BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001H20

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592008.1|  PREDICTED: uncharacterized protein LOC104088938    317   5e-105   Nicotiana tomentosiformis
ref|XP_006347543.1|  PREDICTED: uncharacterized protein LOC102597734    317   9e-105   Solanum tuberosum [potatoes]
ref|XP_009774884.1|  PREDICTED: uncharacterized protein LOC104224864    317   1e-104   Nicotiana sylvestris
ref|XP_004235047.1|  PREDICTED: uncharacterized protein LOC101257149    314   8e-104   Solanum lycopersicum
ref|XP_009361233.1|  PREDICTED: mitochondrial import inner membra...    306   9e-101   Pyrus x bretschneideri [bai li]
ref|XP_008376859.1|  PREDICTED: uncharacterized protein LOC103439979    303   1e-99    Malus domestica [apple tree]
ref|XP_003523301.1|  PREDICTED: uncharacterized protein LOC100775460    303   2e-99    Glycine max [soybeans]
ref|XP_004502789.1|  PREDICTED: uncharacterized protein LOC101495679    303   2e-99    Cicer arietinum [garbanzo]
ref|XP_003526780.1|  PREDICTED: uncharacterized protein LOC100813121    302   3e-99    Glycine max [soybeans]
ref|XP_002317852.1|  mitochondrial import inner membrane transloc...    302   4e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008381679.1|  PREDICTED: uncharacterized protein LOC103444516    302   4e-99    Malus domestica [apple tree]
ref|XP_007218831.1|  hypothetical protein PRUPE_ppa010176mg             302   6e-99    Prunus persica
ref|XP_010035340.1|  PREDICTED: mitochondrial import inner membra...    301   1e-98    Eucalyptus grandis [rose gum]
ref|XP_008234610.1|  PREDICTED: uncharacterized protein LOC103333537    300   2e-98    Prunus mume [ume]
ref|XP_009351884.1|  PREDICTED: mitochondrial import inner membra...    300   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_002321938.1|  mitochondrial import inner membrane transloc...    299   7e-98    Populus trichocarpa [western balsam poplar]
gb|KCW46677.1|  hypothetical protein EUGRSUZ_K00480                     298   1e-97    Eucalyptus grandis [rose gum]
ref|XP_002519617.1|  protein translocase, putative                      298   2e-97    Ricinus communis
ref|XP_011003323.1|  PREDICTED: uncharacterized protein LOC105110098    298   2e-97    Populus euphratica
gb|KJB52400.1|  hypothetical protein B456_008G262900                    296   5e-97    Gossypium raimondii
ref|XP_010045371.1|  PREDICTED: uncharacterized protein LOC104434104    295   2e-96    Eucalyptus grandis [rose gum]
ref|XP_010276440.1|  PREDICTED: uncharacterized protein LOC104611181    295   4e-96    Nelumbo nucifera [Indian lotus]
gb|KDP24771.1|  hypothetical protein JCGZ_25171                         293   1e-95    Jatropha curcas
ref|XP_007136378.1|  hypothetical protein PHAVU_009G040400g             293   1e-95    Phaseolus vulgaris [French bean]
ref|XP_004145954.1|  PREDICTED: uncharacterized protein LOC101208652    292   2e-95    Cucumis sativus [cucumbers]
gb|AGV54806.1|  hypothetical protein                                    292   3e-95    Phaseolus vulgaris [French bean]
ref|XP_002267996.1|  PREDICTED: mitochondrial import inner membra...    291   5e-95    Vitis vinifera
gb|EYU45348.1|  hypothetical protein MIMGU_mgv1a012092mg                290   2e-94    Erythranthe guttata [common monkey flower]
ref|XP_004160398.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    289   3e-94    
ref|XP_011084594.1|  PREDICTED: uncharacterized protein LOC105166...    290   4e-94    Sesamum indicum [beniseed]
ref|XP_008437651.1|  PREDICTED: uncharacterized protein LOC103482996    288   7e-94    Cucumis melo [Oriental melon]
gb|KJB52401.1|  hypothetical protein B456_008G262900                    286   6e-93    Gossypium raimondii
gb|KHG08602.1|  Mitochondrial import inner membrane translocase s...    286   7e-93    Gossypium arboreum [tree cotton]
ref|XP_011075839.1|  PREDICTED: mitochondrial import inner membra...    286   9e-93    Sesamum indicum [beniseed]
ref|XP_007039252.1|  Mitochondrial import inner membrane transloc...    287   2e-92    
ref|XP_006844757.1|  hypothetical protein AMTR_s00016p00256760          285   2e-92    
ref|XP_011084593.1|  PREDICTED: uncharacterized protein LOC105166...    285   3e-92    Sesamum indicum [beniseed]
gb|KJB39516.1|  hypothetical protein B456_007G017700                    283   2e-91    Gossypium raimondii
ref|XP_011005386.1|  PREDICTED: uncharacterized protein LOC105111656    284   2e-91    Populus euphratica
ref|XP_010910427.1|  PREDICTED: uncharacterized protein LOC105036351    281   9e-91    Elaeis guineensis
ref|XP_008788092.1|  PREDICTED: uncharacterized protein LOC103705...    280   3e-90    Phoenix dactylifera
gb|KHG07931.1|  Uncharacterized protein F383_34960                      279   3e-90    Gossypium arboreum [tree cotton]
ref|XP_010942297.1|  PREDICTED: uncharacterized protein LOC105060333    278   1e-89    
gb|EYU19716.1|  hypothetical protein MIMGU_mgv1a011771mg                278   1e-89    Erythranthe guttata [common monkey flower]
gb|EPS71171.1|  hypothetical protein M569_03588                         277   2e-89    Genlisea aurea
ref|XP_008811009.1|  PREDICTED: uncharacterized protein LOC103722...    277   3e-89    Phoenix dactylifera
ref|XP_003602440.1|  SAM domain family protein                          277   3e-89    Medicago truncatula
ref|XP_009404579.1|  PREDICTED: uncharacterized protein LOC103987863    274   5e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU19715.1|  hypothetical protein MIMGU_mgv1a011771mg                274   8e-88    Erythranthe guttata [common monkey flower]
ref|XP_004307936.1|  PREDICTED: uncharacterized protein LOC101296523    273   1e-87    Fragaria vesca subsp. vesca
gb|KJB37429.1|  hypothetical protein B456_006G203900                    270   2e-86    Gossypium raimondii
ref|XP_009421320.1|  PREDICTED: uncharacterized protein LOC104000893    269   3e-86    
ref|XP_009413503.1|  PREDICTED: uncharacterized protein LOC103994789    260   1e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG31629.1|  hypothetical protein                                    260   2e-82    Zea mays [maize]
gb|AFW71638.1|  hypothetical protein ZEAMMB73_527455                    259   3e-82    
ref|NP_001132412.1|  uncharacterized protein LOC100193860               259   3e-82    Zea mays [maize]
ref|XP_010671269.1|  PREDICTED: uncharacterized protein LOC104888105    258   6e-82    Beta vulgaris subsp. vulgaris [field beet]
gb|KGN49828.1|  hypothetical protein Csa_5G139080                       252   7e-80    Cucumis sativus [cucumbers]
ref|XP_006441309.1|  hypothetical protein CICLE_v10021773mg             251   3e-79    Citrus clementina [clementine]
ref|XP_001766937.1|  predicted protein                                  251   4e-79    
ref|XP_002453918.1|  hypothetical protein SORBIDRAFT_04g021420          251   4e-79    Sorghum bicolor [broomcorn]
ref|XP_006493476.1|  PREDICTED: uncharacterized protein LOC102629263    251   5e-79    Citrus sinensis [apfelsine]
ref|XP_004975523.1|  PREDICTED: uncharacterized protein LOC101781...    250   1e-78    Setaria italica
gb|KDO44881.1|  hypothetical protein CISIN_1g024983mg                   248   4e-78    Citrus sinensis [apfelsine]
ref|XP_010541518.1|  PREDICTED: uncharacterized protein LOC104814958    248   4e-78    Tarenaya hassleriana [spider flower]
ref|NP_001146865.1|  SAM domain family protein                          249   4e-78    Zea mays [maize]
gb|AGT16912.1|  SAM domain family protein                               249   5e-78    Saccharum hybrid cultivar R570
gb|KHN02139.1|  hypothetical protein glysoja_046465                     244   9e-78    Glycine soja [wild soybean]
emb|CDP04965.1|  unnamed protein product                                244   1e-77    Coffea canephora [robusta coffee]
ref|XP_003579669.1|  PREDICTED: uncharacterized protein LOC100827945    247   1e-77    Brachypodium distachyon [annual false brome]
gb|AGT17006.1|  SAM domain family protein                               247   2e-77    Saccharum hybrid cultivar R570
gb|EEC77226.1|  hypothetical protein OsI_15770                          247   2e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_006441307.1|  hypothetical protein CICLE_v10021773mg             246   3e-77    
gb|EYU19717.1|  hypothetical protein MIMGU_mgv1a011771mg                245   4e-77    Erythranthe guttata [common monkey flower]
emb|CBI23120.3|  unnamed protein product                                243   4e-77    Vitis vinifera
emb|CAH66528.1|  H0502B11.8                                             246   6e-77    Oryza sativa [red rice]
gb|KDO44883.1|  hypothetical protein CISIN_1g024983mg                   245   7e-77    Citrus sinensis [apfelsine]
gb|AGT16087.1|  hypothetical protein SHCRBa_224_E06_F_230               244   2e-76    Saccharum hybrid cultivar R570
gb|EMT03006.1|  hypothetical protein F775_30606                         244   2e-76    
ref|XP_004952617.1|  PREDICTED: uncharacterized protein LOC101769...    244   2e-76    Setaria italica
ref|XP_010519579.1|  PREDICTED: uncharacterized protein LOC104798993    244   2e-76    Tarenaya hassleriana [spider flower]
dbj|BAJ87822.1|  predicted protein                                      244   2e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM65866.1|  unknown                                                 243   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975522.1|  PREDICTED: uncharacterized protein LOC101781...    245   3e-76    
ref|XP_006441308.1|  hypothetical protein CICLE_v10021773mg             243   5e-76    Citrus clementina [clementine]
ref|XP_006286543.1|  hypothetical protein CARUB_v10001771mg             243   5e-76    Capsella rubella
ref|NP_197853.1|  mitochondrial import inner membrane translocase...    243   6e-76    Arabidopsis thaliana [mouse-ear cress]
gb|AGT17334.1|  SAM domain family protein                               243   6e-76    Saccharum hybrid cultivar R570
gb|KDO44882.1|  hypothetical protein CISIN_1g024983mg                   243   6e-76    Citrus sinensis [apfelsine]
ref|XP_010454784.1|  PREDICTED: uncharacterized protein LOC104736487    242   1e-75    Camelina sativa [gold-of-pleasure]
ref|XP_004952616.1|  PREDICTED: uncharacterized protein LOC101769...    242   2e-75    
emb|CDX80460.1|  BnaC07g29840D                                          241   2e-75    
ref|XP_010421304.1|  PREDICTED: uncharacterized protein LOC104706780    241   3e-75    Camelina sativa [gold-of-pleasure]
ref|XP_003575054.1|  PREDICTED: uncharacterized protein LOC100840753    241   3e-75    Brachypodium distachyon [annual false brome]
dbj|BAJ88716.1|  predicted protein                                      241   4e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE60938.1|  hypothetical protein OsJ_14687                          241   4e-75    Oryza sativa Japonica Group [Japonica rice]
gb|ADE77803.1|  unknown                                                 238   4e-75    Picea sitchensis
gb|ACF86230.1|  unknown                                                 239   9e-75    Zea mays [maize]
gb|KJB37431.1|  hypothetical protein B456_006G203900                    239   9e-75    Gossypium raimondii
ref|XP_008811010.1|  PREDICTED: uncharacterized protein LOC103722...    239   1e-74    
ref|XP_009150989.1|  PREDICTED: uncharacterized protein LOC103874331    240   1e-74    Brassica rapa
ref|XP_006394720.1|  hypothetical protein EUTSA_v10004788mg             238   3e-74    Eutrema salsugineum [saltwater cress]
emb|CDM80696.1|  unnamed protein product                                238   3e-74    Triticum aestivum [Canadian hard winter wheat]
gb|KFK27737.1|  hypothetical protein AALP_AA8G422900                    238   6e-74    Arabis alpina [alpine rockcress]
emb|CAE05370.1|  OJ000315_02.15                                         237   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052708.1|  Os04g0405100                                       237   5e-73    
ref|XP_002447764.1|  hypothetical protein SORBIDRAFT_06g015230          235   9e-73    Sorghum bicolor [broomcorn]
ref|XP_006648683.1|  PREDICTED: uncharacterized protein LOC102705050    234   2e-72    
emb|CDY69408.1|  BnaAnng30370D                                          233   4e-72    Brassica napus [oilseed rape]
ref|XP_009149730.1|  PREDICTED: uncharacterized protein LOC103873049    233   5e-72    Brassica rapa
gb|ACF84635.1|  unknown                                                 233   5e-72    Zea mays [maize]
tpg|DAA37984.1|  TPA: SAM domain protein                                233   6e-72    
gb|EEC73300.1|  hypothetical protein OsI_07469                          233   7e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_010515307.1|  PREDICTED: uncharacterized protein LOC104791180    231   5e-71    Camelina sativa [gold-of-pleasure]
gb|EMT12140.1|  hypothetical protein F775_16456                         228   2e-70    
ref|XP_002875975.1|  mitochondrial import inner membrane transloc...    228   5e-70    
ref|XP_010503618.1|  PREDICTED: uncharacterized protein LOC104780778    227   2e-69    Camelina sativa [gold-of-pleasure]
emb|CDY08145.1|  BnaA06g15810D                                          226   2e-69    Brassica napus [oilseed rape]
ref|XP_010426471.1|  PREDICTED: uncharacterized protein LOC104711470    226   2e-69    Camelina sativa [gold-of-pleasure]
ref|NP_190525.1|  mitochondrial import inner membrane translocase...    226   2e-69    Arabidopsis thaliana [mouse-ear cress]
gb|KFK34395.1|  hypothetical protein AALP_AA5G139700                    226   3e-69    Arabis alpina [alpine rockcress]
emb|CDY05941.1|  BnaC08g21180D                                          224   3e-68    
ref|XP_006404129.1|  hypothetical protein EUTSA_v10010930mg             223   6e-68    Eutrema salsugineum [saltwater cress]
ref|XP_006291697.1|  hypothetical protein CARUB_v10017861mg             222   9e-68    
gb|ACG46863.1|  SAM domain family protein                               218   1e-67    Zea mays [maize]
ref|NP_001150693.1|  LOC100284326                                       221   5e-67    
dbj|BAM64851.1|  hypothetical protein                                   220   5e-67    Beta vulgaris [beet]
gb|AFW71639.1|  SAM domain protein                                      217   1e-66    
ref|XP_010110465.1|  hypothetical protein L484_001864                   200   5e-60    
ref|XP_002964681.1|  hypothetical protein SELMODRAFT_81847              201   8e-60    
ref|XP_002966437.1|  hypothetical protein SELMODRAFT_85831              199   4e-59    
gb|KJB39517.1|  hypothetical protein B456_007G017700                    194   1e-56    Gossypium raimondii
gb|KDO44885.1|  hypothetical protein CISIN_1g024983mg                   176   6e-51    Citrus sinensis [apfelsine]
gb|KDO44884.1|  hypothetical protein CISIN_1g024983mg                   176   1e-50    Citrus sinensis [apfelsine]
gb|KDO44886.1|  hypothetical protein CISIN_1g024983mg                   176   1e-50    Citrus sinensis [apfelsine]
gb|EMS56099.1|  hypothetical protein TRIUR3_21342                       179   3e-50    Triticum urartu
ref|XP_011396822.1|  hypothetical protein F751_6912                     171   7e-48    Auxenochlorella protothecoides
ref|XP_005648139.1|  hypothetical protein COCSUDRAFT_66004              167   3e-46    Coccomyxa subellipsoidea C-169
emb|CDX77311.1|  BnaC08g03560D                                          161   4e-45    
ref|XP_010424280.1|  PREDICTED: uncharacterized protein LOC104709349    159   6e-45    
ref|XP_010035349.1|  PREDICTED: uncharacterized protein LOC104424...    158   7e-45    Eucalyptus grandis [rose gum]
ref|XP_010035350.1|  PREDICTED: uncharacterized protein LOC104424...    155   1e-43    
gb|ACN26194.1|  unknown                                                 150   2e-41    Zea mays [maize]
emb|CAN60468.1|  hypothetical protein VITISV_030224                     137   9e-37    Vitis vinifera
ref|XP_001702924.1|  mitochondrial inner membrane translocase           137   5e-35    Chlamydomonas reinhardtii
ref|XP_002946728.1|  hypothetical protein VOLCADRAFT_103154             134   4e-34    Volvox carteri f. nagariensis
gb|KJB37430.1|  hypothetical protein B456_006G203900                    130   2e-33    Gossypium raimondii
ref|XP_005849272.1|  hypothetical protein CHLNCDRAFT_143549             132   3e-33    Chlorella variabilis
gb|KJB37432.1|  hypothetical protein B456_006G203900                    129   6e-33    Gossypium raimondii
ref|XP_010909429.1|  PREDICTED: uncharacterized protein LOC105035540    127   1e-32    
ref|XP_003056540.1|  pre-protein translocase                            130   2e-32    Micromonas pusilla CCMP1545
ref|XP_008788093.1|  PREDICTED: uncharacterized protein LOC103705...    126   2e-31    Phoenix dactylifera
ref|XP_001415886.1|  predicted protein                                  126   8e-31    Ostreococcus lucimarinus CCE9901
emb|CEF96707.1|  Sterile alpha motif, type 1                            125   9e-31    Ostreococcus tauri
ref|XP_007515528.1|  predicted protein                                  125   2e-30    Bathycoccus prasinos
ref|XP_003602441.1|  SAM domain family protein                          120   5e-30    
ref|XP_002507077.1|  mitochondrial import inner membrane translocase    120   8e-29    Micromonas commoda
ref|XP_003074409.1|  unnamed protein product                            112   2e-25    
ref|XP_003056541.1|  mitochondrial import inner membrane transloc...    102   2e-22    Micromonas pusilla CCMP1545
ref|XP_009152147.1|  PREDICTED: uncharacterized protein LOC103875386    102   2e-22    Brassica rapa
emb|CDY48062.1|  BnaA06g33660D                                          102   3e-22    Brassica napus [oilseed rape]
dbj|BAG90562.1|  unnamed protein product                              99.4    4e-22    Oryza sativa Japonica Group [Japonica rice]
emb|CDY02971.1|  BnaC07g22560D                                          101   6e-22    
ref|NP_001172995.1|  Os02g0526500                                     96.3    2e-21    
emb|CDY02973.1|  BnaC07g22540D                                        97.4    9e-21    
emb|CDY65297.1|  BnaCnng46450D                                        94.7    8e-20    Brassica napus [oilseed rape]
gb|KIY93044.1|  hypothetical protein MNEG_14920                       80.9    4e-15    Monoraphidium neglectum
ref|XP_010516736.1|  PREDICTED: uncharacterized protein LOC104792316  75.1    7e-13    
gb|KDD76264.1|  hypothetical protein H632_c292p0                      70.9    2e-11    Helicosporidium sp. ATCC 50920
emb|CDY02972.1|  BnaC07g22550D                                        71.6    2e-11    
ref|XP_001766099.1|  predicted protein                                68.9    9e-11    
gb|KIZ00921.1|  hypothetical protein MNEG_7036                        54.7    3e-06    Monoraphidium neglectum
ref|XP_009152191.1|  PREDICTED: uncharacterized protein LOC103875426  53.1    2e-05    Brassica rapa
gb|KFK25352.1|  hypothetical protein AALP_AA8G101700                  49.3    1e-04    Arabis alpina [alpine rockcress]
ref|XP_009380125.1|  PREDICTED: mitochondrial import inner membra...  49.7    7e-04    Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009592008.1| PREDICTED: uncharacterized protein LOC104088938 [Nicotiana tomentosiformis]
Length=261

 Score =   317 bits (813),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 198/231 (86%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ EL  G K WL+KQSLPVEAA VTA S  QG  IG  +G L+ D+    PTPPP ANL
Sbjct  29   KFKELEIGFKGWLAKQSLPVEAAVVTATSGLQGAAIGGFMGTLTQDVSSSLPTPPPAANL  88

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  89   NPQAMASFQQAQALAGGPLVQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGA  148

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+ VP ALTSG+FFALVQGGLF+LG++FSQPPAED  Y++TRS+LS LGL
Sbjct  149  LFSLVSGMGGPNPVPNALTSGIFFALVQGGLFELGRKFSQPPAEDTHYIRTRSMLSSLGL  208

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD+TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+ R++
Sbjct  209  QNYEKNFKKGLLTDSTLPLLTDSALRDVRIPPGPRLLILDQIQRDPELRKR  259



>ref|XP_006347543.1| PREDICTED: uncharacterized protein LOC102597734 [Solanum tuberosum]
Length=260

 Score =   317 bits (811),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 197/231 (85%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ EL  G K WLSKQS+PVEAA VTA S  QG  IG  +G L+ D+    PTPP GANL
Sbjct  28   KFKELEIGFKGWLSKQSIPVEAAVVTATSGLQGAAIGGFMGTLTQDVSSSMPTPPAGANL  87

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  88   NPQAMASFQQAQALAGGPLVQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGA  147

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+ VP ALTSG+FFALVQGGLF+LG++FSQPPAED  YV+TRSLLS LGL
Sbjct  148  LFSLVSGMGGPNPVPNALTSGIFFALVQGGLFELGRKFSQPPAEDTHYVRTRSLLSSLGL  207

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTDTTLPLLTDSAL+DV IPPGPRLLILD + R+P+ R+K
Sbjct  208  QNYEKNFKKGLLTDTTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELRKK  258



>ref|XP_009774884.1| PREDICTED: uncharacterized protein LOC104224864 [Nicotiana sylvestris]
Length=260

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 197/231 (85%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ EL  G K WL+KQSLPVEAA VTA S  QG  IG  +G L+ D+    PTPPP ANL
Sbjct  28   KFKELEIGFKGWLAKQSLPVEAAVVTATSGLQGAAIGGFMGTLTQDVSSSLPTPPPAANL  87

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  88   NPQAMASFQQAQALAGGPLVQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGA  147

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+ VP ALTSG+FFALVQGGLF+LG++FSQPPAED  Y++TRS+LS LGL
Sbjct  148  LFSLVSGMGGPNPVPNALTSGIFFALVQGGLFELGRKFSQPPAEDTHYIRTRSMLSSLGL  207

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+ R++
Sbjct  208  QNYEKNFKKGLLTDNTLPLLTDSALRDVRIPPGPRLLILDQIQRDPELRKR  258



>ref|XP_004235047.1| PREDICTED: uncharacterized protein LOC101257149 [Solanum lycopersicum]
Length=260

 Score =   314 bits (805),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 196/231 (85%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ EL  G K WLSKQS+PVEAA VTA S  QG  IG  +G L+ D+    P PP GANL
Sbjct  28   KFKELEIGFKGWLSKQSIPVEAAVVTATSGLQGAAIGGFMGTLTQDVSSSMPIPPAGANL  87

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  88   NPQAMASFQQAQALAGGPLVQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGA  147

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+ VP ALTSG+FFALVQGGLF+LG++FSQPPAED  YV+TRSLLS LGL
Sbjct  148  LFSLVSGMGGPNPVPNALTSGIFFALVQGGLFELGRKFSQPPAEDTHYVRTRSLLSSLGL  207

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTDTTLPLLTDSAL+DV IPPGPRLLILD + R+P+ R+K
Sbjct  208  QNYEKNFKKGLLTDTTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELRKK  258



>ref|XP_009361233.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Pyrus x bretschneideri]
Length=258

 Score =   306 bits (784),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 192/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ EL +GVK WL+KQSLPVEAA VT  S AQG  IGA +G L+ D+    PTPPP A L
Sbjct  26   RFKELQAGVKGWLAKQSLPVEAAVVTLTSGAQGAAIGAFMGTLTNDVSSSLPTPPPQAGL  85

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P  MA+FNQAQAL GGPLVQARNFAVMTGVNAGISCV+KRVRGKEDVQSSM AAFGSG 
Sbjct  86   NPQVMASFNQAQALAGGPLVQARNFAVMTGVNAGISCVMKRVRGKEDVQSSMVAAFGSGA  145

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+    A+TSG+FFALVQGGLFKLGQ+FSQPP ED+ Y KTRS+LS LGL
Sbjct  146  LFSLVSGMGGPNQAANAVTSGLFFALVQGGLFKLGQKFSQPPTEDIYYSKTRSMLSNLGL  205

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFKRGLL+D TLPLL DSAL+DV IPPGPRLLILD + R+P+ + +
Sbjct  206  QSYEKNFKRGLLSDNTLPLLNDSALRDVKIPPGPRLLILDHIQRDPEIKER  256



>ref|XP_008376859.1| PREDICTED: uncharacterized protein LOC103439979 [Malus domestica]
Length=258

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 192/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ EL +GV+ WL+KQSLPVEAA VT  S AQG  IGA +G L+ D+    PTPPP A L
Sbjct  26   RFKELQAGVRGWLAKQSLPVEAAVVTLTSGAQGAAIGAFMGTLTNDVSSSLPTPPPQAGL  85

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCV+KRVRGKEDVQSSM AAFGSG 
Sbjct  86   NPQAMASFKQAQALAGGPLVQARNFAVMTGVNAGISCVMKRVRGKEDVQSSMVAAFGSGA  145

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+    A+TSG+FFALVQGGLFKLGQ+FSQPP ED+ Y KTRS+LS LGL
Sbjct  146  LFSLVSGMGGPNQAANAVTSGLFFALVQGGLFKLGQKFSQPPTEDIYYSKTRSMLSNLGL  205

