BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001F13

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006451210.1|  hypothetical protein CICLE_v10008684mg           96.3    2e-20   
gb|KDP33703.1|  hypothetical protein JCGZ_07274                       96.3    2e-20   Jatropha curcas
ref|XP_006451209.1|  hypothetical protein CICLE_v10008684mg           95.9    2e-20   Citrus clementina [clementine]
ref|XP_010100638.1|  hypothetical protein L484_002738                 94.7    8e-20   Morus notabilis
ref|XP_008242571.1|  PREDICTED: transcription factor bHLH68           94.7    8e-20   Prunus mume [ume]
ref|XP_002514268.1|  transcription factor, putative                   94.4    1e-19   Ricinus communis
emb|CDP03300.1|  unnamed protein product                              93.6    2e-19   Coffea canephora [robusta coffee]
ref|XP_003530506.1|  PREDICTED: transcription factor bHLH68 isofo...  93.2    2e-19   Glycine max [soybeans]
ref|XP_007160320.1|  hypothetical protein PHAVU_002G311700g           93.2    3e-19   Phaseolus vulgaris [French bean]
ref|XP_008462745.1|  PREDICTED: transcription factor bHLH68 isofo...  93.2    3e-19   Cucumis melo [Oriental melon]
ref|XP_003530507.1|  PREDICTED: transcription factor bHLH68 isofo...  93.2    3e-19   Glycine max [soybeans]
ref|XP_004171254.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  93.2    4e-19   
ref|XP_008462742.1|  PREDICTED: transcription factor bHLH68 isofo...  93.2    4e-19   Cucumis melo [Oriental melon]
ref|XP_004142511.1|  PREDICTED: transcription factor bHLH68-like      93.2    4e-19   Cucumis sativus [cucumbers]
ref|XP_007204357.1|  hypothetical protein PRUPE_ppa007164mg           92.8    4e-19   Prunus persica
ref|XP_007013110.1|  Basic helix-loop-helix DNA-binding superfami...  91.7    9e-19   
ref|XP_006341273.1|  PREDICTED: transcription factor bHLH68-like ...  90.9    1e-18   Solanum tuberosum [potatoes]
ref|XP_003630773.1|  Transcription factor bHLH68                      89.7    2e-18   
ref|XP_006341272.1|  PREDICTED: transcription factor bHLH68-like ...  90.9    2e-18   Solanum tuberosum [potatoes]
ref|XP_011078299.1|  PREDICTED: transcription factor bHLH68           90.5    2e-18   Sesamum indicum [beniseed]
ref|XP_009336860.1|  PREDICTED: transcription factor bHLH68-like ...  90.9    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_009352503.1|  PREDICTED: transcription factor bHLH68-like      90.9    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_009620310.1|  PREDICTED: transcription factor bHLH68           90.5    2e-18   Nicotiana tomentosiformis
ref|XP_004503451.1|  PREDICTED: transcription factor bHLH68-like ...  89.7    2e-18   
gb|KJB64955.1|  hypothetical protein B456_010G073600                  89.7    4e-18   Gossypium raimondii
emb|CAN77172.1|  hypothetical protein VITISV_041271                   89.7    4e-18   Vitis vinifera
gb|KHN41646.1|  Transcription factor bHLH68                           89.7    4e-18   Glycine soja [wild soybean]
ref|XP_002284145.1|  PREDICTED: transcription factor bHLH68           89.7    4e-18   Vitis vinifera
ref|XP_006579394.1|  PREDICTED: uncharacterized protein LOC100777...  89.7    4e-18   Glycine max [soybeans]
ref|XP_006579393.1|  PREDICTED: uncharacterized protein LOC100777...  89.7    5e-18   Glycine max [soybeans]
gb|KJB64953.1|  hypothetical protein B456_010G073600                  89.0    7e-18   Gossypium raimondii
ref|XP_004503450.1|  PREDICTED: transcription factor bHLH68-like ...  88.6    8e-18   Cicer arietinum [garbanzo]
ref|XP_006283829.1|  hypothetical protein CARUB_v10004930mg           89.7    8e-18   Capsella rubella
ref|XP_009777548.1|  PREDICTED: transcription factor bHLH68           88.2    1e-17   Nicotiana sylvestris
gb|AFK45495.1|  unknown                                               87.8    2e-17   Medicago truncatula
gb|ACN21652.1|  putative basic helix-loop-helix protein BHLH16        86.3    2e-17   Lotus japonicus
ref|XP_008367900.1|  PREDICTED: transcription factor bHLH68-like ...  88.6    2e-17   
gb|AFK44804.1|  unknown                                               86.3    2e-17   Lotus japonicus
ref|XP_011464892.1|  PREDICTED: transcription factor bHLH68           88.2    2e-17   Fragaria vesca subsp. vesca
ref|XP_010249647.1|  PREDICTED: transcription factor bHLH68-like      87.4    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010254048.1|  PREDICTED: transcription factor bHLH68-like      86.7    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010540965.1|  PREDICTED: transcription factor bHLH68-like      87.4    5e-17   Tarenaya hassleriana [spider flower]
emb|CDX92915.1|  BnaC07g41730D                                        87.0    5e-17   
emb|CAC14433.1|  putative protein                                     87.0    5e-17   Brassica napus [oilseed rape]
ref|XP_009128996.1|  PREDICTED: transcription factor bHLH68-like      87.0    6e-17   Brassica rapa
ref|XP_009137827.1|  PREDICTED: transcription factor bHLH68           86.7    7e-17   Brassica rapa
ref|XP_010049661.1|  PREDICTED: transcription factor bHLH68-like      86.3    8e-17   Eucalyptus grandis [rose gum]
ref|XP_010438345.1|  PREDICTED: transcription factor bHLH68-like      86.7    9e-17   Camelina sativa [gold-of-pleasure]
gb|AEL97574.1|  bHLH                                                  84.7    2e-16   Epimedium sagittatum
ref|XP_010323419.1|  PREDICTED: transcription factor bHLH68-like      84.7    2e-16   Solanum lycopersicum
ref|XP_002869453.1|  hypothetical protein ARALYDRAFT_913602           85.5    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010915877.1|  PREDICTED: transcription factor bHLH68-like ...  84.0    3e-16   Elaeis guineensis
emb|CBI36109.3|  unnamed protein product                              84.0    4e-16   Vitis vinifera
ref|XP_002284327.1|  PREDICTED: transcription factor bHLH68-like      84.0    4e-16   Vitis vinifera
ref|XP_010915876.1|  PREDICTED: transcription factor bHLH68-like ...  84.0    4e-16   Elaeis guineensis
emb|CDX97479.1|  BnaC08g13440D                                        84.7    5e-16   
ref|XP_004513012.1|  PREDICTED: transcription factor bHLH68-like      83.6    6e-16   Cicer arietinum [garbanzo]
gb|ACJ84971.1|  unknown                                               79.7    6e-16   Medicago truncatula
ref|XP_007152861.1|  hypothetical protein PHAVU_004G166300g           83.6    6e-16   Phaseolus vulgaris [French bean]
ref|NP_194639.1|  transcription factor bHLH68                         84.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228481.1|  PREDICTED: transcription factor bHLH68-like ...  83.2    7e-16   Prunus mume [ume]
ref|XP_008228480.1|  PREDICTED: transcription factor bHLH68-like ...  83.2    8e-16   Prunus mume [ume]
ref|XP_010433137.1|  PREDICTED: transcription factor bHLH68-like ...  84.0    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006412879.1|  hypothetical protein EUTSA_v10025359mg           83.6    1e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010447890.1|  PREDICTED: transcription factor bHLH68 isofo...  83.6    1e-15   Camelina sativa [gold-of-pleasure]
gb|KJB07196.1|  hypothetical protein B456_001G007000                  82.0    1e-15   Gossypium raimondii
gb|KFK29460.1|  hypothetical protein AALP_AA7G137200                  83.2    1e-15   Arabis alpina [alpine rockcress]
ref|XP_003637888.1|  Transcription factor bHLH68                      81.3    2e-15   
ref|XP_002325008.2|  hypothetical protein POPTR_0018s09060g           82.0    2e-15   Populus trichocarpa [western balsam poplar]
gb|ABK94460.1|  unknown                                               82.0    3e-15   Populus trichocarpa [western balsam poplar]
gb|KHG20931.1|  Transcription factor bHLH68 -like protein             82.0    3e-15   Gossypium arboreum [tree cotton]
ref|XP_007135661.1|  hypothetical protein PHAVU_010G147600g           81.3    3e-15   Phaseolus vulgaris [French bean]
gb|KHG13996.1|  Transcription factor bHLH68 -like protein             81.6    3e-15   Gossypium arboreum [tree cotton]
gb|EYU32948.1|  hypothetical protein MIMGU_mgv1a013049mg              80.5    4e-15   Erythranthe guttata [common monkey flower]
ref|XP_010925897.1|  PREDICTED: transcription factor bHLH68-like      81.3    4e-15   Elaeis guineensis
gb|KEH27144.1|  BHLH transcription factor-like protein                80.9    4e-15   Medicago truncatula
gb|AFK35850.1|  unknown                                               80.9    4e-15   Medicago truncatula
gb|KJB07195.1|  hypothetical protein B456_001G007000                  81.6    4e-15   Gossypium raimondii
gb|KJB07197.1|  hypothetical protein B456_001G007000                  81.6    4e-15   Gossypium raimondii
gb|KDP37262.1|  hypothetical protein JCGZ_06318                       80.9    5e-15   Jatropha curcas
