMG----------EVPVM  196

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                  REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  197  EEDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  245



>ref|XP_004294775.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Fragaria vesca 
subsp. vesca]
Length=236

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK ++ L+LNY+EV+ AW+ +G  W +    H        ++MG            +M  
Sbjct  136  KKVQLNLNLNYQEVLDAWSDRGSLWAEDCSSHSSMAASNGNYMGE---------VPVMEE  186

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                 REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  187  EKSIRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  236



>ref|XP_008384739.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Malus 
domestica]
Length=234

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVLDAWSDRGSLWAD---------DCSLSSMASNGNY---MGEVPVME  185

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186  EDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_009369559.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Pyrus x bretschneideri]
Length=234

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVLDAWSDRGSLWAD---------DCSLSSMASNGNYM---GEVPVME  185

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186  EDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>gb|KDP45740.1| hypothetical protein JCGZ_17347 [Jatropha curcas]
Length=238

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 12/104 (12%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+ +G  W          N C       + ++    G   +M      R
Sbjct  147  LNLNYQEVLDAWSDRGSLWA---------NDCSASMATSNTYYM---GEVPVMEEEKTRR  194

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  195  EASVMRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  238



>ref|XP_006425148.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|ESR38388.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|KDO67018.1| hypothetical protein CISIN_1g025320mg [Citrus sinensis]
Length=244

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            + S + L+LNY++V+ AW+ +G  WTD       P+H +  +MG             +M 
Sbjct  148  RASSLNLNLNYQQVLDAWSDRGPLWTDDFSLSSVPSHGY--YMG----------EVPVME  195

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  196  EDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  243



>ref|XP_007016977.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
 gb|EOY34596.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
Length=240

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 13/110 (12%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K+  + L+LNY++V+ AW+ +G  W D             D+      + +  G   +M 
Sbjct  144  KRVSLNLNLNYQDVLDAWSDRGSLWAD-------------DYSISKASNGYYMGEVPVME  190

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                 REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  191  EERARREASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  240



>ref|XP_002274679.2| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Vitis vinifera]
Length=218

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 62/102 (61%), Gaps = 14/102 (14%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+ +G  W D     F               +    G   +M      R
Sbjct  123  LNLNYQEVLEAWSDRGSLWADDCSLSF--------------KNTSYMGEVPVMEEEKTRR  168

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  169  EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  210



>ref|XP_011003377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Populus euphratica]
Length=207

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 13/110 (12%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K+  + L+LNY+EV+ AW+ +G    D           +   MG + ++    G   +M 
Sbjct  111  KRVSLNLNLNYQEVLDAWSDRGSLLADD----------YSLSMGSNCYYK---GEVPVME  157

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                 REA V RYREKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  158  EDRTRREASVLRYREKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  207



>ref|XP_008797174.1| PREDICTED: uncharacterized protein LOC103712429 [Phoenix dactylifera]
Length=232

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 70/115 (61%), Gaps = 17/115 (15%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY-----GSAMMM  458
            + L L+YE+V++AW+ +G  + DG  P   P           HH   P       +   +
Sbjct  126  LSLKLDYEDVLTAWSDRGSLYIDGDGPQVVPEL---------HHTASPVMVEVGSTGWRV  176

Query  457  RRSDE---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
              SD     REARV RY+EKRR+RLFSK++RYEVRKLNAE+RPRLKGRFVKR  +
Sbjct  177  PESDREAGNREARVMRYKEKRRSRLFSKRVRYEVRKLNAERRPRLKGRFVKRKDV  231



>ref|XP_008799931.1| PREDICTED: uncharacterized protein LOC103714457 [Phoenix dactylifera]
Length=268

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = -2

Query  619  LLSLNYEEVISAWASQGCPWTDGTRPHFDPN---HCWPDFMGGDHHHHHPYGSAMMMRRS  449
            LL L+YEEV++AW+ +G  + DG  P   P       P F+           S  M  + 
Sbjct  160  LLKLDYEEVLTAWSDRGSLYIDGEGPQIVPELHRTASPVFVEVGCTGWRVPESDRMEGKE  219

Query  448  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
               REARV RY+EKRR+R FSK+IRYEVRKLNAEKRPRLKGRFV+R
Sbjct  220  VGNREARVMRYKEKRRSRHFSKQIRYEVRKLNAEKRPRLKGRFVRR  265