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL+D TLPLL DSAL+DV IPPGPRLLILD + R+P+ + +
Sbjct  206  QSYEKNFKKGLLSDNTLPLLNDSALRDVKIPPGPRLLILDHIQRDPEIKER  256



>ref|XP_003523301.1| PREDICTED: uncharacterized protein LOC100775460 [Glycine max]
Length=260

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 190/231 (82%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ EL +G + WLSKQSLPVEAA VT  SAAQG  IGA +G L+ D     PTPPP A+L
Sbjct  25   RFKELETGFRLWLSKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTADASSTFPTPPPNASL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGPLVQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  85   NPQAMASLKQAQALAGGPLVQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGGLF++GQ+FS PPAED  Y KTR +L+ LGL
Sbjct  145  MFSLVSGMGGPNQATNAVTSGLFFALVQGGLFQIGQKFSNPPAEDTHYAKTRHMLNNLGL  204

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+ D + K
Sbjct  205  QSYEKNFKKGLLTDNTLPLLTDSALRDVRIPPGPRLLILDHIQRDADLKEK  255



>ref|XP_004502789.1| PREDICTED: uncharacterized protein LOC101495679 [Cicer arietinum]
Length=263

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 191/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLS---PDLQPTPPPGANL  606
            +Y  L +G K WLSKQS+ VEAA VT  SAAQGG IGAI+G L+   P   P PPP A L
Sbjct  28   RYKHLENGFKLWLSKQSIAVEAAVVTTTSAAQGGAIGAIMGTLTADAPSAFPIPPPNAAL  87

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGPLVQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  88   NPQAMASLQQAQALAGGPLVQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGA  147

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGGLF++GQ+FSQPPAED+ Y +TR++L  LGL
Sbjct  148  MFSLVSGMGGPNQAANAVTSGLFFALVQGGLFQIGQKFSQPPAEDIHYARTRNMLHNLGL  207

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL+D TLPLLTDSAL+DV IPPGPRLLILD + R+ DFR K
Sbjct  208  QNYEKNFKKGLLSDNTLPLLTDSALRDVKIPPGPRLLILDHIQRDQDFREK  258



>ref|XP_003526780.1| PREDICTED: uncharacterized protein LOC100813121 [Glycine max]
Length=260

 Score =   302 bits (774),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 191/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ +L +G + WLSKQSLPVEAA VT  SAAQG  IGA +G L+ D     PTPPP A+L
Sbjct  25   RFKDLETGFRLWLSKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTADASSTFPTPPPNASL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGPL+QARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  85   NPQAMASLKQAQALAGGPLIQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+    ALTSG+FFALVQGGLF++GQ+FSQPPAED  Y KTR +L+ LGL
Sbjct  145  LFSLVSGMGGPNQATNALTSGLFFALVQGGLFQIGQKFSQPPAEDTHYAKTRHMLNNLGL  204

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+ D + K
Sbjct  205  QSYEKNFKKGLLTDNTLPLLTDSALRDVRIPPGPRLLILDHIQRDADLKDK  255



>ref|XP_002317852.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
 gb|EEE96072.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
Length=262

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 192/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ EL  G K+WLSKQSLPVEAA VTA    QG  IGAI+G L+PD+    PTPPP A+L
Sbjct  28   KFKELEDGFKSWLSKQSLPVEAAVVTATGGVQGAAIGAIMGTLTPDISSSMPTPPPQASL  87

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGPL+QARNFAVMTG NAGI+C++KR+RGKEDVQSSM AAFGSG 
Sbjct  88   NPQAMASLKQAQALAGGPLIQARNFAVMTGTNAGIACIMKRLRGKEDVQSSMVAAFGSGA  147

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP++   A+TSG+FFALVQGGLFKLG++ S+PP ED+ Y +TRS+L+ LGL
Sbjct  148  MFSLVSGMGGPNLATNAITSGLFFALVQGGLFKLGEKLSKPPVEDLCYARTRSMLNNLGL  207

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+ R K
Sbjct  208  QNYEKNFKKGLLTDNTLPLLTDSALRDVRIPPGPRLLILDHLRRDPELREK  258



>ref|XP_008381679.1| PREDICTED: uncharacterized protein LOC103444516 [Malus domestica]
Length=261

 Score =   302 bits (773),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 191/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ EL +G + WL+KQSLPVEAA VT  S AQG  IGA +G L+ D+    PTPPP A L
Sbjct  26   RFKELEAGFRGWLAKQSLPVEAAVVTLTSGAQGAAIGAFMGTLTNDVSSSLPTPPPQAGL  85

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCV+KRVRGKEDVQSSM AAFGSG 
Sbjct  86   NPQAMASFKQAQALAGGPLVQARNFAVMTGVNAGISCVMKRVRGKEDVQSSMVAAFGSGA  145

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+    A+TSG+FFALVQGGLFKLGQ+FSQPP ED+ Y KTRS+L+ LGL
Sbjct  146  LFSLVSGMGGPNQAANAVTSGLFFALVQGGLFKLGQKFSQPPTEDIYYAKTRSMLNNLGL  205

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL+D TLPLL DSAL+DV IPPGPRLLILD + R+P+ + K
Sbjct  206  QSYEKNFKKGLLSDNTLPLLNDSALRDVKIPPGPRLLILDHIQRDPEIKEK  256



>ref|XP_007218831.1| hypothetical protein PRUPE_ppa010176mg [Prunus persica]
 gb|EMJ20030.1| hypothetical protein PRUPE_ppa010176mg [Prunus persica]
Length=260

 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 190/231 (82%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ EL SG K WL+KQSLPVEAA VT  S AQG  IGA +G L+ D+    PTPPP A L
Sbjct  25   RFKELESGFKGWLAKQSLPVEAAVVTLTSGAQGAAIGAFMGTLTNDVSSSLPTPPPQAGL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  85   NPQAMASFKQAQALAGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+    A TSG+FFALVQGGLFKLGQ+FSQPP ED+ Y KTRS+LS LGL
Sbjct  145  LFSLVSGMGGPNQAANAATSGLFFALVQGGLFKLGQKFSQPPTEDIYYSKTRSMLSNLGL  204

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL+D TLPLL DSAL+DV IPPGPRLLILD + R+P+ + +
Sbjct  205  QNYEKNFKKGLLSDNTLPLLNDSALRDVKIPPGPRLLILDHIQRDPEIKER  255



>ref|XP_010035340.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Eucalyptus grandis]
 gb|KCW46676.1| hypothetical protein EUGRSUZ_K00480 [Eucalyptus grandis]
Length=258

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 193/228 (85%), Gaps = 2/228 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT--PPPGANLD  603
            ++ E+ +G K WLSKQSLPVEAA VTA  A QG  IGAI+G L+ D+  +  PPPGANL+
Sbjct  26   RFKEIEAGFKDWLSKQSLPVEAAVVTATGATQGAAIGAIMGTLTNDVSASLGPPPGANLN  85

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVM  423
            P AMA+  QAQAL+GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG M
Sbjct  86   PQAMASLKQAQALSGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGAM  145

Query  422  YSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            +SLVSGMGGP+    A+TSG FFALVQGGLFKLGQ+FSQPP ED+ Y +TRS+LS LGL+
Sbjct  146  FSLVSGMGGPNQAANAVTSGFFFALVQGGLFKLGQKFSQPPVEDVYYSQTRSMLSNLGLQ  205

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFR  99
             YEKNFK+GLLTDTTLPLLTDSAL+DV+IPPGPRLLILD + R+P  +
Sbjct  206  NYEKNFKKGLLTDTTLPLLTDSALRDVNIPPGPRLLILDHIQRDPQLK  253



>ref|XP_008234610.1| PREDICTED: uncharacterized protein LOC103333537 [Prunus mume]
Length=260

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 190/231 (82%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ EL SG K WL+KQSLPVEAA VT  S AQG  IGA +G L+ D+    PTPPP A L
Sbjct  25   RFKELESGFKGWLAKQSLPVEAAVVTLTSGAQGAAIGAFMGTLTNDVSSSLPTPPPQAGL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPL+QARNFAVMTGVNAGISCV+KR+RGK+DVQSSM AAFGSG 
Sbjct  85   NPQAMASFKQAQALAGGPLIQARNFAVMTGVNAGISCVMKRLRGKDDVQSSMVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+    A TSG+FFALVQGGLFKLGQ+FSQPP ED+ Y KTRS+LS LGL
Sbjct  145  LFSLVSGMGGPNQAANAATSGLFFALVQGGLFKLGQKFSQPPTEDIYYSKTRSMLSNLGL  204

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL+D TLPLL DSAL+DV IPPGPRLLILD + R+P+ + +
Sbjct  205  QNYEKNFKKGLLSDNTLPLLNDSALRDVKIPPGPRLLILDHIQRDPEIKER  255



>ref|XP_009351884.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Pyrus x bretschneideri]
Length=258

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 191/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ EL +G + WL+KQSLPVEAA VT  S AQG  IGA +G L+ D+    PTPPP A+L
Sbjct  26   RFKELEAGFRGWLAKQSLPVEAAVVTLTSGAQGAAIGAFMGTLTNDVSSSLPTPPPQASL  85

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCV+KRVRGKEDVQSSM AAFGSG 
Sbjct  86   NPQAMASFKQAQALAGGPLVQARNFAVMTGVNAGISCVMKRVRGKEDVQSSMVAAFGSGA  145

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGM GP+    A+TSG+FFALVQGGLFKLGQ+FSQPP ED+ Y KTRS+L+ LGL
Sbjct  146  LFSLVSGMAGPNQAANAVTSGLFFALVQGGLFKLGQKFSQPPTEDIYYAKTRSMLNNLGL  205

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL+D TLPLL DSAL+DV IPPGPRLLILD + R+P+ + +
Sbjct  206  QSYEKNFKKGLLSDNTLPLLNDSALRDVKIPPGPRLLILDHIQRDPEIKER  256



>ref|XP_002321938.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
 gb|EEF06065.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
Length=260

 Score =   299 bits (765),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 190/231 (82%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            KY EL  G K+WLSKQSL VEAA VTA S  QG  IGAI+G ++PD+    PTPP  A L
Sbjct  27   KYKELEDGFKSWLSKQSLLVEAAVVTATSGVQGAAIGAIMGTITPDISSSMPTPPQAA-L  85

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGPL+QARNFAVMTG NAGI+C++KR+RGKEDVQSSM AAFGSG 
Sbjct  86   NPQAMASLKQAQALAGGPLIQARNFAVMTGTNAGIACIMKRLRGKEDVQSSMVAAFGSGA  145

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGGLFKLG++FSQPP ED+ Y +TRS+LS LGL
Sbjct  146  MFSLVSGMGGPNNATNAITSGLFFALVQGGLFKLGEKFSQPPTEDLHYARTRSMLSNLGL  205

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+ R K
Sbjct  206  QNYEKNFKKGLLTDHTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELREK  256



>gb|KCW46677.1| hypothetical protein EUGRSUZ_K00480 [Eucalyptus grandis]
Length=252

 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 191/224 (85%), Gaps = 2/224 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT--PPPGANLD  603
            ++ E+ +G K WLSKQSLPVEAA VTA  A QG  IGAI+G L+ D+  +  PPPGANL+
Sbjct  26   RFKEIEAGFKDWLSKQSLPVEAAVVTATGATQGAAIGAIMGTLTNDVSASLGPPPGANLN  85

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVM  423
            P AMA+  QAQAL+GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG M
Sbjct  86   PQAMASLKQAQALSGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGAM  145

Query  422  YSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            +SLVSGMGGP+    A+TSG FFALVQGGLFKLGQ+FSQPP ED+ Y +TRS+LS LGL+
Sbjct  146  FSLVSGMGGPNQAANAVTSGFFFALVQGGLFKLGQKFSQPPVEDVYYSQTRSMLSNLGLQ  205

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRN  111
             YEKNFK+GLLTDTTLPLLTDSAL+DV+IPPGPRLLILD + R+
Sbjct  206  NYEKNFKKGLLTDTTLPLLTDSALRDVNIPPGPRLLILDHIQRS  249



>ref|XP_002519617.1| protein translocase, putative [Ricinus communis]
 gb|EEF42762.1| protein translocase, putative [Ricinus communis]
Length=261

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 196/240 (82%), Gaps = 8/240 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WLSKQSL VEAA VTA SA QG  IGAI+G L+PD+    PTPPP A L
Sbjct  26   KMKELENGFKSWLSKQSLAVEAAVVTATSATQGAAIGAIMGTLAPDISSSLPTPPPDAAL  85

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL+GGPLVQARNFAVMTGVNAGIS V+KR+RGKEDVQSSM AAFGSG 
Sbjct  86   NPQAMASIKQAQALSGGPLVQARNFAVMTGVNAGISSVMKRLRGKEDVQSSMVAAFGSGA  145

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSG+GGP+    A+TSG+FFALVQGGLF+LGQ+FSQPPAED  Y +TR++L  LGL
Sbjct  146  MFSLVSGVGGPNPAANAITSGLFFALVQGGLFQLGQKFSQPPAEDTFYARTRTMLHSLGL  205

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK*SGC*LGIH  66
            + YEKNFK+GLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P+ + +      GIH
Sbjct  206  QNYEKNFKKGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELKER-----RGIH  260



>ref|XP_011003323.1| PREDICTED: uncharacterized protein LOC105110098 [Populus euphratica]
Length=260

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 190/231 (82%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            KY EL  G K+WLSKQSL VEAA VTA S  QG  IGAI+G ++PD+    PTPP  A L
Sbjct  27   KYKELEDGFKSWLSKQSLLVEAAVVTATSGVQGAAIGAIMGTITPDISSSMPTPPQ-APL  85

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGPL+QARNFAVMTG NAGI+C++KR+RGKEDVQSSM AAFGSG 
Sbjct  86   NPQAMASLKQAQALAGGPLIQARNFAVMTGTNAGIACIMKRLRGKEDVQSSMVAAFGSGA  145

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGGLFKLG++FSQPP ED+ Y +TRS+LS LGL
Sbjct  146  MFSLVSGMGGPNNATNAITSGLFFALVQGGLFKLGEKFSQPPTEDLHYARTRSMLSNLGL  205

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+ R K
Sbjct  206  QNYEKNFKKGLLTDHTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELREK  256



>gb|KJB52400.1| hypothetical protein B456_008G262900 [Gossypium raimondii]
Length=258

 Score =   296 bits (759),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 193/231 (84%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ E+ +  + WL+KQSLPVEAA VT  SAAQG  IGA +G L+ D+    PTPP  A+L
Sbjct  24   KFKEVETSFRGWLAKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTNDVSSSLPTPPQ-ASL  82

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP AMA+  QAQAL+GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  83   DPQAMASLKQAQALSGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGA  142

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+ +  A TSG+FFALVQGGLF+LGQ+FSQPPAED+ Y +TRS+LS LGL
Sbjct  143  MFSLVSGMGGPNQIANAATSGLFFALVQGGLFQLGQKFSQPPAEDIYYSRTRSMLSSLGL  202

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+ + K
Sbjct  203  QNYEKNFKKGLLTDNTLPLLTDSALRDVKIPPGPRLLILDHIQRDPELKEK  253



>ref|XP_010045371.1| PREDICTED: uncharacterized protein LOC104434104 [Eucalyptus grandis]
 gb|KCW88600.1| hypothetical protein EUGRSUZ_A00976 [Eucalyptus grandis]
Length=259

 Score =   295 bits (755),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 189/229 (83%), Gaps = 2/229 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT--PPPGANLD  603
            ++ E+ +G KAWLS+Q L VEAA VTA S  QG  IGA +G L+ D+  +  PPP ANL+
Sbjct  27   RFKEVEAGFKAWLSRQPLAVEAAVVTATSGLQGAAIGAFMGTLTGDVSSSIAPPPQANLN  86

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVM  423
            P AMA+  QAQAL GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQSSMAAAFGSG M
Sbjct  87   PEAMASLKQAQALAGGPLVQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMAAAFGSGAM  146

Query  422  YSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            +SLVSGMGGP+    A++SG+FFALVQGGLFK GQ+FSQPP EDM YV+TR++L+ LGL+
Sbjct  147  FSLVSGMGGPNQAVNAVSSGLFFALVQGGLFKFGQKFSQPPEEDMHYVRTRNMLTRLGLQ  206

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
             YEKNFK+GLLTD TLPLL DSAL DV IPPGPRLLILD + R+P+ +R
Sbjct  207  TYEKNFKKGLLTDNTLPLLNDSALSDVKIPPGPRLLILDHIQRDPELKR  255



>ref|XP_010276440.1| PREDICTED: uncharacterized protein LOC104611181 [Nelumbo nucifera]
Length=256

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 193/231 (84%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ +L  G ++WLSKQSLPVEAA VTA SA QG  IGA +G L+ D+    PTPP  A L
Sbjct  26   RFRDLEVGFRSWLSKQSLPVEAAVVTATSAVQGAAIGAFMGTLTNDISSSFPTPPQ-APL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL+GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQ+SM AAFGSG 
Sbjct  85   NPQAMASLKQAQALSGGPLVQARNFAVMTGVNAGISCVMKRLRGKEDVQTSMVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSGVFFALVQGGLFKLGQ+FSQPPAED  Y KTRS+L  LGL
Sbjct  145  MFSLVSGMGGPNQAANAITSGVFFALVQGGLFKLGQKFSQPPAEDAFYNKTRSMLITLGL  204

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD+TLPLLTDSAL+DV IPPGPRLLILD +HR+P+ + +
Sbjct  205  QSYEKNFKKGLLTDSTLPLLTDSALRDVKIPPGPRLLILDHIHRDPELKER  255



>gb|KDP24771.1| hypothetical protein JCGZ_25171 [Jatropha curcas]
Length=258

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 193/233 (83%), Gaps = 6/233 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            KY E  +G K+WLSKQSLPVEAA VTA SA QG  IG  +G L+ D+    PTPP  ANL
Sbjct  22   KYKEFETGFKSWLSKQSLPVEAAVVTATSAIQGAAIGGFMGTLTNDVSSSFPTPPQ-ANL  80

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP AMA+  QAQAL+GGPLVQARNFAVMTGVNAGISC++KRVRGKEDVQSSM AAFGSG 
Sbjct  81   DPQAMASLKQAQALSGGPLVQARNFAVMTGVNAGISCIMKRVRGKEDVQSSMVAAFGSGA  140

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPP--AEDMQYVKTRSLLSGL  252
            M+SLVSGMGGP+    A++SG+FFALVQGGL++LGQ+FSQ P  AED  YV+TR++L+ L
Sbjct  141  MFSLVSGMGGPNQAANAVSSGLFFALVQGGLYQLGQKFSQQPQAAEDTNYVRTRTMLNNL  200

Query  251  GLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            GL+KYEKNFK+G LTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P+ + K
Sbjct  201  GLQKYEKNFKKGFLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELKGK  253



>ref|XP_007136378.1| hypothetical protein PHAVU_009G040400g [Phaseolus vulgaris]
 gb|ESW08372.1| hypothetical protein PHAVU_009G040400g [Phaseolus vulgaris]
Length=259

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 188/231 (81%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLS---PDLQPTPPPGANL  606
            ++ EL SG K WLSKQSL VEAA VT  SAAQG  IGA +G ++   P   PTPPP A+L
Sbjct  24   RFKELESGFKLWLSKQSLAVEAAVVTTTSAAQGAAIGAFMGTITADAPSAFPTPPPNASL  83

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGP VQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  84   NPQAMASLKQAQALAGGPFVQARNFAVMTGVNAGISCVLKRLRGKEDVQSSMAAAFGSGA  143

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGGLF++GQ+FSQPP ED+ Y KTR +L+ LGL
Sbjct  144  MFSLVSGMGGPNQAANAVTSGLFFALVQGGLFQVGQKFSQPPVEDVHYAKTRHMLNNLGL  203

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
              YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+ D + K
Sbjct  204  LSYEKNFKKGLLTDNTLPLLTDSALRDVRIPPGPRLLILDHIQRDLDPKEK  254



>ref|XP_004145954.1| PREDICTED: uncharacterized protein LOC101208652 [Cucumis sativus]
Length=253

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT-PPPGANLDP  600
            ++ EL +G + WL+KQSLPVEAA VT  SAAQG  IG  +G L+ D+  + P P A L+P
Sbjct  25   RFKELENGFRTWLAKQSLPVEAAVVTVTSAAQGAAIGGFMGTLTNDVSSSLPTPQAGLNP  84

Query  599  NAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMY  420
             AMA+F QAQAL GGPLVQARNFAVMTGVNAGIS V+KR+RGKEDVQSSM AAFGSG M+
Sbjct  85   QAMASFKQAQALAGGPLVQARNFAVMTGVNAGISSVMKRLRGKEDVQSSMVAAFGSGAMF  144

Query  419  SLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            SLVSGMGGP+    A+TSG+FFALVQGGLFKLG++FSQPP ED+ Y KTRS+L+ LGL+ 
Sbjct  145  SLVSGMGGPNQATNAVTSGLFFALVQGGLFKLGEKFSQPPVEDVYYAKTRSMLNNLGLQS  204

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTDTTLPLLTDSAL+DV IPPGPRLLILD + RNP+ R +
Sbjct  205  YEKNFKKGLLTDTTLPLLTDSALRDVKIPPGPRLLILDHIQRNPELRER  253



>gb|AGV54806.1| hypothetical protein [Phaseolus vulgaris]
Length=259

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 188/231 (81%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLS---PDLQPTPPPGANL  606
            ++ EL +G K WLSKQSL VEAA VT  SAAQG  IGA +G ++   P   PTPPP A+L
Sbjct  24   RFKELETGFKLWLSKQSLAVEAAVVTTTSAAQGAAIGAFMGTITADAPSAFPTPPPNASL  83

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGP VQARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG 
Sbjct  84   NPQAMASLKQAQALAGGPFVQARNFAVMTGVNAGISCVLKRLRGKEDVQSSMAAAFGSGA  143

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGGLF++GQ+FSQPP ED+ Y KTR +L+ LGL
Sbjct  144  MFSLVSGMGGPNQAANAVTSGLFFALVQGGLFQVGQKFSQPPVEDVHYAKTRHMLNNLGL  203

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
              YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+ D + K
Sbjct  204  LSYEKNFKKGLLTDNTLPLLTDSALRDVRIPPGPRLLILDHIQRDLDPKEK  254



>ref|XP_002267996.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-like [Vitis vinifera]
Length=254

 Score =   291 bits (746),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 192/229 (84%), Gaps = 4/229 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ +L +G +AWL+KQSLPVEAA VTA SAAQG  IGA +G L+ D     PTPP  ANL
Sbjct  22   RFKDLENGFRAWLAKQSLPVEAAVVTATSAAQGAAIGAFMGTLTNDATSAIPTPPQ-ANL  80

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
             P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  81   SPQAMASFKQAQALAGGPLVQARNFAVMTGVNAGISCVMKRIRGKEDVQSSMVAAFGSGA  140

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+     +TSG+FFAL+QGG+F++GQ+FSQPPAED+ Y +TRS+L+ LGL
Sbjct  141  MFSLVSGMGGPNQATNVITSGLFFALIQGGIFQIGQKFSQPPAEDLFYSRTRSMLTSLGL  200

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFR  99
            + YEKNFKRGLLTD+TLPLLTDSALKD  IPPGPRLLILD + R+P+ +
Sbjct  201  QNYEKNFKRGLLTDSTLPLLTDSALKDARIPPGPRLLILDHIQRDPELK  249



>gb|EYU45348.1| hypothetical protein MIMGU_mgv1a012092mg [Erythranthe guttata]
Length=262

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 190/231 (82%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPP-GANL  606
            K  E+ +  + WL+KQSLPVEAA VT  SAAQG  IGA +G L+ D     TPPP  AN 
Sbjct  27   KLKEVETKFRGWLAKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTGDASSLITPPPNAANF  86

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+AMA+  QAQAL GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  87   NPDAMASLKQAQALAGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGA  146

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++SLVSGMGGP+    ALTSG+FFALVQGG+F+LGQ+FSQPP EDM Y K RSLLS LGL
Sbjct  147  LFSLVSGMGGPNQATNALTSGLFFALVQGGIFQLGQKFSQPPVEDMYYAKGRSLLSNLGL  206

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTDTTLPLLTDSAL+DV+IPPGPRLLILD + R+P+ + K
Sbjct  207  QNYEKNFKKGLLTDTTLPLLTDSALRDVNIPPGPRLLILDHIERDPELKEK  257



>ref|XP_004160398.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208652 
[Cucumis sativus]
Length=253

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 189/229 (83%), Gaps = 1/229 (0%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT-PPPGANLDP  600
            ++ EL +G + WL+KQSLPVEAA VT  SAAQG  IG  +G L+ D+  + P P A L+P
Sbjct  25   RFKELENGFRTWLAKQSLPVEAAVVTVTSAAQGAAIGGFMGTLTNDVSSSLPTPQAGLNP  84

Query  599  NAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMY  420
             AMA+F QAQAL GGPLVQARNFAVMTGVNAGIS V+KR+RGKEDVQSSM AAFGSG M+
Sbjct  85   QAMASFKQAQALAGGPLVQARNFAVMTGVNAGISSVMKRLRGKEDVQSSMVAAFGSGAMF  144

Query  419  SLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            SLVSGMGGP+    A+TSG+ FALVQGGLFKLG++FSQPP ED+ Y KTRS+L+ LGL+ 
Sbjct  145  SLVSGMGGPNQATNAVTSGLXFALVQGGLFKLGEKFSQPPVEDVYYAKTRSMLNNLGLQS  204