ref|NP_001240881.1|  uncharacterized protein LOC100786555             80.9    5e-15   Glycine max [soybeans]
ref|XP_002516005.1|  transcription factor, putative                   80.1    9e-15   Ricinus communis
ref|XP_010526460.1|  PREDICTED: transcription factor bHLH68-like ...  80.5    1e-14   Tarenaya hassleriana [spider flower]
ref|NP_179600.2|  transcription factor bHLH133                        79.7    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783244.1|  PREDICTED: transcription factor bHLH68-like      79.3    2e-14   Phoenix dactylifera
ref|XP_004486757.1|  PREDICTED: transcription factor bHLH68-like      79.3    2e-14   Cicer arietinum [garbanzo]
gb|KDO66447.1|  hypothetical protein CISIN_1g042078mg                 76.3    2e-14   Citrus sinensis [apfelsine]
ref|XP_002886001.1|  hypothetical protein ARALYDRAFT_480460           79.3    2e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_006583063.1|  PREDICTED: transcription factor bHLH68-like ...  78.6    2e-14   Glycine max [soybeans]
ref|XP_006583061.1|  PREDICTED: transcription factor bHLH68-like ...  78.6    3e-14   Glycine max [soybeans]
gb|ACJ85397.1|  unknown                                               78.6    3e-14   Medicago truncatula
ref|XP_003597718.1|  Transcription factor bHLH68                      78.2    4e-14   
gb|AES67968.2|  BHLH transcription factor-like protein                78.2    4e-14   Medicago truncatula
gb|AFK49339.1|  unknown                                               78.2    5e-14   Medicago truncatula
ref|XP_003597717.1|  Transcription factor bHLH68                      78.2    5e-14   
ref|XP_003531664.1|  PREDICTED: transcription factor bHLH68-like ...  77.8    6e-14   Glycine max [soybeans]
ref|XP_006585586.1|  PREDICTED: transcription factor bHLH68-like ...  77.8    6e-14   Glycine max [soybeans]
ref|XP_010691374.1|  PREDICTED: transcription factor bHLH68-like      78.2    8e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011048370.1|  PREDICTED: transcription factor bHLH68           77.4    8e-14   Populus euphratica
ref|XP_010490296.1|  PREDICTED: transcription factor bHLH133-like     76.6    9e-14   
ref|XP_006297999.1|  hypothetical protein CARUB_v10014044mg           77.0    1e-13   Capsella rubella
ref|XP_006451208.1|  hypothetical protein CICLE_v10008684mg           75.9    4e-13   Citrus clementina [clementine]
ref|XP_010433138.1|  PREDICTED: transcription factor bHLH68-like ...  76.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010467937.1|  PREDICTED: transcription factor bHLH133          75.9    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010526459.1|  PREDICTED: transcription factor bHLH68-like ...  75.9    4e-13   Tarenaya hassleriana [spider flower]
ref|XP_010447891.1|  PREDICTED: transcription factor bHLH68 isofo...  76.3    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010416299.1|  PREDICTED: transcription factor bHLH133-like     75.5    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009117507.1|  PREDICTED: transcription factor bHLH133          74.7    1e-12   Brassica rapa
emb|CDX81959.1|  BnaC08g36420D                                        74.3    1e-12   
ref|XP_006465638.1|  PREDICTED: transcription factor bHLH68-like ...  73.2    3e-12   Citrus sinensis [apfelsine]
ref|XP_006465639.1|  PREDICTED: transcription factor bHLH68-like ...  73.2    3e-12   
gb|KDO56950.1|  hypothetical protein CISIN_1g019574mg                 72.8    4e-12   Citrus sinensis [apfelsine]
gb|KDO56951.1|  hypothetical protein CISIN_1g019574mg                 72.8    4e-12   Citrus sinensis [apfelsine]
ref|XP_006426930.1|  hypothetical protein CICLE_v10026009mg           72.8    4e-12   Citrus clementina [clementine]
gb|KFK40379.1|  hypothetical protein AALP_AA3G365900                  72.8    5e-12   Arabis alpina [alpine rockcress]
ref|XP_008462744.1|  PREDICTED: transcription factor bHLH68 isofo...  72.8    6e-12   
ref|NP_001240956.1|  uncharacterized protein LOC100777095             71.6    1e-11   Glycine max [soybeans]
ref|XP_006833385.1|  hypothetical protein AMTR_s00109p00114170        70.9    2e-11   Amborella trichopoda
gb|EEC72912.1|  hypothetical protein OsI_06741                        71.6    2e-11   Oryza sativa Indica Group [Indian rice]
gb|EEE56732.1|  hypothetical protein OsJ_06238                        71.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046546.1|  Os02g0276900                                     71.6    2e-11   
dbj|BAD21818.1|  ethylene-responsive family protein-like              71.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KJB64954.1|  hypothetical protein B456_010G073600                  70.5    2e-11   Gossypium raimondii
ref|XP_009336861.1|  PREDICTED: transcription factor bHLH68-like ...  70.9    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_010924573.1|  PREDICTED: transcription factor bHLH68-like      70.1    4e-11   
ref|XP_006647157.1|  PREDICTED: transcription factor bHLH68-like      70.5    4e-11   Oryza brachyantha
gb|KJB64952.1|  hypothetical protein B456_010G073600                  69.3    5e-11   Gossypium raimondii
ref|XP_004952222.1|  PREDICTED: transcription factor bHLH68-like ...  68.9    1e-10   Setaria italica
ref|XP_006408924.1|  hypothetical protein EUTSA_v10002020mg           68.6    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_004952223.1|  PREDICTED: transcription factor bHLH68-like ...  68.6    2e-10   Setaria italica
ref|XP_008793073.1|  PREDICTED: transcription factor bHLH68-like ...  67.8    2e-10   Phoenix dactylifera
emb|CDY14219.1|  BnaA08g13500D                                        67.8    3e-10   Brassica napus [oilseed rape]
ref|XP_009109051.1|  PREDICTED: transcription factor bHLH68-like      67.8    3e-10   Brassica rapa
ref|XP_008228482.1|  PREDICTED: transcription factor bHLH68-like ...  67.0    4e-10   Prunus mume [ume]
ref|XP_008462743.1|  PREDICTED: transcription factor bHLH68 isofo...  67.4    5e-10   
ref|XP_002453693.1|  hypothetical protein SORBIDRAFT_04g010670        67.0    6e-10   Sorghum bicolor [broomcorn]
ref|XP_010688253.1|  PREDICTED: transcription factor bHLH68           66.6    8e-10   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY48596.1|  BnaA01g07690D                                        66.2    9e-10   Brassica napus [oilseed rape]
ref|XP_008793074.1|  PREDICTED: transcription factor bHLH68-like ...  65.9    1e-09   Phoenix dactylifera
ref|XP_010234138.1|  PREDICTED: transcription factor bHLH133          66.2    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_011072388.1|  PREDICTED: transcription factor bHLH68-like ...  65.1    2e-09   Sesamum indicum [beniseed]
ref|XP_004960654.1|  PREDICTED: transcription factor bHLH68-like      65.1    3e-09   Setaria italica
ref|XP_009409063.1|  PREDICTED: transcription factor bHLH68-like ...  63.2    4e-09   
gb|AFW82070.1|  putative HLH DNA-binding domain superfamily protein   60.5    6e-09   
ref|XP_009380568.1|  PREDICTED: transcription factor bHLH68-like ...  63.5    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380567.1|  PREDICTED: transcription factor bHLH68-like ...  63.2    8e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD24387.1|  unknown protein                                       58.9    9e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90320.1|  predicted protein                                    63.2    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009409062.1|  PREDICTED: transcription factor bHLH68-like ...  62.8    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS45220.1|  hypothetical protein TRIUR3_20954                     59.3    1e-08   Triticum urartu
ref|XP_009409460.1|  PREDICTED: transcription factor bHLH68-like ...  62.4    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409459.1|  PREDICTED: transcription factor bHLH68-like ...  62.4    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008342665.1|  PREDICTED: transcription factor bHLH68-like      62.0    2e-08   Malus domestica [apple tree]
ref|XP_008654609.1|  PREDICTED: uncharacterized protein LOC100273...  61.6    5e-08   Zea mays [maize]
ref|XP_006655114.1|  PREDICTED: transcription factor bHLH68-like      61.6    5e-08   Oryza brachyantha
ref|NP_001141763.1|  uncharacterized protein LOC100273899             61.2    5e-08   Zea mays [maize]
gb|AFW70908.1|  putative HLH DNA-binding domain superfamily protein   61.2    6e-08   
ref|XP_003568722.1|  PREDICTED: transcription factor bHLH68           60.8    6e-08   Brachypodium distachyon [annual false brome]
ref|XP_009405732.1|  PREDICTED: transcription factor bHLH68-like ...  60.5    8e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054971.2|  Os05g0228400                                     59.7    8e-08   