>ref|XP_008665284.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 tpg|DAA50967.1| TPA: hypothetical protein ZEAMMB73_914054 [Zea mays]
 gb|AIB05335.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=454

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWA-SQGCPWTDGTRPHFD-PNHCWPDFMGGDHHHHHPYGSAMM  461
            K++ M+L LNYE VI++W    G PW  G RPH D P   W +F          +G  M 
Sbjct  303  KRTDMILKLNYEGVIASWVRDGGSPWYHGERPHLDDPYELWLEFPATGSRGL--FGGTMT  360

Query  460  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
                 E REARVSRYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  361  AVTGGE-REARVSRYREKRRRRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTT  411



>ref|XP_008354834.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Malus domestica]
Length=235

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 13/109 (12%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  311
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLK GRFVKR
Sbjct  186  EEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKQGRFVKR  234



>gb|KHN40106.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Glycine soja]
Length=220

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  130  LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  177

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  178  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  219



>ref|XP_003544900.2| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Glycine max]
Length=240

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  150  LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  197

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  198  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  239



>ref|XP_009125969.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Brassica 
rapa]
Length=156

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 69/114 (61%), Gaps = 4/114 (4%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMMR  455
            ++ + L L+YEE++ AW  +G  + DG  P   P+ H   D + G       +    M  
Sbjct  43   RTSLALKLDYEEIMEAWPDKGTLYVDGEPPQTVPDLHASTDVVTGGGEAGSLWTVPEMET  102

Query  454  RSD---EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                    REA + RY+EKR++RLFSK+IRY+VRKLNAEKRPR+KGRFVKR  L
Sbjct  103  TETLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRVKGRFVKRDDL  156



>ref|XP_001769217.1| predicted protein [Physcomitrella patens]
 gb|EDQ65929.1| predicted protein [Physcomitrella patens]
Length=646

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC----------WPDFMGGDHHH  488
             K +  LL LNYE+++SAW+ +   WTDG RP   P+             PDF  G+   
Sbjct  381  VKPAPSLLRLNYEDIMSAWSDRSL-WTDGKRPQTVPDDSNSESTVDLGMVPDF--GNGCQ  437

Query  487  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  320
              P GS       D GR AR+ RYREKRRTRLFSKKIRYEVRKLNAE+RPR+K + 
Sbjct  438  TVPGGS-------DGGRGARIMRYREKRRTRLFSKKIRYEVRKLNAERRPRMKSQL  486



>ref|XP_006574444.1| PREDICTED: uncharacterized protein LOC100803772 isoform X1 [Glycine 
max]
Length=217

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  127  LNLNYQEVLDAWSDRGSLWADDCSLSFATNNAY--YMG----------EVPVLEEERARR  174

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  175  EACVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_007206389.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
 gb|EMJ07588.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
Length=241

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 12/108 (11%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K+  + L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  143  KRVHLNLNLNYQEVLDAWSDRGPLWAD---------DCSRSSMASNGNY---MGEVPIME  190

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  191  EDRTRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  238



>ref|XP_009354286.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009341687.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
Length=235

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 13/109 (12%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            KK R+ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  311
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR K GRFVKR
Sbjct  186  DEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKQGRFVKR  234



>ref|XP_011010948.1| PREDICTED: uncharacterized protein LOC105115687 [Populus euphratica]
Length=310

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 8/111 (7%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEG-  440
            L L+Y+E+++AW+ +G  + +G  P   P+ C       D   H      +   ++ EG 
Sbjct  197  LKLDYQEILNAWSDKGPLYIEGESPQTVPDICDGSNQLMDEWGHVWRVPDLCGSKTKEGK  256

Query  439  -------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
                   REA V RY+EKR+ RLF+K+IRYEVRKLNAEKRPRLKGRFVKRS
Sbjct  257  EIWKSGLREASVLRYKEKRQNRLFAKRIRYEVRKLNAEKRPRLKGRFVKRS  307



>ref|XP_008233500.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Prunus mume]
Length=241

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -2

Query  634  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  455
            K+ ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  143  KRVQLNLNLNYQEVLDAWSDRGPLWAD---------DCSRSSMASNGNY---MGEVPIME  190

Query  454  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
                 REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFV+R
Sbjct  191  EERTRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVRR  238



>ref|XP_010938521.1| PREDICTED: uncharacterized protein LOC105057575 [Elaeis guineensis]
Length=233