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTDTTLPLLTDSAL+DV IPPGPRLLILD + RNP+ R +
Sbjct  205  YEKNFKKGLLTDTTLPLLTDSALRDVKIPPGPRLLILDHIQRNPELRER  253



>ref|XP_011084594.1| PREDICTED: uncharacterized protein LOC105166805 isoform X2 [Sesamum 
indicum]
Length=270

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 191/231 (83%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPPGA-NL  606
            K  E+ +  K WL+KQSLPVEAA VTA S AQG  IG  +G L+ D     TPPP A NL
Sbjct  35   KLKEVETRFKGWLAKQSLPVEAAVVTATSGAQGAAIGGFMGTLTGDASSLVTPPPNAVNL  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+AMA+  QAQAL GGPLVQARNFAVMTGVNAGISC+++R+RGKEDVQSSM AAFGSG 
Sbjct  95   NPDAMASLKQAQALAGGPLVQARNFAVMTGVNAGISCIMRRLRGKEDVQSSMVAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGG+F+LGQ+FSQPP ED+ YVKTRS+LS LGL
Sbjct  155  MFSLVSGMGGPNQAANAVTSGLFFALVQGGIFQLGQKFSQPPTEDVYYVKTRSMLSNLGL  214

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV+IPPGPRLLILD + R+P+ + +
Sbjct  215  QNYEKNFKKGLLTDNTLPLLTDSALRDVNIPPGPRLLILDHIERSPELKER  265



>ref|XP_008437651.1| PREDICTED: uncharacterized protein LOC103482996 [Cucumis melo]
Length=253

 Score =   288 bits (738),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 191/229 (83%), Gaps = 1/229 (0%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT-PPPGANLDP  600
            ++ EL +G + WL+KQSLPVEAA VTA SAAQG  IG  +G L+ D+  + P P A L+P
Sbjct  25   RFKELENGFRTWLAKQSLPVEAAVVTATSAAQGAAIGGFMGTLTNDVSSSLPTPQAGLNP  84

Query  599  NAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMY  420
             AMA+F QAQAL GGPLVQARNFAVMTGVNAGIS V+KR+RGKEDVQSSM AAFGSG M+
Sbjct  85   QAMASFKQAQALAGGPLVQARNFAVMTGVNAGISSVMKRLRGKEDVQSSMVAAFGSGAMF  144

Query  419  SLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            SLVSGMGGP+    A+TSG+FFALVQGGLFKLG++FSQPP ED+ Y KTRS+L+ LGL+ 
Sbjct  145  SLVSGMGGPNQAANAVTSGLFFALVQGGLFKLGEKFSQPPVEDVYYAKTRSMLNNLGLQS  204

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTDTTLPLLTDSAL+DV IPPGPRLLILD + RNP+ R +
Sbjct  205  YEKNFKKGLLTDTTLPLLTDSALRDVKIPPGPRLLILDHIQRNPELRDR  253



>gb|KJB52401.1| hypothetical protein B456_008G262900 [Gossypium raimondii]
Length=255

 Score =   286 bits (732),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 190/231 (82%), Gaps = 7/231 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ E+ +  + WL+KQSLPVEAA VT  SAAQG  IGA +G L+ D+    PTPP  A+L
Sbjct  24   KFKEVETSFRGWLAKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTNDVSSSLPTPPQ-ASL  82

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP AMA+  QAQAL+GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  83   DPQAMASLKQAQALSGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGA  142

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+ +  A TSG+FFALVQGGLF+LGQ+FSQPPAED+ Y +TRS+LS LGL
Sbjct  143  MFSLVSGMGGPNQIANAATSGLFFALVQGGLFQLGQKFSQPPAEDIYYSRTRSMLSSLGL  202

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTD   +DV IPPGPRLLILD + R+P+ + K
Sbjct  203  QNYEKNFKKGLLTDNTLPLLTD---RDVKIPPGPRLLILDHIQRDPELKEK  250



>gb|KHG08602.1| Mitochondrial import inner membrane translocase subunit Tim17 
-like protein [Gossypium arboreum]
Length=246

 Score =   286 bits (731),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 179/231 (77%), Gaps = 16/231 (7%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ E+ +  + WL+KQSLPVEAA VT  SAAQG  IGA +G L+ D+    PTPP  A+L
Sbjct  24   KFKEVETSFRGWLAKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTNDVSSSLPTPPQ-ASL  82

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            D  AMA+  QAQAL+GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  83   DAQAMASLKQAQALSGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGA  142

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+ +  A TSG+FFALVQGGLF+LGQ+FSQPPAED+ Y +TRS+LS LGL
Sbjct  143  MFSLVSGMGGPNQIANAATSGLFFALVQGGLFQLGQKFSQPPAEDIYYSRTRSMLSSLGL  202

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+G             AL+DV IPPGPRLLILD + R+ + + K
Sbjct  203  QNYEKNFKKGF------------ALRDVKIPPGPRLLILDHIQRDAELKEK  241



>ref|XP_011075839.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22 [Sesamum indicum]
Length=270

 Score =   286 bits (732),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 190/229 (83%), Gaps = 3/229 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPP-GANL  606
            K  E+    + WL+KQSLPVEAA VT  SAAQG  IGA +G L+ D     TPPP  AN+
Sbjct  35   KLKEVEIRFRGWLAKQSLPVEAAVVTTTSAAQGAAIGAFMGTLTGDASSLLTPPPSAANI  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGP+VQARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  95   NPEAMASLKQAQALAGGPMVQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMVAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGG+F+LGQ+F++PPAED+ YVKTRS+LS LGL
Sbjct  155  MFSLVSGMGGPNQAANAVTSGLFFALVQGGIFQLGQKFAKPPAEDVYYVKTRSMLSKLGL  214

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFR  99
            + YE+NFK+GLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P+ +
Sbjct  215  QNYERNFKKGLLTDSTLPLLTDSALRDVKIPPGPRLLILDHIERDPELK  263



>ref|XP_007039252.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Theobroma cacao]
 gb|EOY23753.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Theobroma cacao]
Length=309

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 193/229 (84%), Gaps = 1/229 (0%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT-PPPGANLDP  600
            K+ E+ +G + WL+KQS+PVEAA VT  SAAQG  IGA +G L+ D+  + P P ++L+P
Sbjct  76   KFKEVENGFRTWLAKQSMPVEAAVVTGTSAAQGAAIGAFMGTLTNDISSSLPTPQSSLNP  135

Query  599  NAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMY  420
             AMA+  QAQAL+GGPLVQARNFAVMTGVNAGISCV++R+RGKEDVQSSM AAFGSG M+
Sbjct  136  QAMASLQQAQALSGGPLVQARNFAVMTGVNAGISCVMRRLRGKEDVQSSMVAAFGSGAMF  195

Query  419  SLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            SLVSG+GGP+    A++SG+FFALVQGGLF+LG++FSQPPAED  Y +TRS+L+ LGL+ 
Sbjct  196  SLVSGIGGPNQAANAVSSGLFFALVQGGLFQLGKKFSQPPAEDPYYSRTRSMLNSLGLQN  255

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P+ R K
Sbjct  256  YEKNFKKGLLTDSTLPLLTDSALRDVKIPPGPRLLILDHIQRDPELREK  304



>ref|XP_006844757.1| hypothetical protein AMTR_s00016p00256760 [Amborella trichopoda]
 gb|ERN06432.1| hypothetical protein AMTR_s00016p00256760 [Amborella trichopoda]
Length=251

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 184/230 (80%), Gaps = 2/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPP--PGANLD  603
            K  EL  G K WLSKQSLPVEAA VT  SAAQG  IGA +G L+ D   + P  P A L+
Sbjct  20   KLKELELGFKTWLSKQSLPVEAAIVTVTSAAQGAAIGAFMGTLTADATSSLPTAPQAGLN  79

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVM  423
            P AMA+  QAQALTGGPLVQARNFAVMTGVNAGISCV+KR+RG EDVQSSM AAFGSG M
Sbjct  80   PQAMASLKQAQALTGGPLVQARNFAVMTGVNAGISCVMKRIRGVEDVQSSMVAAFGSGAM  139

Query  422  YSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            +SLVSGMGGP+     +TSG+FFALVQGGLFKLGQ+FSQPP ED+ Y +TR++L+ LGL+
Sbjct  140  FSLVSGMGGPNQAANVITSGLFFALVQGGLFKLGQKFSQPPVEDVYYTRTRNMLTNLGLQ  199

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
             YE NFK+GLLTD TLPLL D+AL+DV IPPGPRLLILD + R+P+  ++
Sbjct  200  NYESNFKKGLLTDRTLPLLNDNALRDVKIPPGPRLLILDHIQRDPELVKE  249



>ref|XP_011084593.1| PREDICTED: uncharacterized protein LOC105166805 isoform X1 [Sesamum 
indicum]
Length=271

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 191/232 (82%), Gaps = 4/232 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPPGA-NL  606
            K  E+ +  K WL+KQSLPVEAA VTA S AQG  IG  +G L+ D     TPPP A NL
Sbjct  35   KLKEVETRFKGWLAKQSLPVEAAVVTATSGAQGAAIGGFMGTLTGDASSLVTPPPNAVNL  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+AMA+  QAQAL GGPLVQARNFAVMTGVNAGISC+++R+RGKEDVQSSM AAFGSG 
Sbjct  95   NPDAMASLKQAQALAGGPLVQARNFAVMTGVNAGISCIMRRLRGKEDVQSSMVAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFALVQGG+F+LGQ+FSQPP ED+ YVKTRS+LS LGL
Sbjct  155  MFSLVSGMGGPNQAANAVTSGLFFALVQGGIFQLGQKFSQPPTEDVYYVKTRSMLSNLGL  214

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH-RNPDFRRK  93
            + YEKNFK+GLLTD TLPLLTDSAL+DV+IPPGPRLLILD +  R+P+ + +
Sbjct  215  QNYEKNFKKGLLTDNTLPLLTDSALRDVNIPPGPRLLILDHIESRSPELKER  266



>gb|KJB39516.1| hypothetical protein B456_007G017700 [Gossypium raimondii]
Length=263

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 192/230 (83%), Gaps = 2/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT--PPPGANLD  603
            K+ E+ +G +AWLSKQ LPVEA  VT   AAQG  IGA++G L+ D+  +   PP A+L+
Sbjct  29   KFKEVENGFRAWLSKQPLPVEATVVTTTGAAQGAAIGALMGTLTNDISSSLQTPPQASLN  88

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVM  423
            P AMA+F QAQAL+GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQSSMAAAFGSG M
Sbjct  89   PQAMASFKQAQALSGGPLVQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMAAAFGSGAM  148

Query  422  YSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            +SLVSGMGGP+    A+TSG+FFALVQGGLF+LG+ FSQPP ED+ Y +TRS+L+ LGL+
Sbjct  149  FSLVSGMGGPNQAANAVTSGLFFALVQGGLFQLGKNFSQPPVEDVNYYRTRSMLNSLGLQ  208

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
             YEKNFK+GLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P  + K
Sbjct  209  NYEKNFKKGLLTDSTLPLLTDSALRDVKIPPGPRLLILDHIQRDPVLKEK  258



>ref|XP_011005386.1| PREDICTED: uncharacterized protein LOC105111656 [Populus euphratica]
Length=313

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 189/234 (81%), Gaps = 6/234 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGV---IGAILGNLSPDLQ---PTPPPG  615
            K+ EL  G K+WLSKQSLPVEAA VTA    QG     IGA++G L+PD+    PTPPP 
Sbjct  76   KFKELEDGFKSWLSKQSLPVEAAVVTATGGGQGVQGAAIGAVMGTLTPDISSSMPTPPPQ  135

Query  614  ANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFG  435
            A+L+P AMA+  QAQAL GGPL+QARNFAVMTG NAGI+C++KR+RGKEDVQSSM AAFG
Sbjct  136  ASLNPQAMASLKQAQALAGGPLIQARNFAVMTGTNAGIACIMKRLRGKEDVQSSMVAAFG  195

Query  434  SGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSG  255
            SG M+SLVSGMGG +    A+TSG+FF+LVQGGLFKLG++ S+PP ED+ Y +TRS+L+ 
Sbjct  196  SGAMFSLVSGMGGANPATNAITSGLFFSLVQGGLFKLGEKLSKPPVEDLCYARTRSMLNN  255

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            LGL+ YEKNFK+GLLTD TLPLLTDSAL+D  IPPGPRLLILD + R+P+ R K
Sbjct  256  LGLQTYEKNFKKGLLTDNTLPLLTDSALRDARIPPGPRLLILDHLRRDPELREK  309



>ref|XP_010910427.1| PREDICTED: uncharacterized protein LOC105036351 [Elaeis guineensis]
Length=258

 Score =   281 bits (718),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 189/231 (82%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPP-GAN  609
            ++ EL +G + WL+KQ L VEAA VTA SAAQG  IG +LG L+PD     PTPPP  A 
Sbjct  25   RFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAIGGLLGTLTPDAASTFPTPPPQAAG  84

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            LDP A+A+F QAQA  GGPL QARNFAVMTGVNAGISCV++R+RG EDVQ+SM AAFGSG
Sbjct  85   LDPQALASFKQAQAFAGGPLAQARNFAVMTGVNAGISCVMRRLRGVEDVQNSMVAAFGSG  144

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             M+SLVSGMGGP+     +TSG+FFALVQGGLFKLGQ+FSQPPA+DM Y + RS+L  LG
Sbjct  145  AMFSLVSGMGGPNQGANVITSGLFFALVQGGLFKLGQKFSQPPADDMYYSQARSMLRSLG  204

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            L+ YEKNFK+GLLTD+TLPLLTDSAL+DV+IPPGPRLLILD + R+P+ R+
Sbjct  205  LQNYEKNFKKGLLTDSTLPLLTDSALRDVNIPPGPRLLILDHIQRDPELRK  255



>ref|XP_008788092.1| PREDICTED: uncharacterized protein LOC103705955 isoform X1 [Phoenix 
dactylifera]
Length=258

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 188/231 (81%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPP-GAN  609
            ++ EL +G + WL+KQ L VEAA VTA SAAQG  IG +LG L+PD     PTPPP  A 
Sbjct  25   RFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAIGGLLGTLTPDAASTFPTPPPQAAG  84

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            LD  A+ +F QAQA  GGPL QARNFAVMTGVNAGISCV++R+RG EDVQ+SM AAFGSG
Sbjct  85   LDAQALTSFKQAQAFAGGPLAQARNFAVMTGVNAGISCVMRRLRGLEDVQNSMVAAFGSG  144

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             M+SLVSGMGGP+    A+TSG+FFALVQGGLFKLGQ+FSQPPA+DM Y + RS+L  LG
Sbjct  145  AMFSLVSGMGGPNQAANAITSGLFFALVQGGLFKLGQKFSQPPADDMYYSQARSMLGNLG  204

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            L+ YEKNFK+GLLTD+TLPLLTDSAL+DV+IPPGPRLLILD + R+P+ R+
Sbjct  205  LQNYEKNFKKGLLTDSTLPLLTDSALRDVNIPPGPRLLILDHIQRDPELRK  255



>gb|KHG07931.1| Uncharacterized protein F383_34960 [Gossypium arboreum]
Length=251

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 180/230 (78%), Gaps = 14/230 (6%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT--PPPGANLD  603
            K+ E+ +G +AWLSKQ LPVEA  VT   AAQG  IGA++G L+ D+  +   PP A+L+
Sbjct  29   KFKEVENGFRAWLSKQPLPVEATVVTTTGAAQGAAIGALMGTLTNDISSSFQTPPQASLN  88

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVM  423
            P AMA+F QAQAL+GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQSSMAAAFGSG M
Sbjct  89   PQAMASFKQAQALSGGPLVQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMAAAFGSGAM  148

Query  422  YSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            +SLVSGMGGP+    A+TSG+FFALVQGGLF+LGQ+FSQPP ED+ Y KTRS+L+ LGL+
Sbjct  149  FSLVSGMGGPNQAANAVTSGLFFALVQGGLFQLGQKFSQPPVEDVNYYKTRSMLNSLGLQ  208

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
             YEKNFK+G             AL+DV IPPGPRLLILD + R+P  + K
Sbjct  209  NYEKNFKKGF------------ALRDVKIPPGPRLLILDHIQRDPVLKEK  246



>ref|XP_010942297.1| PREDICTED: uncharacterized protein LOC105060333 [Elaeis guineensis]
 ref|XP_010942298.1| PREDICTED: uncharacterized protein LOC105060333 [Elaeis guineensis]
Length=259

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 191/232 (82%), Gaps = 4/232 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPP-GAN  609
            ++ EL  G +AWL++QS+PVEAA VTA  AAQG  IG ++G L+ DL    PTPPP  A 
Sbjct  25   RFRELEGGFRAWLARQSMPVEAAVVTATGAAQGAAIGGLMGTLTSDLTSAFPTPPPQAAG  84

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            L P AM++  QAQA  GGPLVQARNFAVMTGVNAGISCV+KR+RG EDVQSSM AAFGSG
Sbjct  85   LSPQAMSSLKQAQAFAGGPLVQARNFAVMTGVNAGISCVMKRIRGVEDVQSSMVAAFGSG  144

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++SLVSG+GGP+    A+TSG+FFALVQGGLFKLGQ+FSQ PAED+ Y +TR +L+ LG
Sbjct  145  ALFSLVSGLGGPNQAANAVTSGLFFALVQGGLFKLGQKFSQSPAEDVYYARTRCMLTSLG  204

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L+ YEKNFK+GLLTDTTLPLLTDSAL+DV IPPGPRLLILD +HR+P+F RK
Sbjct  205  LQNYEKNFKKGLLTDTTLPLLTDSALRDVKIPPGPRLLILDHIHRDPEFVRK  256



>gb|EYU19716.1| hypothetical protein MIMGU_mgv1a011771mg [Erythranthe guttata]
Length=270

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 185/231 (80%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPP-GANL  606
            K+ E+    K WL+KQSLPVEAA VTA SAAQG  IGA +G L+ D     TPPP  A L
Sbjct  35   KFKEVEHKFKGWLAKQSLPVEAAVVTATSAAQGAAIGAFMGTLTGDTSSLITPPPNAAGL  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQA TGGPLVQARN AVMTGVNAGISCV++R+RGKEDVQSSM AAFGSG 
Sbjct  95   NPEAMASLKQAQAFTGGPLVQARNIAVMTGVNAGISCVMRRLRGKEDVQSSMVAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            +++LVSGMGGP+    ALTSG+FFALVQGG+F+LGQ+FSQPP ED+ Y KTRS+LS LGL
Sbjct  155  IFTLVSGMGGPNQAANALTSGLFFALVQGGIFQLGQKFSQPPVEDVYYAKTRSMLSNLGL  214

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL D TLPLLTDSALKD +IPPGPRLLIL  V  NP+ + +
Sbjct  215  QNYEKNFKKGLLNDITLPLLTDSALKDANIPPGPRLLILAHVDSNPELKER  265



>gb|EPS71171.1| hypothetical protein M569_03588, partial [Genlisea aurea]
Length=247

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 187/223 (84%), Gaps = 3/223 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPPG-ANL  606
            K  E+ +  + WL+KQ+LPVEAA VTA S+ QG  IG ++G L+ D     TPPP  A L
Sbjct  25   KLKEVETRFRGWLAKQTLPVEAAVVTATSSIQGAAIGGLMGTLTGDASSMVTPPPNVAGL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+AMA+  QAQAL GGPLVQARNFAVMTG NAGISCV++R+RGKEDVQSSM AAFGSG 
Sbjct  85   NPDAMASLKQAQALAGGPLVQARNFAVMTGTNAGISCVMRRLRGKEDVQSSMVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP++   A+TSG+FFALVQGG+++LGQ+FSQPPAED++Y KTRS+LS LGL
Sbjct  145  MFSLVSGMGGPNLAANAVTSGLFFALVQGGIYQLGQKFSQPPAEDVRYAKTRSMLSVLGL  204

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH  117
            + YEKNFK+GLLTD+TLPL+TDSAL+DV+IPPGPRLLILD + 
Sbjct  205  QNYEKNFKKGLLTDSTLPLVTDSALRDVNIPPGPRLLILDHID  247



>ref|XP_008811009.1| PREDICTED: uncharacterized protein LOC103722289 isoform X1 [Phoenix 
dactylifera]
Length=259

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 187/232 (81%), Gaps = 4/232 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGA----N  609
            ++ EL  G +AWL++QS+PVEAA VTA SAAQG  IG ++G L+ DL    P        
Sbjct  25   RFKELEGGFRAWLARQSMPVEAAVVTATSAAQGAAIGGLMGTLTSDLTSAFPAPPPQAAG  84

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            L P AM++  QAQA  GGPLVQARNFAVMTGVNAGISCV+KR+RG EDVQSSM AAFGSG
Sbjct  85   LSPQAMSSLKQAQAFAGGPLVQARNFAVMTGVNAGISCVMKRIRGVEDVQSSMVAAFGSG  144

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++SLVSGMGGP+    A+TSG+FFA+VQGGLFKLGQ+FSQPPAED+ Y + RS+L+ LG
Sbjct  145  ALFSLVSGMGGPNQAANAVTSGLFFAVVQGGLFKLGQKFSQPPAEDVYYSRARSMLTSLG  204

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L+ YEKNFK+GLLTD+TLPLLTDSAL+DV IPPGPRLLILD + RNP+F RK
Sbjct  205  LQNYEKNFKKGLLTDSTLPLLTDSALRDVKIPPGPRLLILDHIDRNPEFVRK  256



>ref|XP_003602440.1| SAM domain family protein [Medicago truncatula]
 gb|AES72691.1| protein translocase, putative [Medicago truncatula]
Length=263

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 188/231 (81%), Gaps = 3/231 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            +Y  L +G K WLSKQS+ VEAA VT   AAQG  IGA LG L+ D     PTPPP A+L
Sbjct  28   RYKHLENGFKLWLSKQSIAVEAAVVTTTGAAQGAAIGAFLGTLTGDASSAFPTPPPNASL  87

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQAL GGPL+QARNFA++TGV+AGI+CVL+R+RGKEDV+SSMAAAFGSGV
Sbjct  88   NPQAMASLQQAQALAGGPLIQARNFAILTGVSAGITCVLRRLRGKEDVKSSMAAAFGSGV  147

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
             +SLVSGMGGP+ V  A+TSG+FFAL QGG+F++GQ+FS+PPAED  Y KTR++L  LGL
Sbjct  148  TFSLVSGMGGPNKVGNAVTSGLFFALFQGGVFQIGQKFSRPPAEDADYAKTRNMLQNLGL  207

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            + YEKNFK+GLL+D TLPLL DSAL+DV IPPGPRLLILD +HR+ D R K
Sbjct  208  QNYEKNFKKGLLSDNTLPLLNDSALRDVKIPPGPRLLILDHIHRDQDLREK  258



>ref|XP_009404579.1| PREDICTED: uncharacterized protein LOC103987863 [Musa acuminata 
subsp. malaccensis]
Length=258

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 187/232 (81%), Gaps = 4/232 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGA-N  609
            +  EL +G +AWL+KQ   VEAA VTA SAAQG  IGA++G+L+ D     PTPPP A  
Sbjct  27   RIKELETGFRAWLAKQPTAVEAAIVTATSAAQGAFIGALMGSLTSDASSALPTPPPNAPG  86

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            L+P AMA+  QAQA  GGPLVQARNFAVMTG NAGISCV+KR+RG ED+Q SMAAAFGSG
Sbjct  87   LNPQAMASLKQAQAFAGGPLVQARNFAVMTGTNAGISCVMKRIRGVEDMQGSMAAAFGSG  146

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             M+SLVSGMGGP+    A+TSG+FFALVQGGLFK+G++FSQPP +D+ Y  T+ +L+ LG
Sbjct  147  AMFSLVSGMGGPNQALNAVTSGLFFALVQGGLFKIGEKFSQPPVDDVLYSGTKRMLTNLG  206

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L+ YEKNFK+GLL+D TLPLLTDSAL+DV+IPPGPRLLILD + RNP+  ++
Sbjct  207  LQNYEKNFKKGLLSDATLPLLTDSALRDVNIPPGPRLLILDHIQRNPELVKR  258



>gb|EYU19715.1| hypothetical protein MIMGU_mgv1a011771mg [Erythranthe guttata]
Length=271

 Score =   274 bits (700),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 185/232 (80%), Gaps = 4/232 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPP-GANL  606
            K+ E+    K WL+KQSLPVEAA VTA SAAQG  IGA +G L+ D     TPPP  A L
Sbjct  35   KFKEVEHKFKGWLAKQSLPVEAAVVTATSAAQGAAIGAFMGTLTGDTSSLITPPPNAAGL  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQA TGGPLVQARN AVMTGVNAGISCV++R+RGKEDVQSSM AAFGSG 
Sbjct  95   NPEAMASLKQAQAFTGGPLVQARNIAVMTGVNAGISCVMRRLRGKEDVQSSMVAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            +++LVSGMGGP+    ALTSG+FFALVQGG+F+LGQ+FSQPP ED+ Y KTRS+LS LGL
Sbjct  155  IFTLVSGMGGPNQAANALTSGLFFALVQGGIFQLGQKFSQPPVEDVYYAKTRSMLSNLGL  214

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH-RNPDFRRK  93
            + YEKNFK+GLL D TLPLLTDSALKD +IPPGPRLLIL  V   NP+ + +
Sbjct  215  QNYEKNFKKGLLNDITLPLLTDSALKDANIPPGPRLLILAHVDSSNPELKER  266



>ref|XP_004307936.1| PREDICTED: uncharacterized protein LOC101296523 [Fragaria vesca 
subsp. vesca]
Length=261