ref|XP_009381048.1|  PREDICTED: transcription factor bHLH68-like ...  59.3    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009377815.1|  PREDICTED: transcription factor bHLH68-like      59.3    2e-07   Pyrus x bretschneideri [bai li]
gb|EEC78747.1|  hypothetical protein OsI_18962                        59.7    2e-07   Oryza sativa Indica Group [Indian rice]
gb|EYU21476.1|  hypothetical protein MIMGU_mgv1a014445mg              57.8    2e-07   Erythranthe guttata [common monkey flower]
gb|EEE62815.1|  hypothetical protein OsJ_17618                        59.3    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440827.1|  hypothetical protein SORBIDRAFT_09g007650        59.3    2e-07   Sorghum bicolor [broomcorn]
ref|XP_007024222.1|  Basic helix-loop-helix DNA-binding superfami...  58.2    5e-07   
gb|KJB70440.1|  hypothetical protein B456_011G073400                  58.2    5e-07   Gossypium raimondii
dbj|BAK06025.1|  predicted protein                                    58.5    5e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001136733.1|  uncharacterized protein LOC100216872             58.2    5e-07   Zea mays [maize]
ref|XP_008681289.1|  PREDICTED: uncharacterized protein LOC100216...  57.8    7e-07   Zea mays [maize]
ref|XP_008681290.1|  PREDICTED: uncharacterized protein LOC100216...  57.8    7e-07   Zea mays [maize]
gb|AFW70909.1|  putative HLH DNA-binding domain superfamily protein   57.8    7e-07   
ref|XP_009381049.1|  PREDICTED: transcription factor bHLH68-like ...  57.4    8e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789390.1|  PREDICTED: uncharacterized protein LOC103706900  56.2    9e-07   
ref|XP_010920705.1|  PREDICTED: transcription factor bHLH68-like      56.6    2e-06   Elaeis guineensis
ref|XP_004150346.1|  PREDICTED: uncharacterized protein LOC101221798  56.2    2e-06   
ref|XP_002299721.1|  hypothetical protein POPTR_0001s18660g           55.8    2e-06   Populus trichocarpa [western balsam poplar]
gb|KHM98740.1|  Transcription factor bHLH68                           55.8    2e-06   Glycine soja [wild soybean]
ref|XP_006597160.1|  PREDICTED: transcription factor bHLH68-like ...  55.8    3e-06   Glycine max [soybeans]
ref|XP_006849290.1|  hypothetical protein AMTR_s00167p00019840        53.9    3e-06   
gb|KHG21853.1|  Transcription factor bHLH68 -like protein             55.5    4e-06   Gossypium arboreum [tree cotton]
ref|XP_009353586.1|  PREDICTED: transcription factor bHLH68-like ...  54.7    6e-06   
ref|XP_002982885.1|  hypothetical protein SELMODRAFT_117274           52.0    6e-06   
ref|XP_009380570.1|  PREDICTED: transcription factor bHLH68-like ...  54.7    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009353584.1|  PREDICTED: transcription factor bHLH68-like ...  54.7    6e-06   
ref|XP_010047918.1|  PREDICTED: transcription factor bHLH68           54.7    7e-06   Eucalyptus grandis [rose gum]
ref|XP_009353583.1|  PREDICTED: transcription factor bHLH68-like ...  54.7    7e-06   Pyrus x bretschneideri [bai li]
ref|XP_010647962.1|  PREDICTED: uncharacterized protein LOC100249...  54.3    7e-06   Vitis vinifera
ref|XP_010923558.1|  PREDICTED: transcription factor bHLH113-like...  53.9    7e-06   Elaeis guineensis
ref|XP_010098101.1|  hypothetical protein L484_026235                 54.7    7e-06   
emb|CBI22512.3|  unnamed protein product                              53.5    7e-06   Vitis vinifera
ref|XP_002976662.1|  hypothetical protein SELMODRAFT_28260            51.6    8e-06   
ref|XP_010923557.1|  PREDICTED: transcription factor bHLH113-like...  53.9    8e-06   Elaeis guineensis
ref|XP_002973190.1|  hypothetical protein SELMODRAFT_28262            51.6    8e-06   
ref|XP_010938699.1|  PREDICTED: transcription factor bHLH113          53.5    1e-05   Elaeis guineensis
emb|CDO98010.1|  unnamed protein product                              53.9    1e-05   Coffea canephora [robusta coffee]
gb|ACG44542.1|  hypothetical protein                                  51.2    1e-05   Zea mays [maize]
ref|XP_010647961.1|  PREDICTED: transcription factor bHLH113 isof...  53.5    1e-05   Vitis vinifera
ref|XP_002269988.1|  PREDICTED: transcription factor bHLH113 isof...  53.5    1e-05   Vitis vinifera
gb|KJB54234.1|  hypothetical protein B456_009G026600                  53.5    2e-05   Gossypium raimondii
ref|XP_009608011.1|  PREDICTED: transcription factor bHLH68-like      53.5    2e-05   Nicotiana tomentosiformis
ref|XP_009400139.1|  PREDICTED: transcription factor bHLH112-like     51.6    2e-05   
gb|KJB54235.1|  hypothetical protein B456_009G026600                  53.5    2e-05   Gossypium raimondii
ref|XP_007215744.1|  hypothetical protein PRUPE_ppa009187mg           53.1    2e-05   
emb|CAN67722.1|  hypothetical protein VITISV_006021                   53.1    3e-05   Vitis vinifera
ref|XP_011010531.1|  PREDICTED: transcription factor bHLH68-like ...  52.8    3e-05   Populus euphratica
ref|XP_011010532.1|  PREDICTED: transcription factor bHLH68-like ...  52.4    4e-05   Populus euphratica
ref|XP_010271336.1|  PREDICTED: transcription factor bHLH113          52.4    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_002304211.1|  hypothetical protein POPTR_0003s05010g           52.4    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006605977.1|  PREDICTED: transcription factor bHLH113-like...  51.2    4e-05   
ref|NP_001142173.1|  uncharacterized protein LOC100274340             52.0    6e-05   Zea mays [maize]
gb|KHG01483.1|  Transcription factor bHLH68 -like protein             51.6    7e-05   Gossypium arboreum [tree cotton]
ref|XP_009628050.1|  PREDICTED: transcription factor bHLH68-like ...  51.2    9e-05   Nicotiana tomentosiformis
ref|XP_011008318.1|  PREDICTED: transcription factor bHLH68-like ...  51.2    1e-04   Populus euphratica
ref|XP_009628051.1|  PREDICTED: transcription factor bHLH68-like ...  51.2    1e-04   Nicotiana tomentosiformis
ref|XP_006605976.1|  PREDICTED: transcription factor bHLH113-like...  50.8    1e-04   
ref|XP_003555279.1|  PREDICTED: transcription factor bHLH113-like...  50.8    1e-04   Glycine max [soybeans]
ref|XP_006605975.1|  PREDICTED: transcription factor bHLH113-like...  50.8    1e-04   Glycine max [soybeans]
gb|KJB54236.1|  hypothetical protein B456_009G026600                  50.8    1e-04   Gossypium raimondii
gb|KHN42348.1|  Transcription factor bHLH113                          50.4    2e-04   Glycine soja [wild soybean]
ref|XP_010062499.1|  PREDICTED: transcription factor bHLH68-like ...  50.8    2e-04   
ref|XP_009419079.1|  PREDICTED: transcription factor bHLH113-like     50.1    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002527479.1|  transcription factor, putative                   50.1    2e-04   
ref|XP_008787215.1|  PREDICTED: transcription factor bHLH113-like     49.3    2e-04   
ref|XP_004241741.1|  PREDICTED: transcription factor bHLH68-like ...  49.7    3e-04   Solanum lycopersicum
ref|XP_008447522.1|  PREDICTED: transcription factor bHLH68-like ...  49.3    5e-04   Cucumis melo [Oriental melon]
ref|XP_006847529.1|  hypothetical protein AMTR_s00014p00103240        49.3    5e-04   
ref|XP_007042552.1|  Basic helix-loop-helix DNA-binding superfami...  48.9    5e-04   
ref|XP_007201519.1|  hypothetical protein PRUPE_ppa015566mg           48.9    5e-04   Prunus persica
ref|XP_008236390.1|  PREDICTED: transcription factor bHLH113          48.9    5e-04   Prunus mume [ume]
ref|XP_004496925.1|  PREDICTED: transcription factor bHLH113-like...  48.9    6e-04   Cicer arietinum [garbanzo]
ref|XP_004496926.1|  PREDICTED: transcription factor bHLH113-like...  48.9    6e-04   Cicer arietinum [garbanzo]
ref|XP_008447524.1|  PREDICTED: transcription factor bHLH68-like ...  49.3    6e-04   
ref|XP_004232764.1|  PREDICTED: transcription factor bHLH112          48.9    6e-04   Solanum lycopersicum
ref|XP_008785926.1|  PREDICTED: transcription factor bHLH113-like     48.5    7e-04   
gb|KDP44432.1|  hypothetical protein JCGZ_16265                       47.8    7e-04   Jatropha curcas
ref|XP_009774580.1|  PREDICTED: transcription factor bHLH68-like ...  48.9    7e-04   Nicotiana sylvestris
ref|XP_009774581.1|  PREDICTED: transcription factor bHLH68-like ...  48.5    8e-04   Nicotiana sylvestris
emb|CDO97231.1|  unnamed protein product                              48.1    8e-04   Coffea canephora [robusta coffee]
ref|XP_006406495.1|  hypothetical protein EUTSA_v10021324mg           48.5    0.001   Eutrema salsugineum [saltwater cress]
dbj|BAH30460.1|  hypothetical protein                                 45.8    0.001   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_006451210.1| hypothetical protein CICLE_v10008684mg [Citrus clementina]
 gb|ESR64450.1| hypothetical protein CICLE_v10008684mg [Citrus clementina]
Length=373