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 69/115 (60%), Gaps = 17/115 (15%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY----GSAMMMR  455
            + L L+YEEV++AW+ +G  + DG  P   P+          +H   P     GS     
Sbjct  127  LSLKLDYEEVLTAWSDRGSLYIDGDGPQVVPDL---------YHTTSPVLVEVGSTGWTV  177

Query  454  RSDE----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
               E     REARV RY+EKRR+RLFSK+IRYEVRKLNAEKRPR KGRFV+R  +
Sbjct  178  PESELEVGNREARVMRYKEKRRSRLFSKRIRYEVRKLNAEKRPRSKGRFVRRKDV  232



>ref|XP_008799492.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2-like [Phoenix dactylifera]
Length=411

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 65/112 (58%), Gaps = 8/112 (7%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  452
            KS + L LN+EEV+ AW+  G  + DG                 D       G  +    
Sbjct  300  KSGLGLKLNHEEVLKAWSGHGSVFADGPDSPHSSAEALAKLADIDLFPEAGGGGGV----  355

Query  451  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  296
                REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFVKR SL Q
Sbjct  356  ----REASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVKRPSLLQ  403



>ref|XP_003615824.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
 gb|ACJ84105.1| unknown [Medicago truncatula]
 gb|AES98782.1| CCT motif protein [Medicago truncatula]
 gb|AFK39776.1| unknown [Medicago truncatula]
Length=217

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 65/102 (64%), Gaps = 11/102 (11%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+++G  W          N C   F   ++  +   G   ++      R
Sbjct  126  LNLNYQEVLDAWSNRGSLWA---------NDCSLSFSSSNNGSYM--GEVPILEEERARR  174

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  175  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_002298500.1| CONSTANS-like family protein [Populus trichocarpa]
 gb|EEE83305.1| CONSTANS-like family protein [Populus trichocarpa]
Length=207

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 13/102 (13%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  437
            L+LNY+EV+ AW+ +G        P    +H       G     H  G   +M      R
Sbjct  117  LNLNYQEVLEAWSDRG--------PLLADDHSLSTASNG-----HYMGEVPVMEEDRTRR  163

Query  436  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  164  EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  205



>ref|XP_001765504.1| predicted protein [Physcomitrella patens]
 gb|EDQ69765.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 68/107 (64%), Gaps = 16/107 (15%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDE--  443
            L LNYE+VI+AW+ +G PW       F P+ C  D               M    +D+  
Sbjct  380  LRLNYEDVITAWSDRGEPW-------FYPHDCTSDATDAG------LVPDMAQEGADDCQ  426

Query  442  -GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  305
              REA V R++EKRR+RLFSK+IRYEVRKLNAEKRPR+KGRFVK++S
Sbjct  427  GSREASVMRFKEKRRSRLFSKRIRYEVRKLNAEKRPRMKGRFVKKNS  473



>ref|XP_006453246.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
 ref|XP_006474272.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR66486.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
Length=442

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 13/110 (12%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            A    +LL L Y++V++AW+ +G P+ D +          PD  G D         A + 
Sbjct  325  ANSGELLLKLQYDDVLNAWSGKGSPFLDES--------LAPDGQGNDVSARL----AQID  372

Query  457  RRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
              SD G REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFV+R
Sbjct  373  LFSDGGLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  422



>ref|XP_010927568.1| PREDICTED: uncharacterized protein LOC105049568 [Elaeis guineensis]
Length=231

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 68/115 (59%), Gaps = 17/115 (15%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAM-------  464
            + L L+YEEV++AW+ +G  + DG  P   P+          HH   P    +       
Sbjct  125  LSLKLDYEEVLTAWSGRGSFYIDGDGPQVVPDL---------HHTTSPVLVEVRSTGWRV  175

Query  463  -MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                R    REARV RY+EKRR+RLFSK+IRYEVRKL+AEKRPR KGRFVKR  +
Sbjct  176  PESEREVGNREARVMRYKEKRRSRLFSKRIRYEVRKLDAEKRPRSKGRFVKRKDV  230



>ref|XP_009383142.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Musa acuminata 
subsp. malaccensis]
Length=324

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 29/123 (24%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR----  455
            + L L+YEE+++ W+ +G  + DG  P   P               HP  SAM++     
Sbjct  208  LALKLDYEEILAVWSDRGPLYMDGEGPQVVP------------QLQHPCDSAMLVEVGCR  255