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 186/233 (80%), Gaps = 7/233 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            +   L +G ++WL+KQS+ VEAA VT AS AQG  IG I+G L+ D+    PTPP    L
Sbjct  27   RVKHLETGFRSWLAKQSVAVEAAIVTVASGAQGAAIGGIMGTLTGDISSALPTPPQA--L  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RGKEDVQSSM AAFGSG 
Sbjct  85   NPQAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRLRGKEDVQSSMVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA--EDMQYVKTRSLLSGL  252
            ++SLVSG GGP+ V  ALTSG+FFA VQGGLFKLGQ+FS+ P+  +D+ Y KTRS+LS L
Sbjct  145  LFSLVSGFGGPNQVQNALTSGIFFAAVQGGLFKLGQRFSKVPSVDKDLYYSKTRSMLSNL  204

Query  251  GLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            GL+ YEKNFK GLLTD TLPLL DSAL++V IPPGPRLLILD + R+P+F+ K
Sbjct  205  GLDHYEKNFKNGLLTDYTLPLLNDSALREVKIPPGPRLLILDHIQRDPEFQEK  257



>gb|KJB37429.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=255

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 179/223 (80%), Gaps = 4/223 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ E+  G KAWL KQS+PVEAA VTA  A QG  IGA++G L+ D+    PTPP  A+L
Sbjct  28   KFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAAIGALMGTLTKDVSSSFPTPPQ-ASL  86

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +  AMA+  QAQAL+G P VQARNFAVMTGVNAG++CV+KR+RGKEDVQSSM AAFGSG 
Sbjct  87   NHQAMASLKQAQALSGAPWVQARNFAVMTGVNAGLACVMKRLRGKEDVQSSMVAAFGSGA  146

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFAL+QG LF+ GQ+ SQP  EDM Y +TRS+L+ LGL
Sbjct  147  MFSLVSGMGGPNQAANAVTSGLFFALIQGVLFQFGQKLSQPAVEDMYYSRTRSMLNSLGL  206

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH  117
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD V 
Sbjct  207  QNYEKNFKKGLLTDNTLPLLTDSALRDVKIPPGPRLLILDHVQ  249



>ref|XP_009421320.1| PREDICTED: uncharacterized protein LOC104000893 [Musa acuminata 
subsp. malaccensis]
Length=260

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 187/232 (81%), Gaps = 4/232 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGA-N  609
            +  EL SG +AWL+KQ   +EAA VTA SAAQG  IGA++G+L+ D     PTPP  A  
Sbjct  28   RVKELESGFRAWLAKQPTAMEAAIVTATSAAQGAFIGALMGSLTSDASSAIPTPPSNAPG  87

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            L+P AMA+  QAQA  GGPLVQARNFAVMTG NAGISCV++R+RG ED+QSS+ AAFGSG
Sbjct  88   LNPEAMASLKQAQAFAGGPLVQARNFAVMTGTNAGISCVMRRIRGVEDMQSSVVAAFGSG  147

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             M+SLVSGMGGP+    A+TSG+FFALVQGGLFK+G++FSQPPA+D+ Y  T+ +L+ LG
Sbjct  148  AMFSLVSGMGGPNQALNAVTSGLFFALVQGGLFKIGEKFSQPPADDVLYSGTKRMLTNLG  207

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L+ YEKNFK+GLL+D TLPLLTDSAL+DV+IPPGPRLLILD + RNP+  ++
Sbjct  208  LQNYEKNFKKGLLSDATLPLLTDSALRDVNIPPGPRLLILDHIQRNPEVVKR  259



>ref|XP_009413503.1| PREDICTED: uncharacterized protein LOC103994789 [Musa acuminata 
subsp. malaccensis]
Length=264

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 183/231 (79%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD----LQPTPPPGAN  609
            +  EL +G +AWL+KQS+ VEAA VTA +AAQG  IG +LG L+ D    L  + P  A 
Sbjct  32   RIKELETGFRAWLAKQSMAVEAAVVTATNAAQGAAIGGLLGTLTSDVSSALPASTPNAAG  91

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            L+P A+A+   AQAL GGPLVQARNFAVM G NAGIS V+KR+RG EDVQSSM AAFGSG
Sbjct  92   LNPEAIASLKNAQALAGGPLVQARNFAVMAGANAGISSVMKRIRGVEDVQSSMVAAFGSG  151

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++SLVSGMGGP+    A+TSG+FFAL QGGLF +GQ+FS PPAE++ Y +TR +L+ LG
Sbjct  152  ALFSLVSGMGGPNQAANAVTSGLFFALFQGGLFMVGQKFSSPPAEEVYYSQTRGMLTCLG  211

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            L+KYEKNFK+GLLTD+TLPLLTDSAL+DV+IPPGPRLLILD +H +P+  +
Sbjct  212  LQKYEKNFKKGLLTDSTLPLLTDSALRDVNIPPGPRLLILDHIHSDPELTK  262



>gb|ACG31629.1| hypothetical protein [Zea mays]
Length=271

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 180/230 (78%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P  N 
Sbjct  40   RVKAIEAGFRAWMAKQPIQIEAAVTTAVGAVQGGALGGLMGSLTADGGSPFPIPQPPPNA  99

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RGKED+Q SMAAAFGSG 
Sbjct  100  NPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGKEDIQGSMAAAFGSGA  159

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +TRS+L  LGL
Sbjct  160  LFSIVSGMGTPNPVANAVTTGVAFAVFQGGFFMIGQKFSKPPSEDTYYSRTRSMLHKLGL  219

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            EKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+  R
Sbjct  220  EKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPELVR  269



>gb|AFW71638.1| hypothetical protein ZEAMMB73_527455 [Zea mays]
Length=271

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P  N 
Sbjct  40   RVKAIEAGFRAWMAKQPIQIEAAVTTAVGAVQGGALGGLMGSLTADGGSPFPIPQPPPNA  99

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RGKED+Q SMAAAFGSG 
Sbjct  100  NPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGKEDIQGSMAAAFGSGA  159

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +TRS+L  LGL
Sbjct  160  LFSIVSGMGTPNPVANAVTTGVAFAVFQGGFFMIGQKFSKPPSEDTYYSRTRSMLHKLGL  219

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDF  102
            EKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+ 
Sbjct  220  EKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPEL  267



>ref|NP_001132412.1| uncharacterized protein LOC100193860 [Zea mays]
 gb|ACF81241.1| unknown [Zea mays]
Length=249

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P  N 
Sbjct  18   RVKAIEAGFRAWMAKQPIQIEAAVTTAVGAVQGGALGGLMGSLTADGGSPFPIPQPPPNA  77

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RGKED+Q SMAAAFGSG 
Sbjct  78   NPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGKEDIQGSMAAAFGSGA  137

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +TRS+L  LGL
Sbjct  138  LFSIVSGMGTPNPVANAVTTGVAFAVFQGGFFMIGQKFSKPPSEDTYYSRTRSMLHKLGL  197

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDF  102
            EKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+ 
Sbjct  198  EKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPEL  245



>ref|XP_010671269.1| PREDICTED: uncharacterized protein LOC104888105 [Beta vulgaris 
subsp. vulgaris]
Length=265

 Score =   258 bits (660),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 183/236 (78%), Gaps = 8/236 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGA---NL  606
            K  E+   VK+WLSKQSLPVEA  VTA  A QG +IGA++G L+ D+  T P       L
Sbjct  30   KIKEVEIKVKSWLSKQSLPVEAVVVTAGGATQGALIGALMGTLTQDMSSTMPMPPPTPGL  89

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP  +A+  QAQAL+GGPLVQARNFAVMTGVN GISCVLKR++GKEDV SSM AAFGSG 
Sbjct  90   DPKTLASMQQAQALSGGPLVQARNFAVMTGVNVGISCVLKRLKGKEDVWSSMIAAFGSGA  149

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQP--PAEDMQYVKTRSLLSGL  252
            M+SLVSGMGGP+ +P  ++SG FFAL QGG++KLG++FS+P  P +D  Y  TRS+L  L
Sbjct  150  MFSLVSGMGGPNQIPNMVSSGAFFALAQGGIYKLGEKFSKPGVPDDDPFYANTRSMLITL  209

Query  251  GLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNP---DFRRK  93
            GL+ YEKNFK+G+L D TLPLLTDSALKDV+IPPGPRLLILDQ+ R+P   + RRK
Sbjct  210  GLQSYEKNFKKGMLNDRTLPLLTDSALKDVNIPPGPRLLILDQIERDPLLKERRRK  265



>gb|KGN49828.1| hypothetical protein Csa_5G139080 [Cucumis sativus]
Length=228

 Score =   252 bits (643),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT-PPPGANLDP  600
            ++ EL +G + WL+KQSLPVEAA VT  SAAQG  IG  +G L+ D+  + P P A L+P
Sbjct  25   RFKELENGFRTWLAKQSLPVEAAVVTVTSAAQGAAIGGFMGTLTNDVSSSLPTPQAGLNP  84

Query  599  NAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMY  420
             AMA+F QAQAL GGPLVQARNFAVMTGVNAGIS V+KR+RGKEDVQSSM AAFGSG M+
Sbjct  85   QAMASFKQAQALAGGPLVQARNFAVMTGVNAGISSVMKRLRGKEDVQSSMVAAFGSGAMF  144

Query  419  SLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            SLVSGMGGP+    A+TSG+FFALVQGGLFKLG++FSQPP ED+ Y KTRS+L+ LGL+ 
Sbjct  145  SLVSGMGGPNQATNAVTSGLFFALVQGGLFKLGEKFSQPPVEDVYYAKTRSMLNNLGLQS  204

Query  239  YEKNFKRG  216
            YEKNFK+G
Sbjct  205  YEKNFKKG  212



>ref|XP_006441309.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
 gb|ESR54549.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
Length=259

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 180/233 (77%), Gaps = 6/233 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF---SQPPAEDMQYVKTRSLLSG  255
             +SLVSGMGG +    A TSG+ FA+ QG  FK+G+ +    +P A+D+ Y +TR +L  
Sbjct  145  AFSLVSGMGGANPAANAFTSGLLFAIFQGCSFKIGEMWQSTQRPTADDVYYARTRGMLDK  204

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            LGL+ Y KNFKRGLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P+ ++
Sbjct  205  LGLQNYTKNFKRGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELKK  257



>ref|XP_001766937.1| predicted protein [Physcomitrella patens]
 gb|EDQ68339.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 176/232 (76%), Gaps = 6/232 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDL---QPTPPPGANL  606
            K  +L S +K WL KQ   VE   VTA SA QGG IGA++G  S D+    PTPPPG  L
Sbjct  19   KVKKLDSDLKVWLKKQPAAVEVVLVTAGSAVQGGAIGALMGTFSSDVASTMPTPPPG--L  76

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRG-KEDVQSSMAAAFGSG  429
            +P A A+  QA+A  GGPL QARNFAVMTGVNAGI+C +KR RG KED+Q+S  AAFGSG
Sbjct  77   NPEAAASLQQAKAFAGGPLTQARNFAVMTGVNAGITCAMKRARGGKEDLQTSAVAAFGSG  136

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++S VSGMGGP+V+  ALT+G FFALVQGGLF+LG++F++ P ED  Y++++S+L  L 
Sbjct  137  AVFSAVSGMGGPNVLGNALTTGFFFALVQGGLFQLGKKFAKTPTEDKDYMRSKSMLEKLS  196

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L+KYEKNFK+G+LTD+TL LL DS+L+DV IPPGPRLLILD + R+ D  ++
Sbjct  197  LQKYEKNFKKGMLTDSTLHLLNDSSLRDVQIPPGPRLLILDHLKRSEDVTKR  248



>ref|XP_002453918.1| hypothetical protein SORBIDRAFT_04g021420 [Sorghum bicolor]
 gb|EES06894.1| hypothetical protein SORBIDRAFT_04g021420 [Sorghum bicolor]
Length=270

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+PD     P P P  N 
Sbjct  39   RVKAIEAGFRAWMAKQPIQIEAAVATAVGAVQGGALGGLMGSLTPDGGSPFPMPQPPPNA  98

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG+ED+Q SMAAAFGSG 
Sbjct  99   NPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGQEDIQGSMAAAFGSGA  158

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSG+G P+    A+T+GV FA+ QGG F +GQ+FS+P +ED  Y +TRS+L  LGL
Sbjct  159  LFSIVSGVGTPNPAVNAITTGVAFAVFQGGFFMIGQKFSKPSSEDTYYSRTRSMLHKLGL  218

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDF  102
            EKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+ 
Sbjct  219  EKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPEL  266



>ref|XP_006493476.1| PREDICTED: uncharacterized protein LOC102629263 [Citrus sinensis]
 gb|KDO44880.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=259

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 180/233 (77%), Gaps = 6/233 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF---SQPPAEDMQYVKTRSLLSG  255
             +SLVSGMGG +    A TSG+ FA+ QG  FK+G+ +    +P A+D+ Y +TR +L  
Sbjct  145  AFSLVSGMGGANPAVNAFTSGLLFAIFQGCSFKIGEMWQSTQRPTADDVYYARTRGMLDK  204

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            LGL+ Y KNFKRGLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P+ ++
Sbjct  205  LGLQNYTKNFKRGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELKK  257



>ref|XP_004975523.1| PREDICTED: uncharacterized protein LOC101781948 isoform X2 [Setaria 
italica]
Length=271

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 176/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +G++AWL+KQ   VEAA  TA  A QG  +G ++G L+PD     P PPP    
Sbjct  40   RVRSLEAGLRAWLAKQPTHVEAAVSTAVGAVQGAALGGLMGTLAPDGGAALPVPPPPLGA  99

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP A+A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RGKEDVQ SMAAAFGSG 
Sbjct  100  DPKALASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGKEDVQGSMAAAFGSGA  159

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQP +ED  Y + RS+L  LGL
Sbjct  160  LFSIVSGMGTPNPVTNAITTGVAFAVFQGGFFMIGQKFSQPQSEDTYYSRGRSMLQTLGL  219

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+  R
Sbjct  220  QNYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDHIKRDPELTR  269



>gb|KDO44881.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=259

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 179/233 (77%), Gaps = 6/233 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF---SQPPAEDMQYVKTRSLLSG  255
             +SLVSGMGG +    A TSG+ FA+ QG  FK+ + +    +P A+D+ Y +TR +L  
Sbjct  145  AFSLVSGMGGANPAVNAFTSGLLFAIFQGCSFKVSEMWQSTQRPTADDVYYARTRGMLDK  204

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            LGL+ Y KNFKRGLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+P+ ++
Sbjct  205  LGLQNYTKNFKRGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQRDPELKK  257



>ref|XP_010541518.1| PREDICTED: uncharacterized protein LOC104814958 [Tarenaya hassleriana]
Length=262

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 178/229 (78%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ SG K+WLSKQSLPVEAA V+A S  QG  IG ++G LSP++   P PG  LDP 
Sbjct  36   KFKEVESGFKSWLSKQSLPVEAAIVSAMSGVQGAFIGGLMGTLSPEM---PQPG--LDPQ  90

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+F QAQAL GGPLVQARNFA +TGVNAGI+C++KR+RGKED++S++ AA GSG  YS
Sbjct  91   AMASFKQAQALVGGPLVQARNFAAITGVNAGIACIMKRLRGKEDLESAVVAALGSGAAYS  150

Query  416  LV-SGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LV SG+ G  V   A+T+   FAL QG  FKLG++FS+P AED  Y + RS+L  LGLEK
Sbjct  151  LVSSGLQGQPV--NAITTAAGFALFQGLFFKLGERFSKPTAEDPYYAQARSMLLKLGLEK  208

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D+TL LLTDSAL+DV+IPPGPRLLILD V R+P+ + K
Sbjct  209  YEKNFKKGLLNDSTLRLLTDSALRDVNIPPGPRLLILDHVQRDPELKGK  257



>ref|NP_001146865.1| SAM domain family protein [Zea mays]
 gb|ACG24035.1| SAM domain family protein [Zea mays]
 gb|AFW62507.1| SAM domain protein [Zea mays]
Length=270

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 176/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P +N 
Sbjct  39   RVKAIEAGFRAWMAKQPIHIEAAVSTAVGAVQGGALGGLMGSLTADGGSPFPIPQPPSNA  98

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            + +AMA+F QAQAL  GPLVQARNFAVMTG NAGISCV++R+RG+ED+Q SM AAFGSG 
Sbjct  99   NSDAMASFKQAQALAAGPLVQARNFAVMTGANAGISCVMRRLRGQEDIQGSMTAAFGSGA  158

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FS+P +ED  Y  TRS+L  LGL
Sbjct  159  LFSIVSGMGTPNPVLNAITTGVAFAVFQGGFFMIGQKFSKPSSEDTYYSLTRSMLHKLGL  218

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            EKYEKNF++GLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P   R
Sbjct  219  EKYEKNFRKGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPGLVR  268



>gb|AGT16912.1| SAM domain family protein [Saccharum hybrid cultivar R570]
Length=270

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 178/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P  N 
Sbjct  39   RVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFPMPQPPPNA  98

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F Q QAL GGPLVQARNFAVMTG NAGIS V++R+RG+ED+Q SMAAAFGSG 
Sbjct  99   NPEAMASFKQTQALAGGPLVQARNFAVMTGTNAGISSVMRRIRGQEDIQGSMAAAFGSGA  158

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSG+G P+ V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +TRS+L  LGL
Sbjct  159  LFSIVSGVGTPNPVVNAITTGVAFAVFQGGFFMIGQKFSKPPSEDTCYSRTRSMLHKLGL  218

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            EKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+  R
Sbjct  219  EKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPELVR  268



>gb|KHN02139.1| hypothetical protein glysoja_046465 [Glycine soja]
Length=172

 Score =   244 bits (624),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  593  MATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSL  414
            MA+  QAQAL GGPL+QARNFAVMTGVNAGISCVLKR+RGKEDVQSSMAAAFGSG ++SL
Sbjct  1    MASLKQAQALAGGPLIQARNFAVMTGVNAGISCVLKRIRGKEDVQSSMAAAFGSGALFSL  60

Query  413  VSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYE  234
            VSGMGGP+    ALTSG+FFALVQGGLF++GQ+FSQPPAED  Y KTR +L+ LGL+ YE
Sbjct  61   VSGMGGPNQATNALTSGLFFALVQGGLFQIGQKFSQPPAEDTHYAKTRHMLNNLGLQSYE  120

Query  233  KNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            KNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+ D + K
Sbjct  121  KNFKKGLLTDNTLPLLTDSALRDVRIPPGPRLLILDHIQRDADLKDK  167



>emb|CDP04965.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = -2

Query  593  MATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSL  414
            MA+F QAQAL+GGPL+QARNFAVMTGVNAGISCV+KR+RGKEDV+SSM AAFGSG M+SL
Sbjct  1    MASFKQAQALSGGPLIQARNFAVMTGVNAGISCVMKRLRGKEDVESSMVAAFGSGAMFSL  60

Query  413  VSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYE  234
            VSGMGG +    A+TSG+FFAL+QGGLFKLGQ+FS PPAED+ YVKTRS+LS LGL+ YE
Sbjct  61   VSGMGGTNQAANAVTSGLFFALIQGGLFKLGQKFSAPPAEDVCYVKTRSMLSNLGLQNYE  120

Query  233  KNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            KNFK+G             AL+DV IPPGPRLLILD +HR+P+ R K
Sbjct  121  KNFKKGF------------ALRDVRIPPGPRLLILDHIHRDPEIREK  155



>ref|XP_003579669.1| PREDICTED: uncharacterized protein LOC100827945 [Brachypodium 
distachyon]
Length=266

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 176/234 (75%), Gaps = 9/234 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD-----LQPTPPPGA  612
            +   L + V+AW++KQ   +EAA  TA  A QGG +G ++G  +PD       P PPPG 
Sbjct  35   RVKSLEAEVRAWMAKQPTHIEAAVTTAFGAVQGGALGGLMGTFAPDGGAGLPVPQPPPG-  93

Query  611  NLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGS  432
             +DPNAMATF QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ SMAAAFGS
Sbjct  94   -VDPNAMATFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSMAAAFGS  152

Query  431  GVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA--EDMQYVKTRSLLS  258
            G ++S+VSGMG P+ V  A+T+G+ FA+ QGG F +GQ+FS+P    EDM Y + R++L+
Sbjct  153  GALFSIVSGMGTPNPVVNAITTGMAFAVFQGGFFMVGQKFSKPKGQNEDMNYSRGRNMLN  212

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
             LGL+ YEKNFK+GLLTD TLPLL DSAL+DV+IPPGPRL+ILD + R P   +
Sbjct  213  QLGLQNYEKNFKKGLLTDETLPLLNDSALRDVNIPPGPRLVILDHIKREPGLTK  266



>gb|AGT17006.1| SAM domain family protein [Saccharum hybrid cultivar R570]
Length=270

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 178/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P  N 
Sbjct  39   RVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFPMPQPPPNA  98

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGIS V++R+RG+ED+Q SMAAAFGSG 
Sbjct  99   NPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISSVMRRIRGQEDIQGSMAAAFGSGA  158

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSG+G P+ V  A+T+GV FA+ QGG F +GQ+FS+P +ED  Y +TRS+L  LGL
Sbjct  159  LFSIVSGVGTPNPVVNAITTGVAFAVFQGGFFMIGQKFSKPSSEDTYYSRTRSMLHKLGL  218

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            EKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+  R
Sbjct  219  EKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPELVR  268



>gb|EEC77226.1| hypothetical protein OsI_15770 [Oryza sativa Indica Group]
Length=266

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 177/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P P P    
Sbjct  35   RVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFPVPQPPPGA  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DPNA+A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ SMAAAFGSG 
Sbjct  95   DPNALASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSMAAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQPP+ED+ Y + R++L  LGL
Sbjct  155  LFSIVSGMGSPNPVANAITTGVAFAVFQGGFFMIGQKFSQPPSEDIYYSRGRNMLKQLGL  214

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            + YEKNFK+GLLTD TLPLL DSAL+DV IPPGPRLLILD + R+P+  +
Sbjct  215  QNYEKNFKKGLLTDQTLPLLNDSALRDVKIPPGPRLLILDHIQRDPELTK  264



>ref|XP_006441307.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
 gb|ESR54547.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
Length=256

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 176/228 (77%), Gaps = 6/228 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF---SQPPAEDMQYVKTRSLLSG  255
             +SLVSGMGG +    A TSG+ FA+ QG  FK+G+ +    +P A+D+ Y +TR +L  
Sbjct  145  AFSLVSGMGGANPAANAFTSGLLFAIFQGCSFKIGEMWQSTQRPTADDVYYARTRGMLDK  204

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRN  111
            LGL+ Y KNFKRGLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+
Sbjct  205  LGLQNYTKNFKRGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQRS  252



>gb|EYU19717.1| hypothetical protein MIMGU_mgv1a011771mg [Erythranthe guttata]
Length=237

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 153/190 (81%), Gaps = 3/190 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP--TPPP-GANL  606
            K+ E+    K WL+KQSLPVEAA VTA SAAQG  IGA +G L+ D     TPPP  A L
Sbjct  35   KFKEVEHKFKGWLAKQSLPVEAAVVTATSAAQGAAIGAFMGTLTGDTSSLITPPPNAAGL  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+  QAQA TGGPLVQARN AVMTGVNAGISCV++R+RGKEDVQSSM AAFGSG 
Sbjct  95   NPEAMASLKQAQAFTGGPLVQARNIAVMTGVNAGISCVMRRLRGKEDVQSSMVAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            +++LVSGMGGP+    ALTSG+FFALVQGG+F+LGQ+FSQPP ED+ Y KTRS+LS LGL
Sbjct  155  IFTLVSGMGGPNQAANALTSGLFFALVQGGIFQLGQKFSQPPVEDVYYAKTRSMLSNLGL  214

Query  245  EKYEKNFKRG  216
            + YEKNFK+G
Sbjct  215  QNYEKNFKKG  224



>emb|CBI23120.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   243 bits (619),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = -2

Query  593  MATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSL  414
            MA+F QAQAL GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQSSM AAFGSG M+SL
Sbjct  1    MASFKQAQALAGGPLVQARNFAVMTGVNAGISCVMKRIRGKEDVQSSMVAAFGSGAMFSL  60

Query  413  VSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYE  234
            VSGMGGP+     +TSG+FFAL+QGG+F++GQ+FSQPPAED+ Y +TRS+L+ LGL+ YE
Sbjct  61   VSGMGGPNQATNVITSGLFFALIQGGIFQIGQKFSQPPAEDLFYSRTRSMLTSLGLQNYE  120

Query  233  KNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFR  99
            KNFKRGLLTD+TLPLLTDSALKD  IPPGPRLLILD + R+P+ +
Sbjct  121  KNFKRGLLTDSTLPLLTDSALKDARIPPGPRLLILDHIQRDPELK  165



>emb|CAH66528.1| H0502B11.8 [Oryza sativa Indica Group]
Length=266

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 176/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L  G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P P P    
Sbjct  35   RVKTLEGGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFPVPQPPPGA  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DPNA+A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ SMAAAFGSG 
Sbjct  95   DPNALASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSMAAAFGSGA  154

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQPP+ED+ Y + R++L  LGL
Sbjct  155  LFSIVSGMGSPNPVANAITTGVAFAVFQGGFFMIGQKFSQPPSEDIYYSRGRNMLKQLGL  214

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            + YEKNFK+GLLTD TLPLL DSAL+DV IPPGPRLLILD + R+P+  +
Sbjct  215  QNYEKNFKKGLLTDQTLPLLNDSALRDVKIPPGPRLLILDHIQRDPELTK  264



>gb|KDO44883.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=256

 Score =   245 bits (626),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 176/228 (77%), Gaps = 6/228 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF---SQPPAEDMQYVKTRSLLSG  255
             +SLVSGMGG +    A TSG+ FA+ QG  FK+G+ +    +P A+D+ Y +TR +L  
Sbjct  145  AFSLVSGMGGANPAVNAFTSGLLFAIFQGCSFKIGEMWQSTQRPTADDVYYARTRGMLDK  204