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG SDH   Q   EE  K LRSRG CLVP+S T QVG DN
Sbjct  302  RNCIFPEDPGQLLNDNCMKRKGTSDH---QESQEEVKKSLRSRGLCLVPVSCTLQVGSDN  358

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  359  GADYWAP  365



>gb|KDP33703.1| hypothetical protein JCGZ_07274 [Jatropha curcas]
Length=376

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG SD   PQ  +EE  KDLRSRG CLVP+S T QVG DN
Sbjct  307  RNCIFPEDPGQLLNDNCIKRKGASD---PQHYNEEQKKDLRSRGLCLVPVSCTLQVGSDN  363

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  364  GADYWAP  370



>ref|XP_006451209.1| hypothetical protein CICLE_v10008684mg [Citrus clementina]
 ref|XP_006475662.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Citrus 
sinensis]
 gb|ESR64449.1| hypothetical protein CICLE_v10008684mg [Citrus clementina]
Length=363

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG SDH   Q   EE  K LRSRG CLVP+S T QVG DN
Sbjct  292  RNCIFPEDPGQLLNDNCMKRKGTSDH---QESQEEVKKSLRSRGLCLVPVSCTLQVGSDN  348

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  349  GADYWAP  355



>ref|XP_010100638.1| hypothetical protein L484_002738 [Morus notabilis]
 gb|EXB83503.1| hypothetical protein L484_002738 [Morus notabilis]
Length=375

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG  DH   Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  305  RNCMFPEDPGQLLNDNCMKRKGAPDH---QDSLEEQKKDLRSRGLCLVPVSCTLQVGSDN  361

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  362  GADYWAP  368



>ref|XP_008242571.1| PREDICTED: transcription factor bHLH68 [Prunus mume]
Length=382

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG  +    Q  DEEA KDLRSRG CLVP+S T QVG DN
Sbjct  313  RNCMFPEDPGQLLNDNCMKRKGAPE----QDADEEAKKDLRSRGLCLVPVSCTLQVGSDN  368

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  369  GADYWAP  375



>ref|XP_002514268.1| transcription factor, putative [Ricinus communis]
 gb|EEF48222.1| transcription factor, putative [Ricinus communis]
Length=363

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG SD    Q  +EE  KDLRSRG CLVP+S T QVG DN
Sbjct  293  RNCIFPEDPGQLLNDNCIKRKGASDQ---QDCNEEPKKDLRSRGLCLVPVSCTLQVGSDN  349

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  350  GADYWAP  356



>emb|CDP03300.1| unnamed protein product [Coffea canephora]
Length=332

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN LFPEDPGQLL  NC+KRK  S+    Q  +EE  KDLRSRG CLVPIS T QVG DN
Sbjct  263  RNCLFPEDPGQLLNDNCMKRKAASE----QDSEEEVKKDLRSRGLCLVPISCTLQVGSDN  318

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  319  GADYWAP  325



>ref|XP_003530506.1| PREDICTED: transcription factor bHLH68 isoform 1 [Glycine max]
 gb|KHN16614.1| Transcription factor bHLH68 [Glycine soja]
Length=347

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N +FPEDPGQLL  NCLKRK  S     Q   EEA KDLRSRG CLVP+S T QVG DN
Sbjct  277  KNCIFPEDPGQLLNENCLKRKAASSEQDSQ---EEANKDLRSRGLCLVPVSCTLQVGSDN  333

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  334  GADYWAP  340



>ref|XP_007160320.1| hypothetical protein PHAVU_002G311700g [Phaseolus vulgaris]
 gb|ESW32314.1| hypothetical protein PHAVU_002G311700g [Phaseolus vulgaris]
Length=347

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N +FPEDPGQLL  NCLKRK  S+    Q  +EEA KDLRSRG CLVP+S T QVG +N
Sbjct  277  KNCIFPEDPGQLLNENCLKRKATSEQ---QDSEEEAKKDLRSRGLCLVPVSCTLQVGSEN  333

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  334  GADYWAP  340



>ref|XP_008462745.1| PREDICTED: transcription factor bHLH68 isoform X4 [Cucumis melo]
Length=368

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 6/67 (9%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NCLKRKG S+       +EE  KDLRSRG CLVP+S T QVG DN
Sbjct  296  RNCVFPEDPGQLLNENCLKRKGVSEQ------EEEGKKDLRSRGLCLVPVSCTLQVGSDN  349

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  350  GADYWAP  356



>ref|XP_003530507.1| PREDICTED: transcription factor bHLH68 isoform 2 [Glycine max]
Length=374

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N +FPEDPGQLL  NCLKRK  S     Q   EEA KDLRSRG CLVP+S T QVG DN
Sbjct  304  KNCIFPEDPGQLLNENCLKRKAASSEQDSQ---EEANKDLRSRGLCLVPVSCTLQVGSDN  360

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  361  GADYWAP  367



>ref|XP_004171254.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH68-like 
[Cucumis sativus]
Length=393

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 6/67 (9%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NCLKRKG S+       +EE  KDLRSRG CLVP+S T QVG DN
Sbjct  321  RNCVFPEDPGQLLNENCLKRKGVSEQ------EEEGKKDLRSRGLCLVPVSCTLQVGSDN  374

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  375  GADYWAP  381



>ref|XP_008462742.1| PREDICTED: transcription factor bHLH68 isoform X1 [Cucumis melo]
Length=390

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 6/67 (9%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NCLKRKG S+       +EE  KDLRSRG CLVP+S T QVG DN
Sbjct  318  RNCVFPEDPGQLLNENCLKRKGVSEQ------EEEGKKDLRSRGLCLVPVSCTLQVGSDN  371

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  372  GADYWAP  378



>ref|XP_004142511.1| PREDICTED: transcription factor bHLH68-like [Cucumis sativus]
 gb|KGN66822.1| hypothetical protein Csa_1G697530 [Cucumis sativus]
Length=394

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 6/67 (9%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NCLKRKG S+       +EE  KDLRSRG CLVP+S T QVG DN
Sbjct  322  RNCVFPEDPGQLLNENCLKRKGVSEQ------EEEGKKDLRSRGLCLVPVSCTLQVGSDN  375

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  376  GADYWAP  382



>ref|XP_007204357.1| hypothetical protein PRUPE_ppa007164mg [Prunus persica]
 gb|EMJ05556.1| hypothetical protein PRUPE_ppa007164mg [Prunus persica]
Length=379

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  +C+KRKG  +    Q  DEEA KDLRSRG CLVP+S T QVG DN
Sbjct  310  RNCMFPEDPGQLLNDHCMKRKGAPE----QDADEEAKKDLRSRGLCLVPVSCTLQVGSDN  365

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  366  GADYWAP  372



>ref|XP_007013110.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY30729.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=356

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG  D    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  286  RNCIFPEDPGQLLNDNCMKRKGGPDQ---QDSHEEPKKDLRSRGLCLVPVSCTLQVGSDN  342

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  343  GADYWAP  349



>ref|XP_006341273.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Solanum 
tuberosum]
Length=340

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNSLFPEDPGQL   NCLKRK  S+    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  271  RNSLFPEDPGQLSNDNCLKRKANSE----QDYQEEEKKDLRSRGLCLVPLSCTLQVGSDN  326

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  327  GADYWAP  333



>ref|XP_003630773.1| Transcription factor bHLH68 [Medicago truncatula]
Length=213

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N LFPEDPGQLL  NCLKRK   +    Q  +E+  KDLRSRG CLVP+S T QVG DN
Sbjct  144  KNCLFPEDPGQLLNENCLKRKAVRE----QVCEEKEKKDLRSRGLCLVPVSCTMQVGSDN  199

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  200  GADYWAP  206



>ref|XP_006341272.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Solanum 
tuberosum]
Length=359

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNSLFPEDPGQL   NCLKRK  S+    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  290  RNSLFPEDPGQLSNDNCLKRKANSE----QDYQEEEKKDLRSRGLCLVPLSCTLQVGSDN  345

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  346  GADYWAP  352



>ref|XP_011078299.1| PREDICTED: transcription factor bHLH68 [Sesamum indicum]
Length=348

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN LFPED GQL+  NC+KRKG S+       DEEA KDLRSRG CLVPIS T  VG DN
Sbjct  280  RNCLFPEDSGQLMNENCIKRKGISEE-----CDEEAKKDLRSRGLCLVPISCTLHVGSDN  334

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  335  GADYWAP  341



>ref|XP_009336860.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Pyrus 
x bretschneideri]
Length=390

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG S+    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  320  RNCMFPEDPGQLLNDNCMKRKGASE----QDPHEEPKKDLRSRGLCLVPVSCTLQVGSDN  375

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  376  GADYWAP  382



>ref|XP_009352503.1| PREDICTED: transcription factor bHLH68-like [Pyrus x bretschneideri]
Length=390

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG S+    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  320  RNCMFPEDPGQLLNDNCMKRKGASE----QDPHEEPKKDLRSRGLCLVPVSCTLQVGSDN  375

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  376  GADYWAP  382



>ref|XP_009620310.1| PREDICTED: transcription factor bHLH68 [Nicotiana tomentosiformis]
Length=358

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNSLFPEDPGQL   NCLKR   S+ ++     EE+ KDLRSRG CLVP+S T QVG DN
Sbjct  289  RNSLFPEDPGQLSNDNCLKRMATSEQYY----HEESKKDLRSRGLCLVPLSCTLQVGSDN  344

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  345  GADYWAP  351



>ref|XP_004503451.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Cicer 
arietinum]
Length=247

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 48/70 (69%), Gaps = 5/70 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N +FPEDPGQLL   CLKRK  S+        EE  KDLRSRG CLVP+S T QVG +N
Sbjct  178  KNCIFPEDPGQLLNEKCLKRKAASEQEC-----EEEKKDLRSRGLCLVPVSCTLQVGSEN  232

Query  357  GAXYWAPXAF  328
            GA YWAP AF
Sbjct  233  GADYWAPAAF  242



>gb|KJB64955.1| hypothetical protein B456_010G073600 [Gossypium raimondii]
Length=352

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  N +KRKG  D    Q  DEE  KDLRSRG CLVP+S T QVG DN
Sbjct  287  RNCIFPEDPGQLLNENSMKRKGGPDR---QECDEEPKKDLRSRGLCLVPVSCTLQVGSDN  343

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  344  GADYWAP  350



>emb|CAN77172.1| hypothetical protein VITISV_041271 [Vitis vinifera]
Length=342

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  N +KRKG SD    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  273  RNCIFPEDPGQLLNDNGMKRKGASD----QESHEEPKKDLRSRGLCLVPVSCTLQVGSDN  328

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  329  GADYWAP  335



>gb|KHN41646.1| Transcription factor bHLH68 [Glycine soja]
Length=356

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FPEDPGQLL  NCLKRK  S+    Q   EE  KDLRSRG CLVP+S T QVG DNG
Sbjct  288  NCIFPEDPGQLLNENCLKRKAASE----QDSQEEQKKDLRSRGLCLVPVSCTLQVGSDNG  343