Query  454  -------------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  314
                         RS   REARV RY+EKRR RLF+K+IRYEVRK NAEKRPR+KGRFV+
Sbjct  256  SWKVPEQPAEGKERSGMSREARVMRYKEKRRNRLFAKRIRYEVRKFNAEKRPRVKGRFVR  315

Query  313  RSS  305
            R+ 
Sbjct  316  RND  318



>gb|KFK25676.1| hypothetical protein AALP_AA8G144900 [Arabis alpina]
Length=329

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 71/115 (62%), Gaps = 6/115 (5%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMMR  455
            ++ + L L+YE+++ AW+ +G  + DG  P   P+ H  PD    D        +   M 
Sbjct  216  RTSLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASPDGFA-DAGEAGSLWTVPEME  274

Query  454  RSDE----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             ++      REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR+KGRFVKR  L
Sbjct  275  TTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKRDDL  329



>emb|CDX70561.1| BnaC03g06450D [Brassica napus]
Length=151

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = -2

Query  631  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM--GGDHHHHHPYGSAMM  461
            +S + L L+YE+++ AW  +G  + DG  P   P+ H   D    GG+     P     M
Sbjct  40   RSSLALKLDYEQIMEAWLDKGTLYVDGEPPQTVPDLHASADVFTSGGEALWAVPE-METM  98

Query  460  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
             R     REA + RY+EKR++ LFSK+IRY+VRKLNAEKRPR+KGRFVKR  L
Sbjct  99   ERLWRVHREASLLRYKEKRQSLLFSKRIRYQVRKLNAEKRPRIKGRFVKRDDL  151



>ref|XP_006286526.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 ref|XP_006286527.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 ref|XP_006286528.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19424.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19425.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19426.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
Length=337

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 5/112 (4%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMMRRSD  446
            + L L+YE+++ AW+ +G  + DG  P   P+ H   D  G        +    M   ++
Sbjct  226  LALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGFGDGGEAGSIWAVPEMETTTE  285

Query  445  E----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  302
                  REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR+KGRFVKR  L
Sbjct  286  RLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKRDDL  337



>ref|XP_007142158.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
 gb|ESW14152.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
Length=217

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 14/103 (14%)
 Frame = -2

Query  616  LSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGDHHHHHPYGSAMMMRRSDEG  440
            L+LNY+EV+ AW+++G  W D        N+ C+              G   ++      
Sbjct  127  LNLNYQEVLDAWSNRGSLWADECSLSLATNNSCYN-------------GEVPVLEEERAR  173

Query  439  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
            REA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  174  REASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_010046933.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Eucalyptus 
grandis]
 gb|KCW78650.1| hypothetical protein EUGRSUZ_C00112 [Eucalyptus grandis]
Length=397

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 13/104 (13%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDE  443
            +LL LNY+EV+ AW+ +G P+ D +           D  G D           +   S  
Sbjct  295  LLLKLNYDEVVDAWSGKGSPFPDDS-----------DGAGNDVSAR--LAQIDLFLESGG  341

Query  442  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
             REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFV+R
Sbjct  342  LREASVQRYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  385



>ref|XP_009144991.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8 [Brassica rapa]
 emb|CDY66242.1| BnaA05g36570D [Brassica napus]
Length=314

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 8/110 (7%)
 Frame = -2

Query  637  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  458
            AK+  +LL LNYE VI+AW  Q  P    T   ++ N    +F    +    P G     
Sbjct  208  AKQRNLLLRLNYENVIAAWDKQESP----TTATWNQN----EFSNTSNFQLVPPGIEEEK  259

Query  457  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  308
              +   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  260  VSNRSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRIKGRFVRRS  309



>emb|CDY09849.1| BnaC09g43120D [Brassica napus]
Length=331

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 4/108 (4%)
 Frame = -2

Query  622  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM--GGDHHHHHPYGSAMMMRR  452
            + L L+YE+++ AW+ +G  + DG  P   P+ H   D    GGD              R
Sbjct  222  LALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADVFTGGGDSGSLWTVPEMETTER  281

Query  451  SDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  311
               G REA + RY+EKR+ RLFSK+IRYEVRKLNAEKRPR+KGRFVKR
Sbjct  282  LWRGHREASLLRYKEKRQNRLFSKRIRYEVRKLNAEKRPRVKGRFVKR  329



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840