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRN  111
            LGL+ Y KNFKRGLLTD+TLPLLTDSAL+DV IPPGPRLLILD + R+
Sbjct  205  LGLQNYTKNFKRGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQRS  252



>gb|AGT16087.1| hypothetical protein SHCRBa_224_E06_F_230 [Saccharum hybrid cultivar 
R570]
Length=270

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 177/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P  N 
Sbjct  39   RVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFPMPQPPPNA  98

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGIS V++R+RG+ED+Q SMAAAFGSG 
Sbjct  99   NPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISSVMRRIRGQEDIQGSMAAAFGSGA  158

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSG+G P+ V  A+T+GV FA+ QGG F +GQ+FS+PP ED  Y +TR++L  LGL
Sbjct  159  LFSIVSGVGTPNPVVNAITTGVAFAVFQGGFFMIGQKFSKPPNEDTYYSRTRNMLHKLGL  218

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            EKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+ +  R
Sbjct  219  EKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDRELVR  268



>gb|EMT03006.1| hypothetical protein F775_30606 [Aegilops tauschii]
Length=269

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 174/234 (74%), Gaps = 9/234 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD-----LQPTPPPGA  612
            ++  L  GV+ W++KQ   +EAA  TA  A QGG +G ++G  +P+       P PPPG 
Sbjct  36   RFRSLEVGVREWMAKQPTHIEAAVTTAFGAVQGGALGGLMGTFAPEGGAGLPVPQPPPG-  94

Query  611  NLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGS  432
             LDP AMATF QAQAL GGPLVQARNFAVMTG NAGISCV++RVRG EDVQ SMAAAFGS
Sbjct  95   -LDPKAMATFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRVRGVEDVQGSMAAAFGS  153

Query  431  GVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA--EDMQYVKTRSLLS  258
            G ++S+VSGMG P+ V  A+T+G+ FA+ QGG F +GQ+FS+     EDM Y + R++LS
Sbjct  154  GALFSIVSGMGTPNPVVNAITTGMAFAVFQGGFFIVGQKFSKTKTHNEDMNYSRARNMLS  213

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
             LGL+ YEKNFK+GLLTD TLPLL +SAL+DV+IPPGPRL+IL+ + R P   +
Sbjct  214  QLGLQNYEKNFKKGLLTDETLPLLNESALRDVNIPPGPRLVILEHIKREPGLTK  267



>ref|XP_004952617.1| PREDICTED: uncharacterized protein LOC101769651 isoform X2 [Setaria 
italica]
Length=272

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 178/231 (77%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+LS D     P P P  N 
Sbjct  40   RVKAIEAGFRAWMAKQPIHIEAAVTTAVGAVQGGALGGLMGSLSADGGSPFPMPQPPPNA  99

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG+ED+Q SMAAAFGSGV
Sbjct  100  NPDAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGQEDIQGSMAAAFGSGV  159

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFS-QPPAEDMQYVKTRSLLSGLG  249
            ++S+VSGMG P+    A+T+G  FA+ QGG F +GQ+FS Q   ED  Y +TRS+L+ LG
Sbjct  160  LFSIVSGMGTPNPAVNAITTGAAFAVFQGGFFMIGQKFSKQQGGEDTYYSQTRSMLNKLG  219

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            LEKYEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILDQ+ R+ +  R
Sbjct  220  LEKYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDAELVR  270



>ref|XP_010519579.1| PREDICTED: uncharacterized protein LOC104798993 [Tarenaya hassleriana]
Length=261

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 179/230 (78%), Gaps = 10/230 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ EL SG K+WLSKQSLPVEAA V+A S  QG  IG ++G LSP++     P + LDP 
Sbjct  35   KFKELESGFKSWLSKQSLPVEAAIVSAMSGVQGAFIGGLMGTLSPEM-----PQSGLDPQ  89

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            A A+F QAQAL GGPLVQARNFA +TGVNAGI+C++KR+RGKED++S++ AA GSGV YS
Sbjct  90   ATASFKQAQALVGGPLVQARNFAAITGVNAGIACIMKRLRGKEDLESAVVAALGSGVAYS  149

Query  416  LV-SGMGGPDVVPA-ALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            LV SG+ G    PA A+++   FAL QG  FKLG++FS+P AED  Y + RS+L  LGLE
Sbjct  150  LVSSGLQGQ---PANAISTAAGFALFQGLFFKLGERFSKPTAEDPYYTRARSMLLKLGLE  206

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            KYEKNFK+GLLTD+TLPLLTDSAL+DV+IP GPRLLILD V R+P+ + +
Sbjct  207  KYEKNFKKGLLTDSTLPLLTDSALRDVNIPSGPRLLILDHVQRDPELKSR  256



>dbj|BAJ87822.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 176/229 (77%), Gaps = 10/229 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD-----LQPTPPPGA  612
            +   L +G +AW++KQ + VEAA  TA  A QGG +G ++G+++ D     + P PP   
Sbjct  27   RVRALEAGFRAWMAKQPVHVEAAVTTAVGAVQGGALGGLMGSITADGGAPWVPPLPP---  83

Query  611  NLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGS  432
            N +P AMA+F QAQAL  GPLVQARNFAVM+G NAGISCV++R+RG ED+Q SMAAAFGS
Sbjct  84   NANPQAMASFKQAQALAAGPLVQARNFAVMSGTNAGISCVMRRIRGVEDIQGSMAAAFGS  143

Query  431  GVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPP--AEDMQYVKTRSLLS  258
            GV++SLVSGMG P+ V +A+TSGV FA+ QGG F +GQ+FS+P   +E   Y KT S+L 
Sbjct  144  GVIFSLVSGMGTPNPVASAITSGVGFAVFQGGFFMIGQRFSKPEGVSETNYYAKTSSMLQ  203

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRN  111
             LGLEKYEKNFK+GLLTD TLPLLTDSALKDV IPPGPRL+ILDQ+ R+
Sbjct  204  NLGLEKYEKNFKKGLLTDHTLPLLTDSALKDVKIPPGPRLIILDQIKRD  252



>gb|AAM65866.1| unknown [Arabidopsis thaliana]
Length=246

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 174/229 (76%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K+WLSKQ LPVEAA VTA    QG  IG ++G LSP++     P A +DP 
Sbjct  20   KFKEIETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM-----PQAGIDPQ  74

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++ AAFGSGV YS
Sbjct  75   AMASLKQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAAFGSGVAYS  134

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y + RS+L  LGLEK
Sbjct  135  LVSAGLQGQPM--NAITTAAGFAVFQGVFFKLGERFSKPSVEDPYYTRGRSMLLKLGLEK  192

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  193  YEKNFKKGLLADPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPELKGK  241



>ref|XP_004975522.1| PREDICTED: uncharacterized protein LOC101781948 isoform X1 [Setaria 
italica]
Length=296

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 173/225 (77%), Gaps = 3/225 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +G++AWL+KQ   VEAA  TA  A QG  +G ++G L+PD     P PPP    
Sbjct  40   RVRSLEAGLRAWLAKQPTHVEAAVSTAVGAVQGAALGGLMGTLAPDGGAALPVPPPPLGA  99

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP A+A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RGKEDVQ SMAAAFGSG 
Sbjct  100  DPKALASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGKEDVQGSMAAAFGSGA  159

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQP +ED  Y + RS+L  LGL
Sbjct  160  LFSIVSGMGTPNPVTNAITTGVAFAVFQGGFFMIGQKFSQPQSEDTYYSRGRSMLQTLGL  219

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRN  111
            + YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+
Sbjct  220  QNYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDHIKRS  264



>ref|XP_006441308.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
 gb|ESR54548.1| hypothetical protein CICLE_v10021773mg [Citrus clementina]
Length=258

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 174/226 (77%), Gaps = 6/226 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF---SQPPAEDMQYVKTRSLLSG  255
             +SLVSGMGG +    A TSG+ FA+ QG  FK+G+ +    +P A+D+ Y +TR +L  
Sbjct  145  AFSLVSGMGGANPAANAFTSGLLFAIFQGCSFKIGEMWQSTQRPTADDVYYARTRGMLDK  204

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH  117
            LGL+ Y KNFKRGLLTD+TLPLLTDSAL+DV IPPGPRLLILD + 
Sbjct  205  LGLQNYTKNFKRGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQ  250



>ref|XP_006286543.1| hypothetical protein CARUB_v10001771mg [Capsella rubella]
 gb|EOA19441.1| hypothetical protein CARUB_v10001771mg [Capsella rubella]
Length=257

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 173/229 (76%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K+WLSKQ LPVEAA VTA    QG  IG ++G LSP++     P A +DP 
Sbjct  32   KFKEVETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM-----PQAGVDPQ  86

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++ AAFGSGV YS
Sbjct  87   AMASLKQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAAFGSGVAYS  146

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FAL QG  FKLGQ+FS+P  ED  Y + RS+L  LGLEK
Sbjct  147  LVSAGLQGQPM--NAITTAAGFALFQGVFFKLGQRFSKPSVEDPFYTRGRSMLLKLGLEK  204

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D TLPLLTDSALKD SIPPGPRLLILD + R+P+ + K
Sbjct  205  YEKNFKKGLLADPTLPLLTDSALKDASIPPGPRLLILDHIQRDPELKGK  253



>ref|NP_197853.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
 dbj|BAB11217.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL50076.1| AT5g24650/K18P6_19 [Arabidopsis thaliana]
 gb|AAM98312.1| At5g24650/K18P6_19 [Arabidopsis thaliana]
 gb|ABD64056.1| At5g24650 [Arabidopsis thaliana]
 gb|AED93344.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=259

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 174/229 (76%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K+WLSKQ LPVEAA VTA    QG  IG ++G LSP++     P A +DP 
Sbjct  33   KFKEIETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM-----PQAGIDPQ  87

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++ AAFGSGV YS
Sbjct  88   AMASLKQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAAFGSGVAYS  147

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y + RS+L  LGLEK
Sbjct  148  LVSAGLQGQPM--NAITTAAGFAVFQGVFFKLGERFSKPSVEDPYYTRGRSMLLKLGLEK  205

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  206  YEKNFKKGLLADPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPELKGK  254



>gb|AGT17334.1| SAM domain family protein [Saccharum hybrid cultivar R570]
Length=270

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 177/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P  N 
Sbjct  39   RVKAIEAGFRAWMAKQPIHIEAAVATAVGAVQGGALGGLMGSLTADGGSPFPMPQPPPNA  98

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGIS V++R+RG+ED+Q SMAAAFGSG 
Sbjct  99   NPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISSVMRRIRGQEDIQGSMAAAFGSGA  158

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSG+G P+ V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +TRS+L  LGL
Sbjct  159  LFSIVSGVGTPNPVVNAITTGVAFAVFQGGFFMIGQKFSKPPSEDTCYSRTRSMLHKLGL  218

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            EKYE NFKRGLL D TLPLLTDSAL+DV IPPGPRLLILD++ R+ +  R
Sbjct  219  EKYENNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDKIKRDRELVR  268



>gb|KDO44882.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=254

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 174/226 (77%), Gaps = 6/226 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF---SQPPAEDMQYVKTRSLLSG  255
             +SLVSGMGG +    A TSG+ FA+ QG  FK+G+ +    +P A+D+ Y +TR +L  
Sbjct  145  AFSLVSGMGGANPAVNAFTSGLLFAIFQGCSFKIGEMWQSTQRPTADDVYYARTRGMLDK  204

Query  254  LGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH  117
            LGL+ Y KNFKRGLLTD+TLPLLTDSAL+DV IPPGPRLLILD + 
Sbjct  205  LGLQNYTKNFKRGLLTDSTLPLLTDSALRDVRIPPGPRLLILDHIQ  250



>ref|XP_010454784.1| PREDICTED: uncharacterized protein LOC104736487 [Camelina sativa]
Length=258

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 175/229 (76%), Gaps = 7/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +GVK+WLSKQ LPVEAA VTA    QG  IG ++G LSP++    P    +DP 
Sbjct  32   KFKEVETGVKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM----PQAGGVDPQ  87

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++AAAFGSGV YS
Sbjct  88   AMASLKQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVAAAFGSGVAYS  147

Query  416  LV-SGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LV SG+ G  +   A+T+   FAL QG  FKLG++F++P  ED  Y + RS+L  LGLEK
Sbjct  148  LVSSGLQGQPM--NAITTAAGFALFQGVFFKLGERFTKPSVEDPYYNQGRSMLLKLGLEK  205

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D TLPLLTDSALK+VSIPPGPRLLILD + R+P+ + K
Sbjct  206  YEKNFKKGLLADPTLPLLTDSALKEVSIPPGPRLLILDHIQRDPELKGK  254



>ref|XP_004952616.1| PREDICTED: uncharacterized protein LOC101769651 isoform X1 [Setaria 
italica]
Length=282

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 175/225 (78%), Gaps = 4/225 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   + +G +AW++KQ + +EAA  TA  A QGG +G ++G+LS D     P P P  N 
Sbjct  40   RVKAIEAGFRAWMAKQPIHIEAAVTTAVGAVQGGALGGLMGSLSADGGSPFPMPQPPPNA  99

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG+ED+Q SMAAAFGSGV
Sbjct  100  NPDAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGQEDIQGSMAAAFGSGV  159

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFS-QPPAEDMQYVKTRSLLSGLG  249
            ++S+VSGMG P+    A+T+G  FA+ QGG F +GQ+FS Q   ED  Y +TRS+L+ LG
Sbjct  160  LFSIVSGMGTPNPAVNAITTGAAFAVFQGGFFMIGQKFSKQQGGEDTYYSQTRSMLNKLG  219

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
            LEKYEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILDQ+ R
Sbjct  220  LEKYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDQIKR  264



>emb|CDX80460.1| BnaC07g29840D [Brassica napus]
Length=260

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 172/229 (75%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E  +G K+WLSKQ LPVEAA VTA    QG  IG ++G LSP++     P   +DP 
Sbjct  34   KFKEAETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM-----PQTGVDPQ  88

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++ AAFGSGV YS
Sbjct  89   AMASLQQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAAFGSGVAYS  148

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   F+L QG  FKLG++FS+P  ED  Y + RS+L  LGLEK
Sbjct  149  LVSAGLQGQPM--NAITTAAGFSLFQGIFFKLGERFSKPSVEDPYYTRARSMLLKLGLEK  206

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D TLPLLTDSALKDVSIPPGPRLLILD + R+P+ + K
Sbjct  207  YEKNFKKGLLADPTLPLLTDSALKDVSIPPGPRLLILDHIQRDPELKGK  255



>ref|XP_010421304.1| PREDICTED: uncharacterized protein LOC104706780 [Camelina sativa]
Length=258

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 174/229 (76%), Gaps = 7/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +GVK+WLSKQ LPVEAA VTA    QG  IG ++G LSP++    P    +DP 
Sbjct  32   KFKEIETGVKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM----PQAGGVDPQ  87

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++AAAFGSGV YS
Sbjct  88   AMASLKQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVAAAFGSGVAYS  147

Query  416  LV-SGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LV SG+ G  +   A+T+   FAL QG  FKLG++F++P  ED  Y + RS+L  LGLEK
Sbjct  148  LVSSGLQGQPM--NAITTAAGFALFQGVFFKLGERFTKPSVEDPYYNQGRSMLLKLGLEK  205

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YE+NFK+GLL D TLPLLTDSALKD SIPPGPRLLILD + R+P+ + K
Sbjct  206  YEQNFKKGLLADPTLPLLTDSALKDASIPPGPRLLILDHIQRDPELKGK  254



>ref|XP_003575054.1| PREDICTED: uncharacterized protein LOC100840753 [Brachypodium 
distachyon]
Length=256

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 178/228 (78%), Gaps = 5/228 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +G +AW++KQ + +EAA  TA  A QGG +G ++G+L+ D     P PPP AN 
Sbjct  23   RVKALEAGFRAWMAKQPIYIEAAVTTAVGAVQGGALGGLMGSLTADAGSPFPVPPPPANA  82

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG ED+Q SMAAAFGSG 
Sbjct  83   NPQAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGAEDIQGSMAAAFGSGA  142

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF--SQPPAEDMQYVKTRSLLSGL  252
            ++SLVSGMG P+ V +A+TSGV FA+ QGG F +GQ+F  SQ  +ED  Y  TRS+L  L
Sbjct  143  LFSLVSGMGTPNPVASAITSGVAFAIFQGGFFMIGQKFTKSQSVSEDTYYSSTRSMLQKL  202

Query  251  GLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNP  108
            GL+KYEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P
Sbjct  203  GLQKYEKNFKKGLLTDHTLPLLTDSALRDVKIPPGPRLLILDQIKRDP  250



>dbj|BAJ88716.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 172/230 (75%), Gaps = 9/230 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD-----LQPTPPPGA  612
            ++  L  GV+ W++KQ   +EAA  TA  A QGG +G ++G  +P+       P PPPG 
Sbjct  39   RFRSLEVGVREWMAKQPTHIEAAVTTAFGAVQGGALGGLMGTFAPEGGAGLPVPQPPPG-  97

Query  611  NLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGS  432
             LDP AMATF QAQAL GGPLVQARNFAVMTG NAGISCV++RVRG ED+Q SM AAFGS
Sbjct  98   -LDPKAMATFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRVRGVEDLQGSMTAAFGS  156

Query  431  GVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA--EDMQYVKTRSLLS  258
            G ++S+VSGMG P+ V  A+T+G+ FA+ QGG F +GQ+FS+     EDM Y + R++L+
Sbjct  157  GALFSIVSGMGTPNPVVNAITTGMAFAVFQGGFFIVGQKFSKTKTHNEDMNYSRGRNMLN  216

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNP  108
             LGL+ YEKNFK+GLLTD TLPLL +SAL+DV+IPPGPRL+ILD + R P
Sbjct  217  QLGLQNYEKNFKKGLLTDETLPLLNESALRDVNIPPGPRLVILDHIKREP  266



>gb|EEE60938.1| hypothetical protein OsJ_14687 [Oryza sativa Japonica Group]
Length=271

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 177/235 (75%), Gaps = 8/235 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P P P    
Sbjct  35   RVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFPVPQPPPGA  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQ-----SSMAAA  441
            DPNA+A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ      SMAAA
Sbjct  95   DPNALASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSAHFDSMAAA  154

Query  440  FGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLL  261
            FGSG ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQPP+ED+ Y + R++L
Sbjct  155  FGSGALFSIVSGMGSPNPVANAITTGVAFAVFQGGFFMIGQKFSQPPSEDIYYSRGRNML  214

Query  260  SGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
              LGL+ YEKNFK+GLLTD TLPLL DSAL+DV IPPGPRLLILD + R+P+  +
Sbjct  215  KQLGLQNYEKNFKKGLLTDQTLPLLNDSALRDVKIPPGPRLLILDHIQRDPELTK  269



>gb|ADE77803.1| unknown [Picea sitchensis]
Length=194

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -2

Query  659  LGNLSPDLQPTPPPGAN-LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKR  483
            +G L+ D+  T P   N ++P AMA+  QAQA TGGPL+QARNFAVMTGVNAGI+C +KR
Sbjct  1    MGTLTSDISSTLPTQPNGVNPQAMASLKQAQAFTGGPLLQARNFAVMTGVNAGITCAMKR  60

Query  482  VRGK-EDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQ  306
            +RG  EDVQ+SM AAFGSG M+SLVSGMGGP+    A+TSG+FFALVQGGLFKLGQ+FSQ
Sbjct  61   LRGGVEDVQTSMVAAFGSGAMFSLVSGMGGPNQAANAVTSGLFFALVQGGLFKLGQKFSQ  120

Query  305  PPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILD  126
            P  E+  YVKT+S+LS LGL+ YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD
Sbjct  121  PSTEENYYVKTKSMLSKLGLQNYEKNFKKGLLTDNTLPLLTDSALRDVKIPPGPRLLILD  180

Query  125  QVHRNPDFRRK  93
             + R+P+   K
Sbjct  181  HIQRDPEAEWK  191



>gb|ACF86230.1| unknown [Zea mays]
Length=220

 Score =   239 bits (609),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 169/218 (78%), Gaps = 3/218 (1%)
 Frame = -2

Query  740  LSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANLDPNAMATFNQAQ  570
            ++KQ + +EAA  TA  A QGG +G ++G+L+ D     P P P +N + +AMA+F QAQ
Sbjct  1    MAKQPIHIEAAVSTAVGAVQGGALGGLMGSLTADGGSPFPIPQPPSNANSDAMASFKQAQ  60

Query  569  ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD  390
            AL  GPLVQARNFAVMTG NAGISCV++R+RG+ED+Q SM AAFGSG ++S+VSGMG P+
Sbjct  61   ALAAGPLVQARNFAVMTGANAGISCVMRRLRGQEDIQGSMTAAFGSGALFSIVSGMGTPN  120

Query  389  VVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGll  210
             V  A+T+GV FA+ QGG F +GQ+FS+P +ED  Y  TRS+L  LGLEKYEKNF++GLL
Sbjct  121  PVLNAITTGVAFAVFQGGFFMIGQKFSKPSSEDTYYSLTRSMLHKLGLEKYEKNFRKGLL  180

Query  209  tdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
             D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P   R
Sbjct  181  NDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPGLVR  218



>gb|KJB37431.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=238

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 150/190 (79%), Gaps = 4/190 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ E+  G KAWL KQS+PVEAA VTA  A QG  IGA++G L+ D+    PTPP  A+L
Sbjct  28   KFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAAIGALMGTLTKDVSSSFPTPPQ-ASL  86

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +  AMA+  QAQAL+G P VQARNFAVMTGVNAG++CV+KR+RGKEDVQSSM AAFGSG 
Sbjct  87   NHQAMASLKQAQALSGAPWVQARNFAVMTGVNAGLACVMKRLRGKEDVQSSMVAAFGSGA  146

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            M+SLVSGMGGP+    A+TSG+FFAL+QG LF+ GQ+ SQP  EDM Y +TRS+L+ LGL
Sbjct  147  MFSLVSGMGGPNQAANAVTSGLFFALIQGVLFQFGQKLSQPAVEDMYYSRTRSMLNSLGL  206

Query  245  EKYEKNFKRG  216
            + YEKNFK+G
Sbjct  207  QNYEKNFKKG  216



>ref|XP_008811010.1| PREDICTED: uncharacterized protein LOC103722289 isoform X2 [Phoenix 
dactylifera]
Length=238

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 166/232 (72%), Gaps = 25/232 (11%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGA----N  609
            ++ EL  G +AWL++QS+PVEAA VTA SAAQG  IG ++G L+ DL    P        
Sbjct  25   RFKELEGGFRAWLARQSMPVEAAVVTATSAAQGAAIGGLMGTLTSDLTSAFPAPPPQAAG  84

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
            L P AM++  QAQA  GGPLVQARNFAVMTGVNAGISCV+KR+RG EDVQSSM AAFGSG
Sbjct  85   LSPQAMSSLKQAQAFAGGPLVQARNFAVMTGVNAGISCVMKRIRGVEDVQSSMVAAFGSG  144

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++SLVSGMGGP+    A+TSG+FFA+VQGGLFKLGQ+FSQPPAED+ Y + RS+L+ LG
Sbjct  145  ALFSLVSGMGGPNQAANAVTSGLFFAVVQGGLFKLGQKFSQPPAEDVYYSRARSMLTSLG  204

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L+ YEKNFK+GL             L D ++P     L+ D   RNP+F RK
Sbjct  205  LQNYEKNFKKGL-------------LTDSTLP-----LLTD---RNPEFVRK  235



>ref|XP_009150989.1| PREDICTED: uncharacterized protein LOC103874331 [Brassica rapa]
Length=263

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 171/229 (75%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E   G K+WLSKQ LPVEAA VTA    QG  IG ++G LSP++     P   +DP 
Sbjct  37   KFKEAEIGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM-----PQTGVDPQ  91

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++ AAFGSGV YS
Sbjct  92   AMASLQQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAAFGSGVAYS  151

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   F+L QG  FKLG++FS+P  ED  Y + RS+L  LGLEK
Sbjct  152  LVSAGLQGQPM--NAITTAAGFSLFQGIFFKLGERFSKPTVEDPYYTRARSMLLKLGLEK  209

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D TLPLLTDSALKDVSIPPGPRLLILD + R+P+ + K
Sbjct  210  YEKNFKKGLLADPTLPLLTDSALKDVSIPPGPRLLILDHIQRDPELKGK  258



>ref|XP_006394720.1| hypothetical protein EUTSA_v10004788mg [Eutrema salsugineum]
 gb|ESQ32006.1| hypothetical protein EUTSA_v10004788mg [Eutrema salsugineum]
Length=261

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 173/229 (76%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K+WLSKQ LPVEAA VTA    QG  IG ++G LSP++     P + +DP 
Sbjct  35   KFKEVETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM-----PQSGMDPQ  89

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+C++KR+RGKED++S++ AA GSGV YS
Sbjct  90   AMASLKQTQALVGGPLVQARNFAAITGVNAGIACIMKRIRGKEDLESAVVAALGSGVAYS  149

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FAL QG  FKLG++FS+P  ED  Y + RS+L  LGLEK
Sbjct  150  LVSAGLQGQPM--NAITTAGGFALFQGIFFKLGERFSKPSIEDPYYTRARSMLLKLGLEK  207

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLL D TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  208  YEKNFKKGLLADPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPELKGK  256



>emb|CDM80696.1| unnamed protein product [Triticum aestivum]
Length=262

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 177/232 (76%), Gaps = 12/232 (5%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD-----LQPTPPPGA  612
            +   + +G +AW++KQ + VEAA  TAA A QGG +G ++G+++ D     + P PP   
Sbjct  28   RVRAIEAGFRAWMAKQPIHVEAAVTTAAGAVQGGALGGLMGSITADGGASWVPPLPP---  84