Query  354  AXYWAP  337
            A YWAP
Sbjct  344  ADYWAP  349



>ref|XP_002284145.1| PREDICTED: transcription factor bHLH68 [Vitis vinifera]
 emb|CBI28038.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  N +KRKG SD    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  273  RNCIFPEDPGQLLNDNGMKRKGASD----QESHEEPKKDLRSRGLCLVPVSCTLQVGSDN  328

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  329  GADYWAP  335



>ref|XP_006579394.1| PREDICTED: uncharacterized protein LOC100777095 isoform X2 [Glycine 
max]
Length=346

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FPEDPGQLL  NCLKRK  S+    Q   EE  KDLRSRG CLVP+S T QVG DNG
Sbjct  278  NCIFPEDPGQLLNENCLKRKAASE----QDSQEEPKKDLRSRGLCLVPVSCTLQVGSDNG  333

Query  354  AXYWAP  337
            A YWAP
Sbjct  334  ADYWAP  339



>ref|XP_006579393.1| PREDICTED: uncharacterized protein LOC100777095 isoform X1 [Glycine 
max]
Length=356

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FPEDPGQLL  NCLKRK  S+    Q   EE  KDLRSRG CLVP+S T QVG DNG
Sbjct  288  NCIFPEDPGQLLNENCLKRKAASE----QDSQEEPKKDLRSRGLCLVPVSCTLQVGSDNG  343

Query  354  AXYWAP  337
            A YWAP
Sbjct  344  ADYWAP  349



>gb|KJB64953.1| hypothetical protein B456_010G073600 [Gossypium raimondii]
Length=353

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  N +KRKG  D    +  DEE  KDLRSRG CLVP+S T QVG DN
Sbjct  287  RNCIFPEDPGQLLNENSMKRKGGPDRQ--KECDEEPKKDLRSRGLCLVPVSCTLQVGSDN  344

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  345  GADYWAP  351



>ref|XP_004503450.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Cicer 
arietinum]
Length=328

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 48/70 (69%), Gaps = 5/70 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N +FPEDPGQLL   CLKRK  S+        EE  KDLRSRG CLVP+S T QVG +N
Sbjct  259  KNCIFPEDPGQLLNEKCLKRKAASEQEC-----EEEKKDLRSRGLCLVPVSCTLQVGSEN  313

Query  357  GAXYWAPXAF  328
            GA YWAP AF
Sbjct  314  GADYWAPAAF  323



>ref|XP_006283829.1| hypothetical protein CARUB_v10004930mg [Capsella rubella]
 gb|EOA16727.1| hypothetical protein CARUB_v10004930mg [Capsella rubella]
Length=413

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R+ +FPEDPGQL+   C+KR+G S     Q   EE  KDLRSRG CLVPIS T QVG DN
Sbjct  339  RSCIFPEDPGQLVNDQCMKRRGASSSTDTQNASEEPKKDLRSRGLCLVPISCTLQVGSDN  398

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  399  GADYWAP  405



>ref|XP_009777548.1| PREDICTED: transcription factor bHLH68 [Nicotiana sylvestris]
Length=351

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNSLFPEDPGQL   NCLKRK  S+  +      E  KDLRSRG CLVP+S T QVG DN
Sbjct  283  RNSLFPEDPGQLSNDNCLKRKATSEQDY-----HEESKDLRSRGLCLVPLSCTLQVGSDN  337

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  338  GADYWAP  344



>gb|AFK45495.1| unknown [Medicago truncatula]
 gb|KEH21348.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=336

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N LFPEDPGQLL  NCLKRK   +    Q  +E+  KDLRSRG CLVP+S T QVG DN
Sbjct  267  KNCLFPEDPGQLLNENCLKRKAVRE----QVCEEKEKKDLRSRGLCLVPVSCTMQVGSDN  322

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  323  GADYWAP  329



>gb|ACN21652.1| putative basic helix-loop-helix protein BHLH16 [Lotus japonicus]
Length=188

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +NS+FPEDPGQLL  N LKRK        Q   EE+ KDLRSRG CLVP+S T QVG DN
Sbjct  119  KNSIFPEDPGQLLNENGLKRKATEG----QDSQEESKKDLRSRGLCLVPVSCTLQVGSDN  174

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  175  GADYWAP  181



>ref|XP_008367900.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Malus 
domestica]
Length=390

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRK  S+    Q   EE  KDLRSRG CLVP+S T QVG DN
Sbjct  320  RNCMFPEDPGQLLNDNCMKRKXASE----QDPHEEPKKDLRSRGLCLVPVSCTLQVGSDN  375

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  376  GADYWAP  382



>gb|AFK44804.1| unknown [Lotus japonicus]
Length=188

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +NS+FPEDPGQLL  N LKRK        Q   EE+ KDLRSRG CLVP+S T QVG DN
Sbjct  119  KNSIFPEDPGQLLNENGLKRKATEG----QDSQEESKKDLRSRGLCLVPVSCTLQVGSDN  174

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  175  GADYWAP  181



>ref|XP_011464892.1| PREDICTED: transcription factor bHLH68 [Fragaria vesca subsp. 
vesca]
Length=386

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+K KG +     Q   +E  KDLRSRG CLVP+S T QVG DN
Sbjct  315  RNCMFPEDPGQLLNDNCMKMKGVNSE---QDAYQEPKKDLRSRGLCLVPVSCTLQVGSDN  371

Query  357  GAXYWAPXAF  328
            GA YWAP A 
Sbjct  372  GADYWAPAAL  381



>ref|XP_010249647.1| PREDICTED: transcription factor bHLH68-like [Nelumbo nucifera]
Length=343

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KR+G  +    Q  ++E  KDLRSRG CLVPIS T  VG DN
Sbjct  274  RNCIFPEDPGQLLNDNCIKRRGAPE----QDSEDEPKKDLRSRGLCLVPISFTVHVGSDN  329

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  330  GADYWAP  336



>ref|XP_010254048.1| PREDICTED: transcription factor bHLH68-like [Nelumbo nucifera]
Length=344

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KR+G  +    Q  ++E  KDLRSRG CLVPIS T  VG DN
Sbjct  275  RNCIFPEDPGQLLNDNCIKRRGTPE----QDSEDEPKKDLRSRGLCLVPISCTLHVGSDN  330

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  331  GADYWAP  337



>ref|XP_010540965.1| PREDICTED: transcription factor bHLH68-like [Tarenaya hassleriana]
Length=399

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 5/71 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKG----XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV  370
            RN +FPEDPGQL+  +C+KR+G     SD  +P   +EE  KDLRSRG CLVP+S T QV
Sbjct  323  RNCIFPEDPGQLVNEHCMKRRGASSSSSDDQNPN-SNEEPKKDLRSRGLCLVPVSFTLQV  381

Query  369  GXDNGAXYWAP  337
            G DNGA YWAP
Sbjct  382  GSDNGADYWAP  392



>emb|CDX92915.1| BnaC07g41730D [Brassica napus]
Length=389

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKG-XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ LFPEDPGQL+   C+KR+G  S     Q   EE  KDLRSRG CLVPIS T QVG D
Sbjct  314  RSCLFPEDPGQLVTDQCVKRRGVSSSSSENQNAKEEPKKDLRSRGLCLVPISYTLQVGSD  373

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  374  NGADYWAP  381



>emb|CAC14433.1| putative protein [Brassica napus]
Length=389

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKG-XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ LFPEDPGQL+   C+KR+G  S     Q   EE  KDLRSRG CLVPIS T QVG D
Sbjct  314  RSCLFPEDPGQLVTDQCVKRRGVSSSSSENQNAKEEPKKDLRSRGLCLVPISYTLQVGSD  373

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  374  NGADYWAP  381



>ref|XP_009128996.1| PREDICTED: transcription factor bHLH68-like [Brassica rapa]
Length=402

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXS-DHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            RN LFPEDPGQLL   C+KR+  S      Q  +EE  KDLRSRG CLVPIS T QVG D
Sbjct  327  RNCLFPEDPGQLLNDQCMKRQEASFSSTETQNANEEPKKDLRSRGLCLVPISCTLQVGSD  386

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  387  NGADYWAP  394



>ref|XP_009137827.1| PREDICTED: transcription factor bHLH68 [Brassica rapa]
Length=389

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKG-XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ LFPEDPGQL+   C+KR+G  S     Q   EE  KDLRSRG CLVPIS T QVG D
Sbjct  314  RSCLFPEDPGQLVNDQCVKRRGASSSSSENQNAKEEPKKDLRSRGLCLVPISYTLQVGSD  373

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  374  NGADYWAP  381



>ref|XP_010049661.1| PREDICTED: transcription factor bHLH68-like [Eucalyptus grandis]
 gb|KCW82402.1| hypothetical protein EUGRSUZ_C03807 [Eucalyptus grandis]
Length=361

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC+KRKG  D    Q  + E  KDLRSRG CLVPI  T QVG + 
Sbjct  292  RNCIFPEDPGQLLNDNCMKRKGALD----QDTNHEEAKDLRSRGLCLVPIQCTMQVGNET  347

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  348  GADYWAP  354



>ref|XP_010438345.1| PREDICTED: transcription factor bHLH68-like [Camelina sativa]
Length=413

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXS----DHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV  370
            R+ +FPEDPGQL+   C+KR+G S    DH   Q  +EE  KDLRSRG CLVPIS T QV
Sbjct  338  RSCIFPEDPGQLVNDQCMKRRGASSSSTDH---QNANEEPKKDLRSRGLCLVPISCTLQV  394

Query  369  GXDNGAXYWAP  337
            G DNGA YWAP
Sbjct  395  GSDNGADYWAP  405



>gb|AEL97574.1| bHLH [Epimedium sagittatum]
Length=340

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 45/64 (70%), Gaps = 5/64 (8%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAX  349
            +FPEDPGQLL  NCLKRKG  D        E+  KDLRSRG CLVP+S T QVG DNGA 
Sbjct  275  IFPEDPGQLLNDNCLKRKGAPDQV-----TEDEPKDLRSRGLCLVPLSCTLQVGSDNGAD  329

Query  348  YWAP  337
            YWAP
Sbjct  330  YWAP  333



>ref|XP_010323419.1| PREDICTED: transcription factor bHLH68-like [Solanum lycopersicum]
Length=359

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN+LFPEDPGQL   N LKRK  S+    Q   E+  KDLRSRG CLVP+S T QVG DN
Sbjct  290  RNNLFPEDPGQLSNDNSLKRKANSE----QDYQEDKKKDLRSRGLCLVPLSCTLQVGSDN  345

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  346  GADYWAP  352



>ref|XP_002869453.1| hypothetical protein ARALYDRAFT_913602 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45712.1| hypothetical protein ARALYDRAFT_913602 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHH-HPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ +FPEDPGQL+   C+KR+G S      Q   EE  KDLRSRG CLVPIS T QVG D
Sbjct  331  RSCIFPEDPGQLVNDQCMKRRGASSSSTENQNASEEPKKDLRSRGLCLVPISCTLQVGSD  390

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  391  NGADYWAP  398



>ref|XP_010915877.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Elaeis 
guineensis]
Length=329

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC K++G  D    Q   +E  KDLRSRG CLVP+S T  VG DN
Sbjct  260  RNCIFPEDPGQLLNDNCTKKRGPPD----QDASDEPKKDLRSRGLCLVPVSCTLHVGSDN  315

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  316  GADYWAP  322



>emb|CBI36109.3| unnamed protein product [Vitis vinifera]
Length=329

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FP+DPGQLL  NCLKRKG + +   Q   ++A KDL+SRG CLVP+S T QVG DNG
Sbjct  261  NCIFPKDPGQLLNDNCLKRKGSAPN---QQDTQDAPKDLKSRGLCLVPVSCTQQVGSDNG  317

Query  354  AXYWAP  337
            A YW+P
Sbjct  318  ADYWSP  323



>ref|XP_002284327.1| PREDICTED: transcription factor bHLH68-like [Vitis vinifera]
Length=330

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FP+DPGQLL  NCLKRKG + +   Q   ++A KDL+SRG CLVP+S T QVG DNG
Sbjct  262  NCIFPKDPGQLLNDNCLKRKGSAPN---QQDTQDAPKDLKSRGLCLVPVSCTQQVGSDNG  318

Query  354  AXYWAP  337
            A YW+P
Sbjct  319  ADYWSP  324



>ref|XP_010915876.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Elaeis 
guineensis]
Length=346

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC K++G  D    Q   +E  KDLRSRG CLVP+S T  VG DN
Sbjct  277  RNCIFPEDPGQLLNDNCTKKRGPPD----QDASDEPKKDLRSRGLCLVPVSCTLHVGSDN  332

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  333  GADYWAP  339



>emb|CDX97479.1| BnaC08g13440D [Brassica napus]
Length=406

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHH-HPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ LFPEDPGQL+   C+KR+G S      Q  +EE  KDLRSRG CLVPIS T QVG D
Sbjct  331  RSCLFPEDPGQLVNDQCMKRRGASSSSTENQNANEEPKKDLRSRGLCLVPISCTLQVGSD  390

Query  360  NGAXYWA  340
            NGA YWA
Sbjct  391  NGADYWA  397



>ref|XP_004513012.1| PREDICTED: transcription factor bHLH68-like [Cicer arietinum]
Length=331

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N LFPEDPGQLL    LKRK   +       D+E+ KDLRSRG CLVP+S T QVG DN
Sbjct  262  KNCLFPEDPGQLLNEYSLKRKAAEEGSQ----DQESKKDLRSRGLCLVPVSCTIQVGNDN  317

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  318  GADYWAP  324



>gb|ACJ84971.1| unknown [Medicago truncatula]
Length=91

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 44/66 (67%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N LFPEDPGQLL  N LKRK   +        EE  KDL+SRG CLVP+S T QVG DNG
Sbjct  24   NCLFPEDPGQLLNENGLKRKAAEEVSQ-----EEPKKDLKSRGLCLVPVSCTLQVGNDNG  78

Query  354  AXYWAP  337
            A YWAP
Sbjct  79   ADYWAP  84



>ref|XP_007152861.1| hypothetical protein PHAVU_004G166300g [Phaseolus vulgaris]
 gb|ESW24855.1| hypothetical protein PHAVU_004G166300g [Phaseolus vulgaris]
Length=333

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 45/67 (67%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +N +FPEDPGQLL  NCLKRK   +        EE  K LRSRG CLVP+S T QVG DN
Sbjct  264  KNCIFPEDPGQLLNENCLKRKAAGEPDT----QEEQQKGLRSRGLCLVPVSCTLQVGSDN  319

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  320  GADYWAP  326



>ref|NP_194639.1| transcription factor bHLH68 [Arabidopsis thaliana]
 sp|Q8S3D1.2|BH068_ARATH RecName: Full=Transcription factor bHLH68; AltName: Full=Basic 
helix-loop-helix protein 68; Short=AtbHLH68; Short=bHLH 68; 
AltName: Full=Transcription factor EN 60; AltName: Full=bHLH 
transcription factor bHLH068 [Arabidopsis thaliana]
 gb|AAM10966.2|AF488634_1 putative bHLH transcription factor [Arabidopsis thaliana]
 emb|CAB43924.1| putative protein [Arabidopsis thaliana]
 emb|CAB79668.1| putative protein [Arabidopsis thaliana]
 gb|AAL91205.1| putative protein [Arabidopsis thaliana]
 gb|AAN15440.1| putative protein [Arabidopsis thaliana]
 gb|AEE85586.1| transcription factor bHLH68 [Arabidopsis thaliana]
Length=407

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHP-QXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ +FPEDPGQL+   C+KR+G S      Q   EE  KDLRSRG CLVPIS T QVG D
Sbjct  332  RSCIFPEDPGQLVNDQCMKRRGASSSSTDNQNASEEPKKDLRSRGLCLVPISCTLQVGSD  391

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  392  NGADYWAP  399



>ref|XP_008228481.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Prunus 
mume]
Length=336

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAX  349
            +FPEDPGQLL  NCLKRKG  + H      ++  KDLRS+G CLVP+S T  VG DNGA 
Sbjct  270  VFPEDPGQLLNDNCLKRKGAPNQH---PSSQDKAKDLRSKGLCLVPVSFTQHVGSDNGAD  326

Query  348  YWAP  337
            YWAP
Sbjct  327  YWAP  330



>ref|XP_008228480.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Prunus 
mume]
Length=342

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAX  349
            +FPEDPGQLL  NCLKRKG  + H      ++  KDLRS+G CLVP+S T  VG DNGA 
Sbjct  276  VFPEDPGQLLNDNCLKRKGAPNQH---PSSQDKAKDLRSKGLCLVPVSFTQHVGSDNGAD  332

Query  348  YWAP  337
            YWAP
Sbjct  333  YWAP  336



>ref|XP_010433137.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Camelina 
sativa]
Length=410

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSD-HHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            +FPEDPGQL+   C+KR+G S      Q  +E+  KDLRSRG CLVPIS T QVG DNGA
Sbjct  337  IFPEDPGQLVNDQCMKRRGASSLSTDNQNANEKPKKDLRSRGLCLVPISCTLQVGSDNGA  396

Query  351  XYWAPXAF  328
             YWAP A 
Sbjct  397  DYWAPAAL  404



>ref|XP_006412879.1| hypothetical protein EUTSA_v10025359mg [Eutrema salsugineum]
 dbj|BAJ33715.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54332.1| hypothetical protein EUTSA_v10025359mg [Eutrema salsugineum]
Length=404

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHP-QXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            +FPEDPGQL+   C+KR+G S      Q  +EE  KDLRSRG CLVP+S T QVG DNGA
Sbjct  332  IFPEDPGQLVNDQCMKRRGASSSSTDNQNANEEPKKDLRSRGLCLVPVSCTLQVGSDNGA  391

Query  351  XYWAP  337
             YWAP
Sbjct  392  DYWAP  396



>ref|XP_010447890.1| PREDICTED: transcription factor bHLH68 isoform X1 [Camelina sativa]
Length=408

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHP-QXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ +FPEDPGQL+   C+KR G S      Q  +EE  KDLRSRG CLVPIS T QVG D
Sbjct  333  RSCIFPEDPGQLVNDQCMKRIGASSSSTDNQNANEEPKKDLRSRGLCLVPISCTLQVGSD  392

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  393  NGADYWAP  400



>gb|KJB07196.1| hypothetical protein B456_001G007000 [Gossypium raimondii]
Length=278

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRK--GXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGX  364
            RN +FPEDPGQLL   C+K++  G +D    Q  +EE  K+L+SRG CLVPIS T QVG 
Sbjct  205  RNCIFPEDPGQLLNEKCMKKRKGGPADL---QDSNEEPKKNLKSRGLCLVPISCTLQVGS  261

Query  363  DNGAXYWAPXAF  328
            DNGA YWAP + 
Sbjct  262  DNGADYWAPPSL  273



>gb|KFK29460.1| hypothetical protein AALP_AA7G137200 [Arabis alpina]
Length=409

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 6/71 (8%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXS----DHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV  370
            R+S+FPEDPGQL+   C+KR+G S    D+ +P   +E   KDL+SRG CLVPIS T QV
Sbjct  333  RSSIFPEDPGQLVNDQCMKRRGVSSSSTDNQNP--NEEPKIKDLKSRGLCLVPISCTLQV  390

Query  369  GXDNGAXYWAP  337
            G DNGA YWAP
Sbjct  391  GSDNGADYWAP  401



>ref|XP_003637888.1| Transcription factor bHLH68 [Medicago truncatula]
Length=263