Query  611  NLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGS  432
            N DP AMA+F QAQAL  GPLVQARNFAVM+G NAGISCV++R+RG ED+Q SMAAAFGS
Sbjct  85   NADPQAMASFKQAQALAAGPLVQARNFAVMSGTNAGISCVMRRIRGVEDIQGSMAAAFGS  144

Query  431  GVMYSLVSGMG--GPDVVPAALTSGVFFALVQGGLFKLGQQFSQPP--AEDMQYVKTRSL  264
            GV++SLVSGMG   P+ V +A+TSGV FA+ QGG F +GQ+FS+P   +E   Y +T S+
Sbjct  145  GVLFSLVSGMGTPTPNPVASAITSGVGFAVFQGGFFMIGQRFSKPQGVSEPNYYARTSSM  204

Query  263  LSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNP  108
            L  LGLEKYEKNF++G LTD TLPLLTDSALKDV IPPGPRL+ILDQ+ R+P
Sbjct  205  LQNLGLEKYEKNFRKGHLTDHTLPLLTDSALKDVKIPPGPRLIILDQIKRDP  256



>gb|KFK27737.1| hypothetical protein AALP_AA8G422900 [Arabis alpina]
Length=261

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 171/230 (74%), Gaps = 10/230 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K+WLSKQ+LPVEA+ V A    QG  IG ++G LSP++     P + +DP 
Sbjct  35   KFKEVETGFKSWLSKQTLPVEASVVAAMGGVQGAFIGGLMGTLSPEM-----PQSGIDPQ  89

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  Q QAL GGPLVQARNFA +TGVNAGI+C++KR+RGK+D++S++ AA GSGV YS
Sbjct  90   AMASLKQTQALVGGPLVQARNFAAITGVNAGIACIMKRIRGKDDLESAVVAALGSGVAYS  149

Query  416  LVSG--MGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            LVS    G P     A+T+   FAL QG  FKLG++FS+P  ED  Y + RS+L  LGLE
Sbjct  150  LVSAGLQGQPG---NAITTAAGFALFQGVFFKLGERFSKPSVEDPYYSRARSMLLKLGLE  206

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            KYEKNFK+GLL D TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  207  KYEKNFKKGLLADPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPELKGK  256



>emb|CAE05370.1| OJ000315_02.15 [Oryza sativa Japonica Group]
Length=275

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 173/229 (76%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P P P    
Sbjct  35   RVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFPVPQPPPGA  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQ-----SSMAAA  441
            DPNA+A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ      SMAAA
Sbjct  95   DPNALASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSAHFDSMAAA  154

Query  440  FGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLL  261
            FGSG ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQPP+ED+ Y + R++L
Sbjct  155  FGSGALFSIVSGMGSPNPVANAITTGVAFAVFQGGFFMIGQKFSQPPSEDIYYSRGRNML  214

Query  260  SGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
              LGL+ YEKNFK+GLLTD TLPLL DSAL+DV IPPGPRLLILD + R
Sbjct  215  KQLGLQNYEKNFKKGLLTDQTLPLLNDSALRDVKIPPGPRLLILDHIQR  263



>ref|NP_001052708.1| Os04g0405100 [Oryza sativa Japonica Group]
 dbj|BAF14622.1| Os04g0405100 [Oryza sativa Japonica Group]
Length=307

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 173/229 (76%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +G++AWL+KQ   VEAA  TA  A QGG +G ++G L+PD     P P P    
Sbjct  35   RVKTLEAGLRAWLAKQPTHVEAAVATAVGAVQGGALGGLMGTLAPDGGSPFPVPQPPPGA  94

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQ-----SSMAAA  441
            DPNA+A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ      SMAAA
Sbjct  95   DPNALASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSAHFDSMAAA  154

Query  440  FGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLL  261
            FGSG ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQPP+ED+ Y + R++L
Sbjct  155  FGSGALFSIVSGMGSPNPVANAITTGVAFAVFQGGFFMIGQKFSQPPSEDIYYSRGRNML  214

Query  260  SGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
              LGL+ YEKNFK+GLLTD TLPLL DSAL+DV IPPGPRLLILD + R
Sbjct  215  KQLGLQNYEKNFKKGLLTDQTLPLLNDSALRDVKIPPGPRLLILDHIQR  263



>ref|XP_002447764.1| hypothetical protein SORBIDRAFT_06g015230 [Sorghum bicolor]
 gb|EES12092.1| hypothetical protein SORBIDRAFT_06g015230 [Sorghum bicolor]
Length=272

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 174/230 (76%), Gaps = 3/230 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD---LQPTPPPGANL  606
            +   L +GV+AWL+KQ   VEAA VT A A QG  +G ++G L+PD     P PPP    
Sbjct  41   RVRSLEAGVRAWLAKQPTHVEAAVVTVAGAVQGAALGGLMGTLAPDGGAALPVPPPPPGA  100

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP  +A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ SMAAAFGSG 
Sbjct  101  DPKVLASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSMAAAFGSGA  160

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
            ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FSQP +ED  Y + RS+L  LGL
Sbjct  161  LFSIVSGMGTPNPVANAITTGVAFAVFQGGFFMIGQKFSQPKSEDTYYSRGRSMLQKLGL  220

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            + YEKNFK+GLLTD TL LLTDSAL+DV IPPGPRLLILD + R+P+  R
Sbjct  221  QNYEKNFKKGLLTDQTLGLLTDSALRDVKIPPGPRLLILDHIKRDPELTR  270



>ref|XP_006648683.1| PREDICTED: uncharacterized protein LOC102705050 [Oryza brachyantha]
Length=258

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 175/231 (76%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGV-IGAILGNLSPD---LQPTPPPGAN  609
            +   L +G + W+++Q   +EAA V AA  A  G  +G ++G L+ D     P P P  N
Sbjct  26   RVKALEAGFRKWMAEQPTHIEAAVVPAAVGAVQGAALGGLMGTLTADGGSPFPVPQPPPN  85

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
             +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG ED+Q SMAAAFGSG
Sbjct  86   ANPEAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGGEDIQGSMAAAFGSG  145

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++S+VSGMG P+ V  A+T+G  FA+ QGG F +GQ+FS+P +ED+ Y + RS+L  LG
Sbjct  146  ALFSIVSGMGTPNPVANAITTGAAFAIFQGGFFMIGQKFSKPQSEDLYYSRARSMLQKLG  205

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            LEKYEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+F +
Sbjct  206  LEKYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPEFAK  256



>emb|CDY69408.1| BnaAnng30370D [Brassica napus]
 emb|CDX88122.1| BnaA06g27130D [Brassica napus]
Length=252

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 167/220 (76%), Gaps = 8/220 (4%)
 Frame = -2

Query  749  KAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQ  570
            ++WLSKQ LPVEAA VTA    QG  IG ++G LSP++     P   +DP AMA+  Q Q
Sbjct  35   QSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTLSPEM-----PQTGVDPQAMASLQQTQ  89

Query  569  ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVS-GMGGP  393
            AL GGPLVQARNFA +TGVNAGI+CV+KR+RGKED++S++ AAFGSGV YSLVS G+ G 
Sbjct  90   ALVGGPLVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAAFGSGVAYSLVSAGLQGQ  149

Query  392  DVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGl  213
             +   A+T+   F+L QG  FKLG++FS+P  ED  Y + RS+L  LGLEKYEKNFK+GL
Sbjct  150  PM--NAITTAAGFSLFQGIFFKLGERFSKPTVEDPYYTRARSMLLKLGLEKYEKNFKKGL  207

Query  212  ltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L D TLPLLTDSALKDVSIPPGPRLLILD + R+P+ + K
Sbjct  208  LADPTLPLLTDSALKDVSIPPGPRLLILDHIQRDPELKGK  247



>ref|XP_009149730.1| PREDICTED: uncharacterized protein LOC103873049 [Brassica rapa]
Length=257

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 172/229 (75%), Gaps = 10/229 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+  G+K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++  T       DP 
Sbjct  35   KFKEVEVGLKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEMPQT-------DPQ  87

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  QAQAL GGP VQARNFA +TGVNAGI+CV+KR+RGKED++S++ AA GSG  YS
Sbjct  88   AMASMKQAQALVGGPWVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAALGSGFAYS  147

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y ++R++L  LGL+K
Sbjct  148  LVSQGLQGQPI--NAITTAAGFAVFQGIFFKLGERFSKPSPEDPFYTRSRTMLLKLGLQK  205

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTD TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  206  YEKNFKKGLLTDPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPEIKGK  254



>gb|ACF84635.1| unknown [Zea mays]
Length=257

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 172/236 (73%), Gaps = 15/236 (6%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANL---  606
            +   L +GV+AWL+KQ   VEAA VTA  A QG  +G ++G L+PD       GA L   
Sbjct  26   RVRSLEAGVRAWLAKQPTHVEAAVVTAVGAVQGAALGGLMGTLAPD------GGAALPVP  79

Query  605  ------DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAA  444
                  DP  +A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ SMAA
Sbjct  80   PPPPGTDPKVLASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSMAA  139

Query  443  AFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSL  264
            AFGSG ++S+VSGMG P+ V  A+T+GV FA+ QGG F + Q+FSQP + D  Y + RS+
Sbjct  140  AFGSGALFSIVSGMGTPNPVANAITTGVGFAVFQGGFFMISQKFSQPQSGDTYYSRGRSM  199

Query  263  LSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            L  LGL+ YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+  +
Sbjct  200  LQKLGLQNYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDHIKRDPELTK  255



>tpg|DAA37984.1| TPA: SAM domain protein [Zea mays]
Length=270

 Score =   233 bits (594),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 172/236 (73%), Gaps = 15/236 (6%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANL---  606
            +   L +GV+AWL+KQ   VEAA VTA  A QG  +G ++G L+PD       GA L   
Sbjct  39   RVRSLEAGVRAWLAKQPTHVEAAVVTAVGAVQGAALGGLMGTLAPD------GGAALPVP  92

Query  605  ------DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAA  444
                  DP  +A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ SMAA
Sbjct  93   PPPPGTDPKVLASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSMAA  152

Query  443  AFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSL  264
            AFGSG ++S+VSGMG P+ V  A+T+GV FA+ QGG F + Q+FSQP + D  Y + RS+
Sbjct  153  AFGSGALFSIVSGMGTPNPVANAITTGVGFAVFQGGFFMISQKFSQPQSGDTYYSRGRSM  212

Query  263  LSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            L  LGL+ YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+  +
Sbjct  213  LQKLGLQNYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDHIKRDPELTK  268



>gb|EEC73300.1| hypothetical protein OsI_07469 [Oryza sativa Indica Group]
 gb|EEE57110.1| hypothetical protein OsJ_06971 [Oryza sativa Japonica Group]
Length=262

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 170/225 (76%), Gaps = 4/225 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD----LQPTPPPGAN  609
            +   L +G + W+++Q   +EAA  TA  A QG  +G ++G L+ D        PPP  N
Sbjct  26   RVKALEAGFRKWMAEQPTHIEAAVTTAVGAVQGAALGGLMGTLTADGGSPFPTPPPPPPN  85

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
             +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG ED+Q SMAAAFGSG
Sbjct  86   ANPQAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGGEDIQGSMAAAFGSG  145

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++S+VSGMG P+ V  A+T+G  FA+ QGG F +GQ+FS+P +ED+ Y + RS+L  LG
Sbjct  146  ALFSIVSGMGTPNPVANAITTGAAFAIFQGGFFMIGQKFSKPQSEDLYYSRARSMLQKLG  205

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
            LEKYEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILDQ+ R
Sbjct  206  LEKYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDQIKR  250



>ref|XP_010515307.1| PREDICTED: uncharacterized protein LOC104791180 [Camelina sativa]
Length=267

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 171/229 (75%), Gaps = 7/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    P    +DP 
Sbjct  43   KFKEVETGFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----PQAGGVDPQ  98

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            A+A+  QAQAL GGP VQARNFA +TGVNAGI+ V+KR+RGKED++S++ AA GSG  YS
Sbjct  99   AIASMKQAQALVGGPWVQARNFAAITGVNAGIASVMKRIRGKEDIESAVVAALGSGFAYS  158

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y + R++L  LGLEK
Sbjct  159  LVSQGLQGQPM--NAITTAAGFAVFQGIFFKLGERFSKPSVEDPFYTRGRTMLVQLGLEK  216

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTD TLPLLTDSAL+DVSIPPGPRL+ILD + R+P+ + K
Sbjct  217  YEKNFKKGLLTDPTLPLLTDSALRDVSIPPGPRLMILDHIQRDPEIKGK  265



>gb|EMT12140.1| hypothetical protein F775_16456 [Aegilops tauschii]
Length=221

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 169/218 (78%), Gaps = 10/218 (5%)
 Frame = -2

Query  740  LSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD-----LQPTPPPGANLDPNAMATFNQ  576
            ++KQ + VEAA  TAA A QGG +G ++G+++ D     + P PP   N +P AMA+F Q
Sbjct  1    MAKQPIHVEAAVTTAAGAVQGGALGGLMGSITADGGAPWVPPLPP---NANPQAMASFKQ  57

Query  575  AQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGG  396
            AQAL  GPLVQARNFAVM+G NAGISCV++R+RG +D+Q SM AAFGSGV++SLVSGMG 
Sbjct  58   AQALAAGPLVQARNFAVMSGTNAGISCVMRRIRGVDDIQGSMTAAFGSGVLFSLVSGMGT  117

Query  395  PDVVPAALTSGVFFALVQGGLFKLGQQFSQPP--AEDMQYVKTRSLLSGLGLEKYEKNFK  222
            P+ V  A+TSGV FA+ QGG F +GQ+FS+P   +E   Y +T S+L  LGLEKYEKNF+
Sbjct  118  PNPVANAITSGVGFAVFQGGFFMIGQRFSKPQGVSEHNYYARTSSMLQNLGLEKYEKNFR  177

Query  221  RGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNP  108
            +GLLTD TLPLLTDSALKDV IPPGPRL+ILDQ+ R+P
Sbjct  178  KGLLTDHTLPLLTDSALKDVKIPPGPRLIILDQIKRDP  215



>ref|XP_002875975.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52234.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 170/229 (74%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +  K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++     P A +DP 
Sbjct  37   KFKEVETNFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM-----PQAGVDPQ  91

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            A+A+  QAQAL GGP VQARNFA +TGVNAGI+ V+KR+RGKED++S++ AA GSG  YS
Sbjct  92   AIASLKQAQALVGGPWVQARNFAAITGVNAGIASVMKRIRGKEDIESAVVAALGSGFAYS  151

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y + R++L  LGLEK
Sbjct  152  LVSQGLQGQPM--NAITTAAGFAVFQGVFFKLGERFSKPSTEDPFYTRGRTMLVKLGLEK  209

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTD TLPLLTDSALKD +IPPGPRL+ILD + R+P+ + K
Sbjct  210  YEKNFKKGLLTDPTLPLLTDSALKDANIPPGPRLMILDHIQRDPEIKGK  258



>ref|XP_010503618.1| PREDICTED: uncharacterized protein LOC104780778 [Camelina sativa]
Length=265

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 170/229 (74%), Gaps = 7/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    P    +D  
Sbjct  41   KFKEVETGFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM----PQAGGVDLQ  96

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            A+A+  QAQAL GGP VQARNFA +TGVNAGI+ V+KR+RGKED++S++ AA GSG  YS
Sbjct  97   AIASMKQAQALVGGPWVQARNFAAITGVNAGIASVMKRIRGKEDIESAVVAALGSGFAYS  156

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y + R++L  LGLEK
Sbjct  157  LVSQGLQGQPM--NAITTAAGFAVFQGIFFKLGERFSKPSVEDPFYTRGRTMLLQLGLEK  214

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTD TLPLLTDSAL+DVSIPPGPRL+ILD + R+P+ + K
Sbjct  215  YEKNFKKGLLTDPTLPLLTDSALRDVSIPPGPRLMILDHIQRDPEIKGK  263



>emb|CDY08145.1| BnaA06g15810D [Brassica napus]
Length=263

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 172/235 (73%), Gaps = 16/235 (7%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+  G+K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++  T       DP 
Sbjct  35   KFKEVEVGLKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEMPQT-------DPQ  87

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  QAQAL GGP VQARNFA +TGVNAGI+CV+KR+RGKED++S++ AA GSG  YS
Sbjct  88   AMASMKQAQALVGGPWVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAALGSGFAYS  147

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFK------LGQQFSQPPAEDMQYVKTRSLLS  258
            LVS G+ G  +   A+T+   FA+ QG  FK      LG++FS+P  ED  Y ++R++L 
Sbjct  148  LVSQGLQGQPI--NAITTAAGFAVFQGIFFKASYIIWLGERFSKPSPEDPFYTRSRTMLL  205

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
             LGL+KYEKNFK+GLLTD TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  206  KLGLQKYEKNFKKGLLTDPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPEIKGK  260



>ref|XP_010426471.1| PREDICTED: uncharacterized protein LOC104711470 [Camelina sativa]
Length=267

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 171/230 (74%), Gaps = 8/230 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++    P    +DP 
Sbjct  42   KFKEVETGFKTWLSKQSIPVEAAVVSIMSGVQGAFIGGLMGTLSPEM----PQAGGVDPQ  97

Query  596  AMA-TFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMY  420
            A+A +  QAQAL GGP VQARNFA +TGVNAGI+ V+KR+RGKED++S++ AA GSG  Y
Sbjct  98   AIAPSMKQAQALVGGPWVQARNFAAITGVNAGIASVMKRIRGKEDIESAVVAALGSGFAY  157

Query  419  SLVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLE  243
            SLVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y + R++L  LGLE
Sbjct  158  SLVSQGLQGQPM--NAITTAAGFAVFQGIFFKLGERFSKPSVEDPFYTRGRTMLVQLGLE  215

Query  242  KYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            KYEKNFK+GLLTD TLPLLTDSAL+DVSIPPGPRL+ILD + R+P+ + K
Sbjct  216  KYEKNFKKGLLTDPTLPLLTDSALRDVSIPPGPRLMILDHIQRDPELKSK  265



>ref|NP_190525.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
 gb|AAK25901.1|AF360191_1 unknown protein [Arabidopsis thaliana]
 emb|CAB62460.1| putative protein [Arabidopsis thaliana]
 gb|AAM62775.1| unknown [Arabidopsis thaliana]
 gb|AAN71950.1| unknown protein [Arabidopsis thaliana]
 gb|ABD64055.1| At3g49560 [Arabidopsis thaliana]
 gb|AEE78557.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=261

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 170/229 (74%), Gaps = 8/229 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +  K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++     P A +DP 
Sbjct  38   KFKEVETNFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM-----PQAGVDPQ  92

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            A+A+  QAQAL GGP VQARNFA +TGVNAGI+ V+KR+RGKED++S++ AA GSG  YS
Sbjct  93   AIASMKQAQALVGGPWVQARNFAAITGVNAGIASVMKRIRGKEDIESAVVAALGSGFAYS  152

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  + + R++L  LGLEK
Sbjct  153  LVSQGLQGQPM--NAITTAAGFAVFQGVFFKLGERFSKPSTEDPFFTRGRTMLVKLGLEK  210

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTD TLPLLTDSALKD +IPPGPRL+ILD + R+P+ + K
Sbjct  211  YEKNFKKGLLTDPTLPLLTDSALKDANIPPGPRLMILDHIQRDPEIKGK  259



>gb|KFK34395.1| hypothetical protein AALP_AA5G139700 [Arabis alpina]
Length=257

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 173/229 (76%), Gaps = 11/229 (5%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ ++ SG K WLSKQSLPVEAA V+  S  QG +IG ++G LSP++     P + +DP 
Sbjct  36   KFKKVESGFKTWLSKQSLPVEAAVVSTMSGVQGALIGGLMGTLSPEM-----PQSGVDPQ  90

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AM    QAQAL GGP VQARNFA +TGVNAGI+CV+KR+RGKED++S++ AA GSG  YS
Sbjct  91   AM---KQAQALVGGPWVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAALGSGFAYS  147

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y ++R++L  LGLEK
Sbjct  148  LVSQGLQGQPM--NAITTAAGFAVFQGIFFKLGEKFSKPNPEDPFYTRSRTMLLKLGLEK  205

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            Y+KNF++GLLTD TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  206  YDKNFRKGLLTDPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPEIKGK  254



>emb|CDY05941.1| BnaC08g21180D [Brassica napus]
Length=266

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 170/235 (72%), Gaps = 16/235 (7%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+  G K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++  T       DP 
Sbjct  38   KFKEVEVGFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEMPQT-------DPQ  90

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            AMA+  QAQAL GGP VQARNFA +TGVNAGI+CV+KR+RGKED++S++ AA GSG  YS
Sbjct  91   AMASMKQAQALVGGPWVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAALGSGFAYS  150

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFK------LGQQFSQPPAEDMQYVKTRSLLS  258
            LVS G+ G  +   A+T+   FA+ QG  FK      LG++FS+P  ED  Y ++R++L 
Sbjct  151  LVSQGLQGQPI--NAITTAAGFAVFQGIFFKASYHFGLGERFSKPSPEDPFYTRSRTMLL  208

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
             LGL+KYEKNFK+GLLTD TLPLLTDSAL+DVSIPPGPRLLILD + R+P+   K
Sbjct  209  KLGLQKYEKNFKKGLLTDPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPEINGK  263



>ref|XP_006404129.1| hypothetical protein EUTSA_v10010930mg [Eutrema salsugineum]
 gb|ESQ45582.1| hypothetical protein EUTSA_v10010930mg [Eutrema salsugineum]
Length=263

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 173/232 (75%), Gaps = 11/232 (5%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+  G K WLSKQSLPVEAA V+  S  QG  IG ++G LSP++     P + +DP 
Sbjct  36   KFKEVEVGFKTWLSKQSLPVEAAVVSTMSGVQGAFIGGLMGTLSPEM-----PQSGVDPQ  90

Query  596  AMATFNQAQ---ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            AMA+ ++ +   AL GGP VQARNFA +TGVNAGI+CV+KR+RGKED++S++ AA GSG 
Sbjct  91   AMASMSKLRFHSALVGGPWVQARNFAAITGVNAGIACVMKRIRGKEDLESAVVAALGSGF  150

Query  425  MYSLVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             YSLVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED  Y ++R++L  LG
Sbjct  151  AYSLVSQGLQGQPL--NAITTAAGFAVFQGIFFKLGERFSKPSPEDPFYTRSRTMLLKLG  208

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            L+KYEKNF++GLLTD TLPLLTDSAL+DVSIPPGPRLLILD + R+P+ + K
Sbjct  209  LQKYEKNFRKGLLTDPTLPLLTDSALRDVSIPPGPRLLILDHIQRDPEIKGK  260



>ref|XP_006291697.1| hypothetical protein CARUB_v10017861mg [Capsella rubella]
 gb|EOA24595.1| hypothetical protein CARUB_v10017861mg [Capsella rubella]
Length=261

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 170/229 (74%), Gaps = 9/229 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K+ E+ +  K WLSKQS+PVEAA V+  S  QG  IG ++G LSP++     P A +DP 
Sbjct  39   KFKEVETNFKTWLSKQSIPVEAAVVSTMSGVQGAFIGGLMGTLSPEM-----PQAGVDPQ  93

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
            A+A+  QAQAL GGP VQARNFA +TGVNAGI+ V+KR+RGKED++S++ AA GSG  YS
Sbjct  94   AIASMKQAQALVGGPWVQARNFAAITGVNAGIASVMKRIRGKEDIESAVVAALGSGFAYS  153

Query  416  LVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEK  240
            LVS G+ G  +   A+T+   FA+ QG  FK  ++FS+P +ED  Y + R++L  LGLEK
Sbjct  154  LVSQGLQGQPM--NAITTAAGFAVFQGIFFK-AKRFSKPSSEDPFYTRGRTMLVQLGLEK  210

Query  239  YEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            YEKNFK+GLLTD TLPLLTDSAL+DVSIPPGPRL+ILD + R+P+ + K
Sbjct  211  YEKNFKKGLLTDPTLPLLTDSALRDVSIPPGPRLMILDHIQRDPEMKGK  259



>gb|ACG46863.1| SAM domain family protein [Zea mays]
Length=172

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  569  ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD  390
            AL GGPLVQARNFAVMTG NAGISCV++R+RGKED+Q SMAAAFGSG ++S+VSGMG P+
Sbjct  13   ALAGGPLVQARNFAVMTGANAGISCVMRRIRGKEDIQGSMAAAFGSGALFSIVSGMGTPN  72

Query  389  VVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGll  210
             V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +TRS+L  LGLEKYEKNFKRGLL
Sbjct  73   PVANAVTTGVAFAVFQGGFFMIGQKFSKPPSEDTYYSRTRSMLHKLGLEKYEKNFKRGLL  132

Query  209  tdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
             D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+  R
Sbjct  133  NDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPELVR  170



>ref|NP_001150693.1| LOC100284326 [Zea mays]
 gb|ACG40019.1| SAM domain family protein [Zea mays]
Length=271

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 167/231 (72%), Gaps = 4/231 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQP----TPPPGAN  609
            +   L +GV AWL+KQ   VEAA VTA  A QG  +G   G+     +      PPP   
Sbjct  39   RVRSLEAGVLAWLAKQPTHVEAAVVTAVGAVQGAALGRAHGHACARRRGPRSLVPPPPPG  98

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG  429
             DP  +A+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG EDVQ SMAAAFGSG
Sbjct  99   TDPKVLASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGVEDVQGSMAAAFGSG  158

Query  428  VMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLG  249
             ++S+VSGMG P+ V  A+T+GV FA+ QGG F + Q+FSQP + D  Y + RS+L  LG
Sbjct  159  ALFSIVSGMGTPNPVANAITTGVGFAVFQGGFFMISQKFSQPQSGDTYYSRGRSMLQKLG  218