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 44/66 (67%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N LFPEDPGQLL  N LKRK   +        EE  KDL+SRG CLVP+S T QVG DNG
Sbjct  196  NCLFPEDPGQLLNENGLKRKAAEE-----VSQEEPKKDLKSRGLCLVPVSCTLQVGNDNG  250

Query  354  AXYWAP  337
            A YWAP
Sbjct  251  ADYWAP  256



>ref|XP_002325008.2| hypothetical protein POPTR_0018s09060g [Populus trichocarpa]
 gb|EEF03573.2| hypothetical protein POPTR_0018s09060g [Populus trichocarpa]
Length=350

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FPEDPGQLL  +C+KRKG S     Q       KDLRSRG CLVP+S T QVG DNG
Sbjct  283  NCIFPEDPGQLLNDSCIKRKGAS-----QQDSHGEPKDLRSRGLCLVPVSCTLQVGSDNG  337

Query  354  AXYWAP  337
            A YWAP
Sbjct  338  ADYWAP  343



>gb|ABK94460.1| unknown [Populus trichocarpa]
Length=350

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FPEDPGQLL  +C+KRKG S     Q       KDLRSRG CLVP+S T QVG DNG
Sbjct  283  NCIFPEDPGQLLNDSCIKRKGAS-----QQDSHGEPKDLRSRGLCLVPVSCTLQVGSDNG  337

Query  354  AXYWAP  337
            A YWAP
Sbjct  338  ADYWAP  343



>gb|KHG20931.1| Transcription factor bHLH68 -like protein [Gossypium arboreum]
Length=353

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN  FPEDPGQ L  N +KRKG  D    +  DEE  KDLRSRG CLVP+S T QV  DN
Sbjct  287  RNCKFPEDPGQQLNENSMKRKGGPDQQ--KECDEEPKKDLRSRGLCLVPVSCTLQVCSDN  344

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  345  GADYWAP  351



>ref|XP_007135661.1| hypothetical protein PHAVU_010G147600g [Phaseolus vulgaris]
 gb|ESW07655.1| hypothetical protein PHAVU_010G147600g [Phaseolus vulgaris]
Length=317

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N LKRKG      P    +E  KDLRSRG CLVP+S T  VG +N
Sbjct  250  RNSVFPEDPGQLLNDNGLKRKGA-----PNQDAKEKAKDLRSRGLCLVPVSCTQHVGNEN  304

Query  357  GAXYWAP  337
            G  YWAP
Sbjct  305  GGDYWAP  311



>gb|KHG13996.1| Transcription factor bHLH68 -like protein [Gossypium arboreum]
Length=367

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL   C+K++  S     Q  +EE  K+L+SRG CLVPIS T QVG DN
Sbjct  294  RNCIFPEDPGQLLNEKCMKKRKGSPADL-QDSNEEPKKNLKSRGLCLVPISCTLQVGSDN  352

Query  357  GAXYWAPXAF  328
            GA YWAP + 
Sbjct  353  GADYWAPPSL  362



>gb|EYU32948.1| hypothetical protein MIMGU_mgv1a013049mg [Erythranthe guttata]
Length=232

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD-  361
            RN LFPEDPGQLL  NC+KRK  SD    +  DEE  +DL+SRG CLVPIS T  VG + 
Sbjct  160  RNCLFPEDPGQLLNENCIKRKEISDL---ECNDEEPKQDLKSRGLCLVPISCTIDVGSEI  216

Query  360  NGAXYWA  340
            NGA YWA
Sbjct  217  NGADYWA  223



>ref|XP_010925897.1| PREDICTED: transcription factor bHLH68-like [Elaeis guineensis]
Length=343

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R+ +FPEDPGQLL  NC K++G  +    Q  ++E  KDLRSRG CLVP+S T  VG DN
Sbjct  274  RSCIFPEDPGQLLNDNCTKKRGPPE----QDANDEPKKDLRSRGLCLVPVSCTLHVGSDN  329

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  330  GADYWAP  336



>gb|KEH27144.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=328

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 44/66 (67%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N LFPEDPGQLL  N LKRK   +        EE  KDL+SRG CLVP+S T QVG DNG
Sbjct  261  NCLFPEDPGQLLNENGLKRKAAEE-----VSQEEPKKDLKSRGLCLVPVSCTLQVGNDNG  315

Query  354  AXYWAP  337
            A YWAP
Sbjct  316  ADYWAP  321



>gb|AFK35850.1| unknown [Medicago truncatula]
 gb|KEH27143.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=323

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 44/66 (67%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N LFPEDPGQLL  N LKRK   +        EE  KDL+SRG CLVP+S T QVG DNG
Sbjct  256  NCLFPEDPGQLLNENGLKRKAAEE-----VSQEEPKKDLKSRGLCLVPVSCTLQVGNDNG  310

Query  354  AXYWAP  337
            A YWAP
Sbjct  311  ADYWAP  316



>gb|KJB07195.1| hypothetical protein B456_001G007000 [Gossypium raimondii]
Length=386

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRK--GXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGX  364
            RN +FPEDPGQLL   C+K++  G +D    Q  +EE  K+L+SRG CLVPIS T QVG 
Sbjct  297  RNCIFPEDPGQLLNEKCMKKRKGGPADL---QDSNEEPKKNLKSRGLCLVPISCTLQVGS  353

Query  363  DNGAXYWAPXAF  328
            DNGA YWAP + 
Sbjct  354  DNGADYWAPPSL  365



>gb|KJB07197.1| hypothetical protein B456_001G007000 [Gossypium raimondii]
Length=370

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRK--GXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGX  364
            RN +FPEDPGQLL   C+K++  G +D    Q  +EE  K+L+SRG CLVPIS T QVG 
Sbjct  297  RNCIFPEDPGQLLNEKCMKKRKGGPADL---QDSNEEPKKNLKSRGLCLVPISCTLQVGS  353

Query  363  DNGAXYWAPXAF  328
            DNGA YWAP + 
Sbjct  354  DNGADYWAPPSL  365



>gb|KDP37262.1| hypothetical protein JCGZ_06318 [Jatropha curcas]
Length=342

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL   CLKRKG  +    Q   ++  KDL+SRG CLVP+S T  VG DN
Sbjct  273  RNCVFPEDPGQLLNDICLKRKGGPNQ---QDNSQDKPKDLKSRGLCLVPVSCTQHVGSDN  329

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  330  GADYWAP  336



>ref|NP_001240881.1| uncharacterized protein LOC100786555 [Glycine max]
 gb|ACU18221.1| unknown [Glycine max]
Length=334

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            +  +FPEDPGQLL  NCLKRK   +        EE  K LRSRG CLVP+S T QVG DN
Sbjct  265  KTCIFPEDPGQLLDENCLKRKAAGEPDT----QEEPKKGLRSRGLCLVPVSCTLQVGSDN  320

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  321  GADYWAP  327



>ref|XP_002516005.1| transcription factor, putative [Ricinus communis]
 gb|EEF46425.1| transcription factor, putative [Ricinus communis]
Length=336

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL   C KRKG S+        ++  KDLRSRG CLVP+S T  VG DN
Sbjct  272  RNCVFPEDPGQLLNDICQKRKGGSNQDC-----QDKPKDLRSRGLCLVPVSCTQHVGSDN  326

Query  357  GAXYWAPXAF  328
            GA YWAP  F
Sbjct  327  GADYWAPGGF  336



>ref|XP_010526460.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Tarenaya 
hassleriana]
Length=379

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 4/68 (6%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKG---XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGX  364
            N +FPEDPGQL+  +C+KR+G    SD+ +P   +E   KDLRSRG CLVPIS T QVG 
Sbjct  305  NCIFPEDPGQLVNEHCMKRRGASSSSDNQNPN-SNEGPKKDLRSRGLCLVPISCTVQVGG  363

Query  363  DNGAXYWA  340
            DNGA YWA
Sbjct  364  DNGADYWA  371



>ref|NP_179600.2| transcription factor bHLH133 [Arabidopsis thaliana]
 sp|Q7XHI5.1|BH133_ARATH RecName: Full=Transcription factor bHLH133; AltName: Full=Basic 
helix-loop-helix protein 133; Short=AtbHLH133; Short=bHLH 
133; AltName: Full=bHLH transcription factor bHLH133 [Arabidopsis 
thaliana]
 emb|CAE12175.1| putative bHLH133 transcription factor [Arabidopsis thaliana]
 dbj|BAH30393.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06964.1| transcription factor bHLH133 [Arabidopsis thaliana]
Length=362

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKR--KGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            N +FPEDPGQL+   C+KR     S  +     +EE  KDLRSRG CLVPIS T QVG D
Sbjct  288  NGIFPEDPGQLVNEYCMKRGVSLSSTDNQKSNPNEEPMKDLRSRGLCLVPISCTLQVGSD  347

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  348  NGADYWAP  355



>ref|XP_008783244.1| PREDICTED: transcription factor bHLH68-like [Phoenix dactylifera]
Length=347

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 45/67 (67%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQLL  NC K++G  D    Q   +E  KDL+SRG CLVP+S T  VG DN
Sbjct  278  RNCIFPEDPGQLLNDNCTKKRGPPD----QDASDEPKKDLKSRGLCLVPVSCTMHVGSDN  333

Query  357  GAXYWAP  337
            GA  WAP
Sbjct  334  GADCWAP  340



>ref|XP_004486757.1| PREDICTED: transcription factor bHLH68-like [Cicer arietinum]
Length=338

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 45/67 (67%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL    LKRKG  +    Q  +    KDLRSRG CLVP+S T  VG +N
Sbjct  270  RNSVFPEDPGQLLDDTGLKRKGAPN----QNAEGNKAKDLRSRGLCLVPVSCTQNVGSEN  325