Query  248  LEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            L+ YEKNFK+GLLTD TLPLLTDSAL+DV IPPGPRLLILD + R+P+  +
Sbjct  219  LQNYEKNFKKGLLTDQTLPLLTDSALRDVKIPPGPRLLILDHIKRDPELTK  269



>dbj|BAM64851.1| hypothetical protein [Beta vulgaris]
Length=256

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 146/192 (76%), Gaps = 5/192 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGA---NL  606
            K  E+   VK+WLSKQSLPVEA  VTA  A QG +IGA++G L+ D+  T P       L
Sbjct  30   KIKEVEIKVKSWLSKQSLPVEAVVVTAGGATQGALIGALMGTLTQDMSSTMPMPPPTPGL  89

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            DP  +A+  QAQAL+GGPLVQARNFAVMTGVN GISCVLKR++GKEDV SSM AAFGSG 
Sbjct  90   DPKTLASMQQAQALSGGPLVQARNFAVMTGVNVGISCVLKRLKGKEDVWSSMIAAFGSGA  149

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQP--PAEDMQYVKTRSLLSGL  252
            M+SLVSGMGGP+ +P  ++SG FFAL QGG++KLG++FS+P  P +D  Y  TRS+L  L
Sbjct  150  MFSLVSGMGGPNQIPNMVSSGAFFALAQGGIYKLGEKFSKPGVPDDDPFYANTRSMLITL  209

Query  251  GLEKYEKNFKRG  216
            GL+ YEKNFK+G
Sbjct  210  GLQSYEKNFKKG  221



>gb|AFW71639.1| SAM domain protein [Zea mays]
Length=206

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -2

Query  569  ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD  390
            AL GGPLVQARNFAVMTG NAGISCV++R+RGKED+Q SMAAAFGSG ++S+VSGMG P+
Sbjct  47   ALAGGPLVQARNFAVMTGANAGISCVMRRIRGKEDIQGSMAAAFGSGALFSIVSGMGTPN  106

Query  389  VVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGll  210
             V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +TRS+L  LGLEKYEKNFKRGLL
Sbjct  107  PVANAVTTGVAFAVFQGGFFMIGQKFSKPPSEDTYYSRTRSMLHKLGLEKYEKNFKRGLL  166

Query  209  tdttlplltDSALKDVSIPPGPRLLILDQVHRNPDF  102
             D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+ 
Sbjct  167  NDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPEL  202



>ref|XP_010110465.1| hypothetical protein L484_001864 [Morus notabilis]
 gb|EXC26463.1| hypothetical protein L484_001864 [Morus notabilis]
Length=194

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            KY EL +G KAWL KQ L VEAA VT  SAAQG  IG+++G L+ D+    PTPP  ANL
Sbjct  26   KYKELENGFKAWLEKQPLAVEAAVVTVTSAAQGAGIGSLMGTLTKDVSSSIPTPPQ-ANL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
             P AMA+F QAQAL+GGPLVQARNFAVMTGVNAG+SCV+KR+RGKEDVQSSM AAFGSG 
Sbjct  85   TPQAMASFQQAQALSGGPLVQARNFAVMTGVNAGLSCVMKRLRGKEDVQSSMVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQ  285
            M+SLVSGMGGP+ V  A TSG+FFALVQGGL+++ ++ +    E  +
Sbjct  145  MFSLVSGMGGPNQVANAATSGLFFALVQGGLYQIIKEITDVDTEQRE  191



>ref|XP_002964681.1| hypothetical protein SELMODRAFT_81847, partial [Selaginella moellendorffii]
 gb|EFJ35014.1| hypothetical protein SELMODRAFT_81847, partial [Selaginella moellendorffii]
Length=244

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 161/227 (71%), Gaps = 5/227 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGAN----  609
            +  +L +G K WL +QS PVE A VTA  AAQGG IG ++G L+ D     PP  N    
Sbjct  12   RLGKLDAGFKQWLRQQSAPVEVAIVTAGGAAQGGAIGGLMGRLTADAAAGAPPMGNQLPQ  71

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGK-EDVQSSMAAAFGS  432
             +P  M      QA  GGP  QARNFAVM+GVN+G++CV+KR+RG  ED Q+SM A FGS
Sbjct  72   TNPQMMVCNLNFQAFAGGPWAQARNFAVMSGVNSGLTCVMKRLRGGVEDAQTSMVAGFGS  131

Query  431  GVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGL  252
            G   S+ SGMGG + V +A+T+G+ F L+Q  +FK+ Q+F QPP +D+QY++++++L  L
Sbjct  132  GACLSIASGMGGENPVASAVTTGLSFGLIQAAMFKVTQKFYQPPGDDIQYLRSKNMLRVL  191

Query  251  GLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRN  111
            GLEKYEKNFK+G LTD TLPLLTDSAL+DV IPPGPRLLIL  + R+
Sbjct  192  GLEKYEKNFKKGYLTDETLPLLTDSALRDVKIPPGPRLLILHHIERS  238



>ref|XP_002966437.1| hypothetical protein SELMODRAFT_85831 [Selaginella moellendorffii]
 gb|EFJ32464.1| hypothetical protein SELMODRAFT_85831 [Selaginella moellendorffii]
Length=239

 Score =   199 bits (506),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 161/227 (71%), Gaps = 5/227 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGAN----  609
            +  +L +G K WL +QS PVE A VTA  AAQGG IG ++G L+ D     PP  N    
Sbjct  7    RLGKLDAGFKQWLRQQSAPVEVAIVTAGGAAQGGAIGGLMGRLTADAAAGAPPMGNQLPQ  66

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGK-EDVQSSMAAAFGS  432
             +P  M      QA  GGP  QARNFAVM+GVN+G++CV+KR+RG  ED Q+SM A FGS
Sbjct  67   TNPQMMVCNLNFQAFAGGPWAQARNFAVMSGVNSGLTCVMKRLRGGVEDAQTSMVAGFGS  126

Query  431  GVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGL  252
            G   S+ SG+GG + V +A+T+G+ F L+Q  +FK+ Q+F QPP +D+QY++++++L  L
Sbjct  127  GACLSIASGIGGENPVASAVTTGLSFGLIQAAMFKVTQKFYQPPGDDIQYLRSKNMLRVL  186

Query  251  GLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRN  111
            GLEKYEKNFK+G LTD TLPLLTDSAL+DV IPPGPRLLIL  + R+
Sbjct  187  GLEKYEKNFKKGYLTDETLPLLTDSALRDVKIPPGPRLLILHHIERS  233



>gb|KJB39517.1| hypothetical protein B456_007G017700, partial [Gossypium raimondii]
Length=275

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 127/153 (83%), Gaps = 2/153 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT--PPPGANLD  603
            K+ E+ +G +AWLSKQ LPVEA  VT   AAQG  IGA++G L+ D+  +   PP A+L+
Sbjct  82   KFKEVENGFRAWLSKQPLPVEATVVTTTGAAQGAAIGALMGTLTNDISSSLQTPPQASLN  141

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVM  423
            P AMA+F QAQAL+GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQSSMAAAFGSG M
Sbjct  142  PQAMASFKQAQALSGGPLVQARNFAVMTGVNAGISCVMKRLRGKEDVQSSMAAAFGSGAM  201

Query  422  YSLVSGMGGPDVVPAALTSGVFFALVQGGLFKL  324
            +SLVSGMGGP+    A+TSG+FFALVQGGLF++
Sbjct  202  FSLVSGMGGPNQAANAVTSGLFFALVQGGLFQV  234



>gb|KDO44885.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=180

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQ  318
             +SLVSGMGG +    A TSG+ FA+ QG  FK+ +
Sbjct  145  AFSLVSGMGGANPAVNAFTSGLLFAIFQGCSFKVNR  180



>gb|KDO44884.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=183

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 117/153 (76%), Gaps = 3/153 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFK  327
             +SLVSGMGG +    A TSG+ FA+ QG  FK
Sbjct  145  AFSLVSGMGGANPAVNAFTSGLLFAIFQGCSFK  177



>gb|KDO44886.1| hypothetical protein CISIN_1g024983mg [Citrus sinensis]
Length=203

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K  EL +G K+WL+KQ LPVEAA VTA +A  G  IGA LG ++ DL    PTPPP ++L
Sbjct  25   KLKELENGYKSWLAKQPLPVEAAIVTATTAINGAAIGAFLGVMTQDLTSSLPTPPPQSSL  84

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGV  426
            +P+A+A F Q QA+ GGPLVQARNFAV+TGVNAGISCV+KR+RGKED+QSS+ AAFGSG 
Sbjct  85   NPDAVAPFQQVQAVAGGPLVQARNFAVITGVNAGISCVMKRLRGKEDLQSSVVAAFGSGA  144

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKL  324
             +SLVSGMGG +    A TSG+ FA+ QG  FK+
Sbjct  145  AFSLVSGMGGANPAVNAFTSGLLFAIFQGCSFKV  178



>gb|EMS56099.1| hypothetical protein TRIUR3_21342 [Triticum urartu]
Length=341

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 127/172 (74%), Gaps = 20/172 (12%)
 Frame = -2

Query  569  ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSS------------------MAA  444
            AL GGPLVQARNFAVMTG NAGISCV++RVRG EDVQ S                  MAA
Sbjct  109  ALAGGPLVQARNFAVMTGANAGISCVMRRVRGVEDVQGSMYVHDYLLSYKQQNNDKFMAA  168

Query  443  AFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA--EDMQYVKTR  270
            AFGSG ++S+VSGMG P+ V  A+T+G+ FA+ QGG F +GQ+FS+     EDM Y + R
Sbjct  169  AFGSGALFSIVSGMGTPNPVVNAITTGMAFAVFQGGFFIVGQKFSKTKTHNEDMNYSRAR  228

Query  269  SLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
            ++L+ LGL+ YEKNFK+GLLTD TLPLL +SAL+DV+IPPGPRL+IL+ + R
Sbjct  229  NMLNQLGLQNYEKNFKKGLLTDETLPLLNESALRDVNIPPGPRLVILEHIRR  280



>ref|XP_011396822.1| hypothetical protein F751_6912 [Auxenochlorella protothecoides]
 gb|KFM23944.1| hypothetical protein F751_6912 [Auxenochlorella protothecoides]
Length=259

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 142/221 (64%), Gaps = 19/221 (9%)
 Frame = -2

Query  746  AWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQA  567
            AW + Q++ V+    T+    QG ++GA++G++S        PGA  +P  + +      
Sbjct  34   AWTATQAIWVDVVSATSFGGVQGSLLGALMGSMSQ--MTASAPGAAGNPAQLMSL-----  86

Query  566  LTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDV  387
              G P  QARNFAVMTGVNAGIS +++RVRG EDVQ+++ +AFGSGV +SLVSGMG P  
Sbjct  87   --GTPFQQARNFAVMTGVNAGISTLMRRVRGVEDVQNALVSAFGSGVCFSLVSGMGKPGA  144

Query  386  VP---------AALTSGVFFALVQGGLFKLGQQFS-QPPAEDMQYVKTRSLLSGLGLEKY  237
             P         AA ++GV FAL QG  +KLG++F+    A D  YVK +++L  LG+ KY
Sbjct  145  QPGSGTANPLMAAFSAGVVFALFQGAFYKLGERFAGGSRAVDDDYVKVKAMLDTLGMSKY  204

Query  236  EKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
            E+NFK+GLL D T+ L   S+L +V +PPGPRLLILD V +
Sbjct  205  ERNFKKGLLEDRTIGLWDSSSLAEVRVPPGPRLLILDHVDQ  245



>ref|XP_005648139.1| hypothetical protein COCSUDRAFT_66004 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23595.1| hypothetical protein COCSUDRAFT_66004 [Coccomyxa subellipsoidea 
C-169]
Length=279

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 144/221 (65%), Gaps = 5/221 (2%)
 Frame = -2

Query  764  LASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMAT  585
            L S  + W++ Q + VEA   T A + QG ++G ++G++S  + P         PN+   
Sbjct  29   LLSRFQTWVTLQPVAVEALVATLAGSGQGALLGGVMGSIS-KMDPNSTNQLLNQPNSNPD  87

Query  584  F-NQAQAL-TGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLV  411
               Q QA  +GGP VQARNFAV+TGV AG++  +KR+RGKEDV S+MA+AFGSGV +SLV
Sbjct  88   MVKQMQAFQSGGPWVQARNFAVLTGVGAGLTVAIKRIRGKEDVYSTMASAFGSGVAFSLV  147

Query  410  SGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF-SQPPAEDM-QYVKTRSLLSGLGLEKY  237
            SGM   + +  A T+G  FAL QG  ++LG++F S    E++ +Y +   LL+ LG +KY
Sbjct  148  SGMTAGNKLQGAFTTGTLFALFQGAFYQLGKKFKSGNTTEELPEYARATHLLATLGFQKY  207

Query  236  EKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
            +KN K G L D+TL L  DSAL++V IPPGPRLLI+  + R
Sbjct  208  QKNLKTGQLNDSTLMLWNDSALREVKIPPGPRLLIMHHLER  248



>emb|CDX77311.1| BnaC08g03560D [Brassica napus]
Length=172

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = -2

Query  524  MTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVS-GMGGPDVVPAALTSGVFFAL  348
            +TGVNAGI+CV+KR+RGKED++S++ AAFGSGV YSLVS G+ G  +   A+T+   F+L
Sbjct  19   ITGVNAGIACVMKRIRGKEDLESAVVAAFGSGVAYSLVSAGLQGQPM--NAITTAAGFSL  76

Query  347  VQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALK  168
             QG  FKLG++FS+P  ED  Y + RS+L  LGLEKYEKNFK+GLL D TLPLLTDSALK
Sbjct  77   FQGIFFKLGERFSKPSVEDPYYTRARSMLLKLGLEKYEKNFKKGLLADPTLPLLTDSALK  136

Query  167  DVSIPPGPRLLILDQVHRNPDFRRK  93
            DVSIPPGPRLLILD + R+P+ + K
Sbjct  137  DVSIPPGPRLLILDHIQRDPELKGK  161



>ref|XP_010424280.1| PREDICTED: uncharacterized protein LOC104709349, partial [Camelina 
sativa]
Length=147

 Score =   159 bits (403),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = -2

Query  524  MTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVS-GMGGPDVVPAALTSGVFFAL  348
            +TGVNAGI+CV+KR+RGKED++S++AAAFGSGV YSLVS G+ G  +   A+T+   FAL
Sbjct  1    ITGVNAGIACVMKRIRGKEDLESAVAAAFGSGVAYSLVSSGLQGQPM--NAITTAAGFAL  58

Query  347  VQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALK  168
             QG  FKLG++FS+P  ED  Y + RS+L  LGLEKYEKNFK+GLL D TLPLLTDSALK
Sbjct  59   FQGVFFKLGERFSKPSVEDPYYNQGRSMLLKLGLEKYEKNFKKGLLADPTLPLLTDSALK  118

Query  167  DVSIPPGPRLLILDQVHRNPDFRRK  93
            D SIPPGPRLLILD + R+P+ + K
Sbjct  119  DASIPPGPRLLILDHIQRDPELKGK  143



>ref|XP_010035349.1| PREDICTED: uncharacterized protein LOC104424596 isoform X1 [Eucalyptus 
grandis]
 gb|KCW46708.1| hypothetical protein EUGRSUZ_K00528 [Eucalyptus grandis]
Length=123

 Score =   158 bits (400),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  452  MAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKT  273
            MAAAFGSG M+SLVSGMGGP+    A+TSG FFALVQGGLFKLGQ+FSQPP ED+ Y +T
Sbjct  1    MAAAFGSGAMFSLVSGMGGPNQAANAVTSGFFFALVQGGLFKLGQKFSQPPVEDVYYSQT  60

Query  272  RSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFR  99
            RS+LS LGL+ YEKNFK+GLLTDTTLPLLTDSAL+DV+IPPGPRLLILD + R+P  +
Sbjct  61   RSMLSNLGLQNYEKNFKKGLLTDTTLPLLTDSALRDVNIPPGPRLLILDHIQRDPQLK  118



>ref|XP_010035350.1| PREDICTED: uncharacterized protein LOC104424596 isoform X2 [Eucalyptus 
grandis]
Length=116

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  452  MAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKT  273
            MAAAFGSG M+SLVSGMGGP+    A+TSG FFALVQGGLFKLGQ+FSQPP ED+ Y +T
Sbjct  1    MAAAFGSGAMFSLVSGMGGPNQAANAVTSGFFFALVQGGLFKLGQKFSQPPVEDVYYSQT  60

Query  272  RSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
            RS+LS LGL+ YEKNFK+GLLTDTTLPLLTDSAL+DV+IPPGPRLLILD + R
Sbjct  61   RSMLSNLGLQNYEKNFKKGLLTDTTLPLLTDSALRDVNIPPGPRLLILDHIQR  113



>gb|ACN26194.1| unknown [Zea mays]
Length=127

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  455  SMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVK  276
            SMAAAFGSG ++S+VSGMG P+ V  A+T+GV FA+ QGG F +GQ+FS+PP+ED  Y +
Sbjct  6    SMAAAFGSGALFSIVSGMGTPNPVANAVTTGVAFAVFQGGFFMIGQKFSKPPSEDTYYSR  65

Query  275  TRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPD  105
            TRS+L  LGLEKYEKNFKRGLL D TLPLLTDSAL+DV IPPGPRLLILDQ+ R+P+
Sbjct  66   TRSMLHKLGLEKYEKNFKRGLLNDQTLPLLTDSALRDVKIPPGPRLLILDQIKRDPE  122



>emb|CAN60468.1| hypothetical protein VITISV_030224 [Vitis vinifera]
Length=131

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            ++ +L +G +AWL+KQSLPVEAA VTA SAAQG  IGA +G L+ D     PTPP  ANL
Sbjct  22   RFKDLENGFRAWLAKQSLPVEAAVVTATSAAQGAAIGAFMGTLTNDATSAIPTPPQ-ANL  80

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQS  456
             P AMA+F QAQAL GGPLVQARNFAVMTGVNAGISCV+KR+RGKEDVQS
Sbjct  81   SPQAMASFKQAQALAGGPLVQARNFAVMTGVNAGISCVMKRIRGKEDVQS  130



>ref|XP_001702924.1| mitochondrial inner membrane translocase [Chlamydomonas reinhardtii]
 gb|EDO96777.1| mitochondrial inner membrane translocase [Chlamydomonas reinhardtii]
Length=265

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 132/228 (58%), Gaps = 17/228 (7%)
 Frame = -2

Query  773  YNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLS---PDLQPTPPPGANLD  603
            + ++     AWL  Q + V+       S+ QGG IG + G++S   P    T P  AN  
Sbjct  19   FEDVGKKWHAWLDTQDVAVQVLVTGLQSSIQGGAIGYMFGSISAIDPTQNGTAPKPANPA  78

Query  602  PNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVR-GKEDVQSSMAAAFGSGV  426
             ++M        +  GP   ARN A +TGV A  +  +K+ R GKEDV SSMAA+F SGV
Sbjct  79   LDSM--------MKAGPWGTARNLAALTGVQAAATLAIKKARNGKEDVYSSMAASFLSGV  130

Query  425  MYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGL  246
             YSLVSG   P+ + +A+T+G  F L  G ++++GQ F +P   D +Y + + +L  LGL
Sbjct  131  AYSLVSG--SPNPIQSAITTGAAFGLFNGLIYQVGQAF-KPEFADTEYDRGKYMLKTLGL  187

Query  245  EKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV--HRNP  108
             KY  N K+GLLTD T+ L  D AL +V IPPGPRLLIL  +  +RNP
Sbjct  188  TKYVDNLKKGLLTDNTIMLWNDIALAEVRIPPGPRLLILHHLDTYRNP  235



>ref|XP_002946728.1| hypothetical protein VOLCADRAFT_103154 [Volvox carteri f. nagariensis]
 gb|EFJ51954.1| hypothetical protein VOLCADRAFT_103154 [Volvox carteri f. nagariensis]
Length=260

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 132/230 (57%), Gaps = 22/230 (10%)
 Frame = -2

Query  773  YNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN-  597
            ++EL    + WL+ Q + V+       SA QGGV+G + G++S           + DPN 
Sbjct  18   FDELGKKYQDWLAGQDVAVQVLLTGLQSAVQGGVLGYMFGSIS-----------SFDPNQ  66

Query  596  --AMATFNQA--QALTGGPLVQARNFAVMTGVNAGISCVLKRVR-GKEDVQSSMAAAFGS  432
              A    N A    +  GP   ARN A +TGV A  S  +K+ R GKEDV S+M A+F S
Sbjct  67   NGAAKPSNPALESVVKAGPWGSARNLAALTGVQAAASLAIKKARNGKEDVYSAMGASFLS  126

Query  431  GVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGL  252
            GV YS+VSG   P+ + +A+T+G  FAL  G +++ GQ F +P   D  Y + + +L  L
Sbjct  127  GVAYSVVSG--SPNPIQSAVTTGAAFALFNGLIYQFGQAF-KPEFADTDYDRGKYMLKTL  183

Query  251  GLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV--HRNP  108
            GL KY  N K+GLLTD T+ L  DSAL +  IPPGPRLLIL  +  +RNP
Sbjct  184  GLTKYADNLKKGLLTDNTIMLWNDSALAECRIPPGPRLLILHHLDTYRNP  233



>gb|KJB37430.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=162

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ E+  G KAWL KQS+PVEAA VTA  A QG  IGA++G L+ D+    PTPP  A+L
Sbjct  28   KFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAAIGALMGTLTKDVSSSFPTPPQ-ASL  86

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQS  456
            +  AMA+  QAQAL+G P VQARNFAVMTGVNAG++CV+KR+RGKEDVQS
Sbjct  87   NHQAMASLKQAQALSGAPWVQARNFAVMTGVNAGLACVMKRLRGKEDVQS  136



>ref|XP_005849272.1| hypothetical protein CHLNCDRAFT_143549 [Chlorella variabilis]
 gb|EFN57170.1| hypothetical protein CHLNCDRAFT_143549 [Chlorella variabilis]
Length=274

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 135/247 (55%), Gaps = 31/247 (13%)
 Frame = -2

Query  767  ELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSP-DLQPTPPPGANLDPNAM  591
            E+   +  W +KQ   VE        + QG  +G I+G +   +++     GA + P  +
Sbjct  23   EVQQKLDVWTAKQPAWVEGVVAGIKGSGQGLFLGLIMGTMGKMNMEAAASSGAPMAPQML  82

Query  590  ATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRG-KEDVQSSMAA----------  444
                      GGP+ QARNFAVMTGVNAG+  ++KR RG +EDVQ+ +            
Sbjct  83   NM--------GGPVTQARNFAVMTGVNAGVQAMMKRWRGGREDVQNQLVGESLLLLRGHG  134

Query  443  -AFGSGVMYSLVSG----------MGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA  297
              F SG  +SLVSG             P+ + AA ++GV FAL QG  FKLG+ +S P A
Sbjct  135  RGFFSGASFSLVSGGISNPAAVPGAAAPNPLMAAFSAGVVFALFQGAFFKLGEIWSGPKA  194

Query  296  EDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH  117
             D +Y + +++L+ L L +YEKN ++G+L DTT+ L  ++AL++V IP GPRLLIL  + 
Sbjct  195  ADTEYARVKAMLTSLNLPQYEKNVRKGMLNDTTIGLWDNAALQEVRIPAGPRLLILAHID  254

Query  116  RNPDFRR  96
            +     R
Sbjct  255  QYRHILR  261



>gb|KJB37432.1| hypothetical protein B456_006G203900 [Gossypium raimondii]
Length=187

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            K+ E+  G KAWL KQS+PVEAA VTA  A QG  IGA++G L+ D+    PTPP  A+L
Sbjct  28   KFKEVEKGFKAWLDKQSMPVEAAVVTATGAVQGAAIGALMGTLTKDVSSSFPTPPQ-ASL  86

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQS  456
            +  AMA+  QAQAL+G P VQARNFAVMTGVNAG++CV+KR+RGKEDVQS
Sbjct  87   NHQAMASLKQAQALSGAPWVQARNFAVMTGVNAGLACVMKRLRGKEDVQS  136



>ref|XP_010909429.1| PREDICTED: uncharacterized protein LOC105035540 [Elaeis guineensis]
Length=136

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPP-GAN  609
            ++ EL +G + WL+KQ L VEAA VTA SAAQG  IG +LG L+PD     PTPPP  A 
Sbjct  25   RFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAIGGLLGTLTPDAASTFPTPPPQAAG  84

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQS  456
            LDP A+A+F QAQA  GGPL QARNFAVMTGVNAGISCV++R+RG EDVQ+
Sbjct  85   LDPQALASFKQAQAFAGGPLAQARNFAVMTGVNAGISCVMRRLRGVEDVQN  135



>ref|XP_003056540.1| pre-protein translocase [Micromonas pusilla CCMP1545]
 gb|EEH59916.1| pre-protein translocase [Micromonas pusilla CCMP1545]
Length=257

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 127/226 (56%), Gaps = 21/226 (9%)
 Frame = -2

Query  749  KAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQ  570
            + WL  Q L +E    +A+SA QGGV+G  LG ++  L+       N  P+ +AT     
Sbjct  13   EEWLKTQPLSIEVGVTSASSALQGGVLGYTLGLVNQSLEKQAASIPN-RPSPLAT----G  67

Query  569  ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGG--  396
            + +G P V A N A+ T V  G++  +KR RG +D+Q++M    G+G   SL + + G  
Sbjct  68   SFSGPPKVLALNLAIFTAVQGGLTLAVKRFRGVDDIQTNMIGMLGAGAALSLTTNLSGGG  127

Query  395  -------------PDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA-EDMQYVKTRSLLS  258
                          D +  AL +GV FA++ G   K GQ F+   A +D+ Y  T  +L+
Sbjct  128  VGSAPGHVKSTKPQDYLTDALRTGVLFAVLNGAFMKAGQWFTGTNASQDIYYYHTNCMLT  187

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV  120
             LGLEKYEKNF++G+L D  L LL+DSALK+V IPPGPRL IL  +
Sbjct  188  SLGLEKYEKNFRKGMLMDDCLTLLSDSALKEVRIPPGPRLRILHYI  233



>ref|XP_008788093.1| PREDICTED: uncharacterized protein LOC103705955 isoform X2 [Phoenix 
dactylifera]
Length=210

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPP-GAN  609
            ++ EL +G + WL+KQ L VEAA VTA SAAQG  IG +LG L+PD     PTPPP  A 
Sbjct  25   RFKELETGFRTWLAKQPLHVEAAVVTATSAAQGAAIGGLLGTLTPDAASTFPTPPPQAAG  84

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMA  447
            LD  A+ +F QAQA  GGPL QARNFAVMTGVNAGISCV++R+RG EDVQ+S A
Sbjct  85   LDAQALTSFKQAQAFAGGPLAQARNFAVMTGVNAGISCVMRRLRGLEDVQNSWA  138



>ref|XP_001415886.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94178.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=263

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 127/231 (55%), Gaps = 33/231 (14%)
 Frame = -2

Query  746  AWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ------PTPPPGANLDPNAMAT  585
            AWL  QS PVE     A  A QG V+G  LG ++  L+      P  PP A     A  +
Sbjct  17   AWLKAQSDPVEVGITAAGGALQGSVLGYGLGMMNKSLEAQAATMPNKPPMA-----AQGS  71

Query  584  FNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGK-EDVQSSMAAAFGSGVMYSLVS  408
            F      +G P V A N AV + V  G++  +K+ RG  ED+Q SM A FG+G   SLV 
Sbjct  72   F------SGPPKVLALNLAVFSAVQGGLTLAIKKYRGGVEDIQGSMMAMFGAGSALSLVG  125

Query  407  G--------MGGP------DVVPAALTSGVFFALVQGGLFKLGQQFS-QPPAEDMQYVKT  273
                     MGG        V   A+ +G  FAL+ G   K+GQ FS +  A+D  Y   
Sbjct  126  AATGSSTGAMGGEAPKDAAGVATDAVRTGALFALLNGAFMKVGQMFSGKDAAQDHYYAHA  185

Query  272  RSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV  120
             ++L+ LGLEKYEKNF++GLLTD TL LL DSAL++V IPPGPRL IL+ V
Sbjct  186  NNMLATLGLEKYEKNFRKGLLTDDTLLLLNDSALQEVRIPPGPRLKILNYV  236



>emb|CEF96707.1| Sterile alpha motif, type 1 [Ostreococcus tauri]
Length=261

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 131/238 (55%), Gaps = 27/238 (11%)
 Frame = -2

Query  746  AWLSKQSLPVEaafvtaasaAQGGVIGAILG--NLSPDLQPTPPPGANLDPNAMATFNQA  573
            AWL  QS PVE    T   AAQG V+G  LG  N S + Q    PGA   P A  +F   
Sbjct  13   AWLRAQSAPVEIGVSTLGGAAQGSVLGYGLGVMNKSLEAQAATMPGAK-PPMAQGSF---  68

Query  572  QALTGGPLVQARNFAVMTGVNAGISCVLKRVRGK-EDVQSSMAAAFGSGVMYSLV-----  411
               +G P V A N AV + V  G++  +K+ RG  ED+Q SM A FG+G   SLV     
Sbjct  69   ---SGPPKVLALNLAVFSAVQQGLTLAIKKYRGGVEDIQGSMMAMFGAGSALSLVGAATG  125

Query  410  ---SGMGGP------DVVPAALTSGVFFALVQGGLFKLGQQFSQPPA-EDMQYVKTRSLL  261
               + MGG        V   A+ +G  FAL+ G   K+GQ FS   A +D  Y     +L
Sbjct  126  SPSAAMGGEAPKDAAGVATDAVRTGALFALLNGAFMKVGQMFSGKDATQDYLYAHGTHML  185

Query  260  SGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVH--RNPDFRRK  93
            + LGLEKYEKNF++GLLTD TL LL DSAL++V IPPGPRL IL+ V   R   FR +
Sbjct  186  TKLGLEKYEKNFRKGLLTDDTLMLLNDSALQEVRIPPGPRLKILNYVDAARAQAFRHQ  243



>ref|XP_007515528.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14407.1| predicted protein [Bathycoccus prasinos]
Length=257

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 135/231 (58%), Gaps = 27/231 (12%)
 Frame = -2

Query  752  VKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQ-  576
            V  WL  QS+PVE A ++A SA QGGV+G +LG ++ +L       A  +P AMA  NQ 
Sbjct  14   VDEWLKNQSVPVEIAAISAGSAVQGGVLGFVLGTVNKNLAEQ----AATNP-AMA--NQP  66

Query  575  --AQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLV---  411
              + A++G P V A N AV T V  G++C +K++    ++++ M A FG+G   S+    
Sbjct  67   AMSGAMSGPPHVLAVNLAVFTAVQGGLTCWIKKMNKFSEIETGMLAMFGAGAALSVSSSL  126

Query  410  ----SGMGGPD---------VVPAALTSGVFFALVQGGLFKLGQQFS-QPPAEDMQYVKT  273
                +  GG D         +   A+ SGV F+L+ G   K+GQ FS +    D+ Y   
Sbjct  127  SGQKAAFGGQDAAIPEGPMQIAQEAVKSGVLFSLLNGAFMKIGQSFSGKNEKTDVFYSHA  186

Query  272  RSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV  120
              +L+ LGLEKYEKNFKRGLLTD  L LL D+AL++V IPPGPRL IL+ V
Sbjct  187  VGMLTALGLEKYEKNFKRGLLTDDCLLLLNDNALQEVRIPPGPRLKILNYV  237



>ref|XP_003602441.1| SAM domain family protein [Medicago truncatula]
Length=138

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQ---PTPPPGANL  606
            +Y  L +G K WLSKQS+ VEAA VT   AAQG  IGA LG L+ D     PTPPP A+L
Sbjct  28   RYKHLENGFKLWLSKQSIAVEAAVVTTTGAAQGAAIGAFLGTLTGDASSAFPTPPPNASL  87

Query  605  DPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQS  456
            +P AMA+  QAQAL GGPL+QARNFA++TGV+AGI+CVL+R+RGKEDV+S
Sbjct  88   NPQAMASLQQAQALAGGPLIQARNFAILTGVSAGITCVLRRLRGKEDVKS  137



>ref|XP_002507077.1| mitochondrial import inner membrane translocase [Micromonas sp. 
RCC299]
 gb|ACO68335.1| mitochondrial import inner membrane translocase [Micromonas sp. 
RCC299]
Length=257

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 129/234 (55%), Gaps = 24/234 (10%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPN  597
            K NE  S    W+  Q   VE    +A SA QGG++G  LG ++   Q      AN+ PN
Sbjct  8    KKNEFES----WMRAQPPAVEIGITSATSAIQGGILGFTLGTVN---QSIEKQAANM-PN  59

Query  596  AMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYS  417
              +    + + +G P V A N AV T V  G++  +KR RG +D+Q++M   FG+G   S
Sbjct  60   K-SVMPTSGSFSGPPRVLALNLAVFTAVQGGLTLAVKRYRGVDDIQTNMIGMFGAGAALS  118

Query  416  LVSGMGGPD------VVPA--------ALTSGVFFALVQGGLFKLGQQFS-QPPAEDMQY  282
            L + + G        V P+        A  +G  FA + G   K+GQ  S +  ++D+ Y
Sbjct  119  LTTNIAGNQPAAPGQVKPSTPLGYMTDAARTGALFAALNGAFMKIGQMLSGKDSSQDVYY  178

Query  281  VKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV  120
              T  +L+ LGLEKYE+NF++G+L D  L LL+DSAL++V IPPGPRL IL+ V
Sbjct  179  YHTICMLNALGLEKYERNFRKGMLMDDCLALLSDSALREVKIPPGPRLKILNYV  232



>ref|XP_003074409.1| unnamed protein product [Ostreococcus tauri]
Length=289

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 120/217 (55%), Gaps = 27/217 (12%)
 Frame = -2

Query  683  QGGVIGAILG--NLSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVN  510
            QG V+G  LG  N S + Q    PGA   P A  +F      +G P V A N AV + V 
Sbjct  62   QGSVLGYGLGVMNKSLEAQAATMPGAK-PPMAQGSF------SGPPKVLALNLAVFSAVQ  114

Query  509  AGISCVLKRVRGK-EDVQSSMAAAFGSGVMYSLV--------SGMGGP------DVVPAA  375
             G++  +K+ RG  ED+Q SM A FG+G   SLV        + MGG        V   A
Sbjct  115  QGLTLAIKKYRGGVEDIQGSMMAMFGAGSALSLVGAATGSPSAAMGGEAPKDAAGVATDA  174

Query  374  LTSGVFFALVQGGLFKLGQQFSQPPA-EDMQYVKTRSLLSGLGLEKYEKNFKRGlltdtt  198
            + +G  FAL+ G   K+GQ FS   A +D  Y     +L+ LGLEKYEKNF++GLLTD T
Sbjct  175  VRTGALFALLNGAFMKVGQMFSGKDATQDYLYAHGTHMLTKLGLEKYEKNFRKGLLTDDT  234

Query  197  lplltDSALKDVSIPPGPRLLILDQVH--RNPDFRRK  93
            L LL DSAL++V IPPGPRL IL+ V   R   FR +
Sbjct  235  LMLLNDSALQEVRIPPGPRLKILNYVDAARAQAFRHQ  271



>ref|XP_003056541.1| mitochondrial import inner membrane translocase subunit [Micromonas 
pusilla CCMP1545]
 gb|EEH59917.1| mitochondrial import inner membrane translocase subunit [Micromonas 
pusilla CCMP1545]
Length=236

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 110/226 (49%), Gaps = 42/226 (19%)
 Frame = -2

Query  749  KAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQ  570
            + WL  Q L +E    +A+SA QGGV+G  LG ++  L+       N  P+ +AT     
Sbjct  13   EEWLKTQPLSIEVGVTSASSALQGGVLGYTLGLVNQSLEKQAASIPN-RPSPLAT----G  67

Query  569  ALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGG--  396
            + +G P V A N A+ T V  G++  +KR RG +D+Q++M    G+G   SL + + G  
Sbjct  68   SFSGPPKVLALNLAIFTAVQGGLTLAVKRFRGVDDIQTNMIGMLGAGAALSLTTNLSGGG  127

Query  395  -------------PDVVPAALTSGVFFALVQGGLFKLGQQFSQPPA-EDMQYVKTRSLLS  258
                          D +  AL +GV FA++ G   K GQ F+   A +D+ Y  T  +L+
Sbjct  128  VGSAPGHVKSTKPQDYLTDALRTGVLFAVLNGAFMKAGQWFTGTNASQDIYYYHTNCMLT  187

Query  257  GLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV  120
             LGLE                     +ALK+V IPPGPRL IL  +
Sbjct  188  SLGLE---------------------NALKEVRIPPGPRLRILHYI  212



>ref|XP_009152147.1| PREDICTED: uncharacterized protein LOC103875386 [Brassica rapa]
Length=228

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 113/198 (57%), Gaps = 14/198 (7%)
 Frame = -2

Query  680  GGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGI  501
            GGV GA+LG +   +     P A   P A+A   + Q      L  +  FA   G    I
Sbjct  43   GGVSGAVLGGIIGTV--IMAPMARRYPQALAALRRTQYARAYALEGSAVFAAWFG----I  96

Query  500  SCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPA-ALTSGVFFALVQGGLFKL  324
              +++ +RGK+D+ S M +A G G+ YS    M G    PA AL +  ++A + G    +
Sbjct  97   ESIMRGIRGKDDLTSRMVSASGGGLAYSF--AMKGLTGQPAHALFTSAYYAALSGTTATI  154

Query  323  GQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGP  144
              +     A+D  Y++T+++LS LGLE+YEKNFK+G LTD TLP LTDS L++V+IPPGP
Sbjct  155  KSR----NAQDAFYIETKAMLSKLGLEEYEKNFKKGHLTDPTLPFLTDSVLQEVNIPPGP  210

Query  143  RLLILDQVHR-NPDFRRK  93
            RLLILD + R N    RK
Sbjct  211  RLLILDHIQRYNKMVNRK  228



>emb|CDY48062.1| BnaA06g33660D [Brassica napus]
Length=244

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = -2

Query  680  GGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGI  501
            GGV GA+LG +   +     P A   P A+A   + Q      L  +  FA   G    I
Sbjct  43   GGVSGAVLGGIVGTV--IMAPMARRYPQALAALRRTQYARAYALEGSAVFAAWFG----I  96

Query  500  SCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPA-ALTSGVFFALVQGGLFKL  324
              +++ +RGK+D+ S M +A G G+ YS    M G    PA AL +  ++A + G    +
Sbjct  97   ESIMRGIRGKDDLTSRMVSASGGGLAYSF--AMKGLTGQPAHALFTSAYYAALSGTTATI  154

Query  323  GQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGP  144
              +     A+D  Y++T+++LS LGLE+YEKNFK+G LTD TLP LTDS L++V+IPPGP
Sbjct  155  KSR----NAQDAFYIETKAMLSKLGLEEYEKNFKKGHLTDPTLPFLTDSVLQEVNIPPGP  210

Query  143  RLLILDQVHR  114
            RLLILD + R
Sbjct  211  RLLILDHIQR  220



>dbj|BAG90562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=137

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPD----LQPTPPPGAN  609
            +   L +G + W+++Q   +EAA  TA  A QG  +G ++G L+ D        PPP  N
Sbjct  26   RVKALEAGFRKWMAEQPTHIEAAVTTAVGAVQGAALGGLMGTLTADGGSPFPTPPPPPPN  85

Query  608  LDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQ  459
             +P AMA+F QAQAL GGPLVQARNFAVMTG NAGISCV++R+RG ED+Q
Sbjct  86   ANPQAMASFKQAQALAGGPLVQARNFAVMTGANAGISCVMRRIRGGEDIQ  135



>emb|CDY02971.1| BnaC07g22560D [Brassica napus]
Length=236

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 113/194 (58%), Gaps = 21/194 (11%)
 Frame = -2

Query  680  GGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAV----MTGV  513
            GGV GA+LG +   +     P A   P A+A   + Q         AR++A+    +   
Sbjct  51   GGVSGAVLGGIVGTV--IMAPMARRYPRALAALRRTQ--------YARSYALEGSAVLAA  100

Query  512  NAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPA-ALTSGVFFALVQGG  336
              GI  +++ +RGK+D+ S M ++ G G+ YS    M G    PA AL +  ++A   G 
Sbjct  101  WFGIESIMRGIRGKDDLTSDMVSSSGGGLAYSF--AMKGLKGQPAHALFNSAYYAAFSGT  158

Query  335  LFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSI  156
            +  +  + +Q    D  Y +TR++LS LGLE+YEKNFK+G LTD TLPLLTDS L++V+I
Sbjct  159  IETIKSRNTQ----DAFYTETRAMLSKLGLEEYEKNFKKGHLTDPTLPLLTDSVLQEVNI  214

Query  155  PPGPRLLILDQVHR  114
            PPGPRLLILD + R
Sbjct  215  PPGPRLLILDHIQR  228



>ref|NP_001172995.1| Os02g0526500 [Oryza sativa Japonica Group]
 dbj|BAH91724.1| Os02g0526500, partial [Oryza sativa Japonica Group]
Length=88

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = -2

Query  359  FFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltD  180
            F+ L+     ++GQ+FS+P +ED+ Y + RS+L  LGLEKYEKNFK+GLLTD TLPLLTD
Sbjct  1    FYLLIHS--VQIGQKFSKPQSEDLYYSRARSMLQKLGLEKYEKNFKKGLLTDQTLPLLTD  58

Query  179  SALKDVSIPPGPRLLILDQVHRNPDF  102
            SAL+DV IPPGPRLLILDQ+ R+P+F
Sbjct  59   SALRDVKIPPGPRLLILDQIKRDPEF  84



>emb|CDY02973.1| BnaC07g22540D [Brassica napus]
Length=193

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 92/145 (63%), Gaps = 3/145 (2%)
 Frame = -2

Query  539  RNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPA-ALTSG  363
            R+++       GI   +  +RGK+D+ + + +  G+G+  S +    G  + PA AL+S 
Sbjct  45   RDYSAFFAALCGIESAMSAIRGKDDITNHLVSGSGAGLALSFLRQ--GFKLRPAHALSSV  102

Query  362  VFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlpllt  183
              FA++Q  ++K+ +      A+D  Y + R++LS LGLE+YEKNFK+G LTD TLPLLT
Sbjct  103  AVFAVIQATIYKVKETIKSRNAQDALYTEARAMLSMLGLEEYEKNFKKGRLTDPTLPLLT  162

Query  182  DSALKDVSIPPGPRLLILDQVHRNP  108
            D  L++V+IPPG RLLILD + R P
Sbjct  163  DRELREVNIPPGARLLILDHIKRYP  187



>emb|CDY65297.1| BnaCnng46450D [Brassica napus]
Length=202

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 106/191 (55%), Gaps = 22/191 (12%)
 Frame = -2

Query  680  GGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGI  501
            GG++G ++            P A   P A+ + ++ Q         AR+++       GI
Sbjct  24   GGIVGMVI----------MAPLARRYPRALGSLSRTQF--------ARDYSTFAAAACGI  65

Query  500  SCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAA--LTSGVFFALVQGGLFK  327
              +++  RGK+D+ + + +  G+G+ YS VS   G  V PA   LT+     ++ G ++K
Sbjct  66   DSIMRVTRGKDDLTNHLVSGSGAGLAYSFVSQ--GFKVRPAHALLTAAGSAVVMSGTVYK  123

Query  326  LGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPG  147
              +      A+D  Y + R++LS L LE YEKNFK+G LTD TLPLLTDS LK+V+IPPG
Sbjct  124  GYEIIRSRNAQDSFYTEARAMLSKLSLEDYEKNFKKGHLTDYTLPLLTDSDLKEVTIPPG  183

Query  146  PRLLILDQVHR  114
             RLLILD + R
Sbjct  184  ARLLILDHIKR  194



>gb|KIY93044.1| hypothetical protein MNEG_14920 [Monoraphidium neglectum]
Length=169

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 81/141 (57%), Gaps = 9/141 (6%)
 Frame = -2

Query  740  LSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALT  561
               Q+  V+ A  T ASAAQG  IG +LG+ S D  P    G+N  P   A     Q   
Sbjct  25   FKAQNDAVDIAVTTLASAAQGVFIGYLLGSFSVD--PAGQSGSN--PQVSAQLAALQ--K  78

Query  560  GGPLVQARNFAVMTGVNAGISCVLKRVR-GKEDVQSSMAAAFGSGVMYSLVSGMGGPDVV  384
            GGP  QARN  V TGVNAG+S  +K+ R GKEDV  SM AAFG+GV +SL+SG   P  +
Sbjct  79   GGPWGQARNLGVFTGVNAGLSLAIKKARGGKEDVWGSMGAAFGAGVAFSLMSGA--PSPL  136

Query  383  PAALTSGVFFALVQGGLFKLG  321
             +A T+G  FA   G  +++G
Sbjct  137  QSAFTTGAAFAGFNGLFYQVG  157



>ref|XP_010516736.1| PREDICTED: uncharacterized protein LOC104792316 [Camelina sativa]
Length=239

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 82/174 (47%), Gaps = 26/174 (15%)
 Frame = -2

Query  731  QSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTGGP  552
            QS P++    ++     G V G  L  L P +                    +  L G P
Sbjct  26   QSQPIKTVVNSSIGCLGGAVFGYTLATLLPQIT-----------------THSHTLVGVP  68

Query  551  LVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVS--GMGGPDVVPA  378
             VQA+ FA + GV   IS +++ +RGKE + S+M  A GSG  YS +S    G P  +  
Sbjct  69   WVQAQAFAGVAGVYCAISGLIEGIRGKESLLSAMVPAAGSGAAYSFLSRDWQGRPINL--  126

Query  377  ALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRG  216
             L + + F + QG L+ L       P    +Y +TRSLL+ L LEKYEK FK+ 
Sbjct  127  -LYTAIGFTVYQGLLYCLSDVIISNP----KYRQTRSLLNKLELEKYEKEFKKA  175



>gb|KDD76264.1| hypothetical protein H632_c292p0 [Helicosporidium sp. ATCC 50920]
Length=201

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 78/154 (51%), Gaps = 12/154 (8%)
 Frame = -2

Query  536  NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAA------  375
            + +V T + A     L  V G      + +AA  +   +SLVS    P V P+A      
Sbjct  44   DVSVTTAMGAAQGAALGLVMGA----LTKSAADANPAAFSLVSAASMPGVPPSATKKVMS  99

Query  374  -LTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdtt  198
             ++ G  FAL Q  + +           D  YV+ RS+L  LGL++YE+  KRGLL D T
Sbjct  100  AISGGAMFALFQAAIHRFFGDKKNGKGID-AYVRVRSMLQNLGLQEYEQRLKRGLLDDRT  158

Query  197  lplltDSALKDVSIPPGPRLLILDQVHRNPDFRR  96
            + L  DSAL +  IPPGPRLLILD + +  D  R
Sbjct  159  MALWNDSALAEAKIPPGPRLLILDHIDQYRDILR  192



>emb|CDY02972.1| BnaC07g22550D [Brassica napus]
Length=265

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = -2

Query  437  GSGVMYSLVSGMGGPDVVPA-ALTSGVFFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLL  261
            G+G+ +  +S   G    P  AL S   FA++    +K+ Q      A+D  Y++T+++L
Sbjct  134  GAGLTFCFLSK--GLKARPEQALFSAAGFAVMSATAYKMMQTTKPRNAQDAFYIETKAML  191

Query  260  SGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHR  114
            S LGLE+YEKNFK+G LTD TLPLLTDS LKDV+IP G R LILD + R
Sbjct  192  SKLGLEEYEKNFKKGHLTDFTLPLLTDSDLKDVNIPSGARRLILDHIKR  240



>ref|XP_001766099.1| predicted protein [Physcomitrella patens]
 gb|EDQ69158.1| predicted protein [Physcomitrella patens]
Length=233

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  299  AEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQV  120
            +ED  Y++++ +L  L L+KYEKNFK+G+LTD+TL LL DS+L+DV IPPGPRLLILD +
Sbjct  91   SEDKDYLRSKIMLEKLNLQKYEKNFKKGMLTDSTLHLLNDSSLRDVQIPPGPRLLILDHL  150

Query  119  HR  114
             R
Sbjct  151  KR  152


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -2

Query  776  KYNELASGVKAWLSKQSLPVEaafvtaasaAQGGVIGAILGNLSPDLQPT-PPPGANLDP  600
            K  +L   VK WL KQ   VE A VTA SA QGG IGA++G  S D+  T P P   L+P
Sbjct  19   KVKQLDQDVKVWLKKQPAAVEVALVTAGSAVQGGAIGALMGTFSADVVSTMPTPSPQLNP  78

Query  599  NAMATFNQAQ  570
             A A+  QA+
Sbjct  79   EAAASLQQAK  88



>gb|KIZ00921.1| hypothetical protein MNEG_7036 [Monoraphidium neglectum]
Length=98

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = -2

Query  308  QPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLIL  129
            +P  E+ +Y + + +L  LGL KYE N K+GLLTD T+ L    +L +  IPPGPRLLIL
Sbjct  3    KPDHEETEYAQGKYMLRVLGLHKYENNLKKGLLTDNTIMLWNAESLAEARIPPGPRLLIL  62

Query  128  DQV--HRNP  108
              +  +RNP
Sbjct  63   HHLDTYRNP  71



>ref|XP_009152191.1| PREDICTED: uncharacterized protein LOC103875426 [Brassica rapa]
Length=163

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 60/108 (56%), Gaps = 9/108 (8%)
 Frame = -2

Query  614  ANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFG  435
            A  +P A+A+ ++ Q       V AR+ + M+  ++GI  +++ +RGK+D+ S + +  G
Sbjct  60   ACRNPRALASLSRTQY----ARVWARDLSAMSAASSGIESIMRGIRGKDDLTSELVSGSG  115

Query  434  SGVMYSLVS-GMGGPDVVPA-ALTSGVFFALVQGGLFKLGQQFSQPPA  297
            SG+ +S VS G+ G    PA AL+    FA++ G  +KL +      A
Sbjct  116  SGLAFSFVSQGLKGQ---PAHALSWAAGFAVLSGAFYKLEETIRSRKA  160



>gb|KFK25352.1| hypothetical protein AALP_AA8G101700 [Arabis alpina]
Length=61

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  266  LLSGLGLEKYEKNFKRGlltdttlplltDSALKDVSIPPGPRLLILDQVHRNPDFRRK  93
            +L  LGLEK+EK F    LTD+ LPLLTD  LK+V IPPG RLLILD + R+P+   K
Sbjct  1    MLLKLGLEKFEKIFTDEHLTDSALPLLTDKTLKEVGIPPGARLLILDHIKRDPEIETK  58



>ref|XP_009380125.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM22-2-like [Musa acuminata subsp. malaccensis]
Length=209

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = -2

Query  542  ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD-VVPAALTS  366
            A+ FAV++GV++ +SC+LKR+RGK+DV ++  A   +G ++S     G P  ++ + LT 
Sbjct  87   AKTFAVLSGVHSLVSCLLKRLRGKDDVINAGIAGCCTGFVFSFP---GQPHALLQSCLTF  143

Query  365  GVFFALVQG  339
            G F ++++G
Sbjct  144  GAFSSIIEG  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730