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  326  GADYWAP  332



>gb|KDO66447.1| hypothetical protein CISIN_1g042078mg [Citrus sinensis]
Length=116

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 39/56 (70%), Gaps = 3/56 (5%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NC+KRKG SDH   Q   EE  K LRSRG CLVP+S T QVG DNGA YWAP
Sbjct  56   LLNDNCMKRKGTSDHQESQ---EEVKKSLRSRGLCLVPVSCTLQVGSDNGADYWAP  108



>ref|XP_002886001.1| hypothetical protein ARALYDRAFT_480460 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62260.1| hypothetical protein ARALYDRAFT_480460 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKR--KGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            N +FPEDPGQL+   C+KR     S  +     +EE  KDLRSRG CLVPIS T QVG D
Sbjct  291  NGIFPEDPGQLVNEYCMKRGVSLSSTDNQKSNPNEEPMKDLRSRGLCLVPISCTLQVGSD  350

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  351  NGADYWAP  358



>ref|XP_006583063.1| PREDICTED: transcription factor bHLH68-like isoform X3 [Glycine 
max]
 gb|KHN04224.1| Transcription factor bHLH68 [Glycine soja]
Length=317

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N LKRKG      P    ++  +DL+SRG CLVP+S T  VG +N
Sbjct  250  RNSVFPEDPGQLLNDNGLKRKGA-----PNQDAKDKPRDLKSRGLCLVPVSCTQHVGNEN  304

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  305  GADYWAP  311



>ref|XP_006583061.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Glycine 
max]
 ref|XP_006583062.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Glycine 
max]
Length=319

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N LKRKG      P    ++  +DL+SRG CLVP+S T  VG +N
Sbjct  252  RNSVFPEDPGQLLNDNGLKRKGA-----PNQDAKDKPRDLKSRGLCLVPVSCTQHVGNEN  306

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  307  GADYWAP  313



>gb|ACJ85397.1| unknown [Medicago truncatula]
Length=307

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL    LKRKG    +    G++   KDLRSRG CLVP+S T  VG +N
Sbjct  237  RNSVFPEDPGQLLDDTGLKRKGAPIPNQNAEGNK--AKDLRSRGLCLVPVSCTQHVGSEN  294

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  295  GADYWAP  301



>ref|XP_003597718.1| Transcription factor bHLH68 [Medicago truncatula]
 gb|ABN06010.1| Helix-loop-helix DNA-binding [Medicago truncatula]
Length=319

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL    LKRKG    +    G++   KDLRSRG CLVP+S T  VG +N
Sbjct  249  RNSVFPEDPGQLLDDTGLKRKGAPIPNQNAEGNK--AKDLRSRGLCLVPVSCTQHVGSEN  306

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  307  GADYWAP  313



>gb|AES67968.2| BHLH transcription factor-like protein [Medicago truncatula]
Length=329

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL    LKRKG    +    G++   KDLRSRG CLVP+S T  VG +N
Sbjct  259  RNSVFPEDPGQLLDDTGLKRKGAPIPNQNAEGNK--AKDLRSRGLCLVPVSCTQHVGSEN  316

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  317  GADYWAP  323



>gb|AFK49339.1| unknown [Medicago truncatula]
Length=328

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL    LKRKG    +    G++   KDLRSRG CLVP+S T  VG +N
Sbjct  258  RNSVFPEDPGQLLDDTGLKRKGAPIPNQNAEGNK--AKDLRSRGLCLVPVSCTQHVGSEN  315

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  316  GADYWAP  322



>ref|XP_003597717.1| Transcription factor bHLH68 [Medicago truncatula]
Length=328

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL    LKRKG    +    G++   KDLRSRG CLVP+S T  VG +N
Sbjct  258  RNSVFPEDPGQLLDDTGLKRKGAPIPNQNAEGNK--AKDLRSRGLCLVPVSCTQHVGSEN  315

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  316  GADYWAP  322



>ref|XP_003531664.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Glycine 
max]
 gb|KHN47838.1| Transcription factor bHLH68 [Glycine soja]
Length=317

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N LKRKG      P    ++   DL+SRG CLVP+S T  VG +N
Sbjct  250  RNSVFPEDPGQLLNDNGLKRKGA-----PNQDAKDKPSDLKSRGLCLVPVSCTQHVGNEN  304

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  305  GADYWAP  311



>ref|XP_006585586.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Glycine 
max]
Length=319

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N LKRKG      P    ++   DL+SRG CLVP+S T  VG +N
Sbjct  252  RNSVFPEDPGQLLNDNGLKRKGA-----PNQDAKDKPSDLKSRGLCLVPVSCTQHVGNEN  306

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  307  GADYWAP  313



>ref|XP_010691374.1| PREDICTED: transcription factor bHLH68-like [Beta vulgaris subsp. 
vulgaris]
Length=395

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN LFP+DPGQLL  +CLKR+G ++      G   A KDL+SRG CLVPIS T  VG DN
Sbjct  327  RNCLFPDDPGQLLNDSCLKRRGAANLEDNIKG---ALKDLKSRGLCLVPISCTQLVGSDN  383

Query  357  GAXYWA  340
            GA YWA
Sbjct  384  GADYWA  389



>ref|XP_011048370.1| PREDICTED: transcription factor bHLH68 [Populus euphratica]
 ref|XP_011048371.1| PREDICTED: transcription factor bHLH68 [Populus euphratica]
Length=345

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N +FPEDPGQLL  +C+ RKG S     Q       KDLRSRG CLVP+S T  VG DNG
Sbjct  278  NCIFPEDPGQLLDDSCINRKGAS-----QQDSHAEPKDLRSRGLCLVPVSCTLPVGSDNG  332

Query  354  AXYWAP  337
            A YWAP
Sbjct  333  ADYWAP  338



>ref|XP_010490296.1| PREDICTED: transcription factor bHLH133-like [Camelina sativa]
Length=274

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGD--EEAXKDLRSRGXCLVPISXTXQVGXD  361
            N +FPEDPGQL+    +KR   S     Q  +  EE  KDLRSRG CLVPIS T QVG D
Sbjct  200  NGIFPEDPGQLVNEYRMKRGVSSSSKDNQNSNPNEEPMKDLRSRGLCLVPISCTLQVGSD  259

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  260  NGADYWAP  267



>ref|XP_006297999.1| hypothetical protein CARUB_v10014044mg [Capsella rubella]
 gb|EOA30897.1| hypothetical protein CARUB_v10014044mg [Capsella rubella]
Length=359

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKR---KGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGX  364
            N +FPEDPGQL+   C+KR      S  +     +EE  KDL SRG CLVPIS T QVG 
Sbjct  285  NGIFPEDPGQLVNEYCMKRGVSSSSSKDNQNSSPNEEPMKDLTSRGLCLVPISCTLQVGS  344

Query  363  DNGAXYWAP  337
            DNGA YWAP
Sbjct  345  DNGADYWAP  353



>ref|XP_006451208.1| hypothetical protein CICLE_v10008684mg [Citrus clementina]
 ref|XP_006475663.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Citrus 
sinensis]
 gb|ESR64448.1| hypothetical protein CICLE_v10008684mg [Citrus clementina]
Length=348

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 39/56 (70%), Gaps = 3/56 (5%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NC+KRKG SDH   Q   EE  K LRSRG CLVP+S T QVG DNGA YWAP
Sbjct  288  LLNDNCMKRKGTSDH---QESQEEVKKSLRSRGLCLVPVSCTLQVGSDNGADYWAP  340



>ref|XP_010433138.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Camelina 
sativa]
Length=405

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSD-HHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            +FPEDPGQ     C+KR+G S      Q  +E+  KDLRSRG CLVPIS T QVG DNGA
Sbjct  337  IFPEDPGQ-----CMKRRGASSLSTDNQNANEKPKKDLRSRGLCLVPISCTLQVGSDNGA  391

Query  351  XYWAPXAF  328
             YWAP A 
Sbjct  392  DYWAPAAL  399



>ref|XP_010467937.1| PREDICTED: transcription factor bHLH133 [Camelina sativa]
Length=367

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGD--EEAXKDLRSRGXCLVPISXTXQVGXD  361
            N +FPEDPGQL+    +KR   S     Q  +  EE  KDLRSRG CLVPIS T QVG D
Sbjct  293  NGIFPEDPGQLVNEYRMKRGVSSSSTDNQKSNPNEEPMKDLRSRGLCLVPISCTLQVGSD  352

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  353  NGADYWAP  360



>ref|XP_010526459.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Tarenaya 
hassleriana]
Length=380

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = -1

Query  534  NSLFPEDPGQ-LLXXNCLKRKG---XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVG  367
            N +FPEDPGQ L+  +C+KR+G    SD+ +P   +E   KDLRSRG CLVPIS T QVG
Sbjct  305  NCIFPEDPGQQLVNEHCMKRRGASSSSDNQNPN-SNEGPKKDLRSRGLCLVPISCTVQVG  363

Query  366  XDNGAXYWA  340
             DNGA YWA
Sbjct  364  GDNGADYWA  372



>ref|XP_010447891.1| PREDICTED: transcription factor bHLH68 isoform X2 [Camelina sativa]
Length=403

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHP-QXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ +FPEDPGQ     C+KR G S      Q  +EE  KDLRSRG CLVPIS T QVG D
Sbjct  333  RSCIFPEDPGQ-----CMKRIGASSSSTDNQNANEEPKKDLRSRGLCLVPISCTLQVGSD  387

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  388  NGADYWAP  395



>ref|XP_010416299.1| PREDICTED: transcription factor bHLH133-like [Camelina sativa]
Length=369

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGD--EEAXKDLRSRGXCLVPISXTXQVGXD  361
            N +FPEDPGQL+    +KR   S     Q  +  EE  KDLRSRG CLVP+S T QVG D
Sbjct  295  NGIFPEDPGQLVNEYRMKRGVSSSSTDNQKSNPNEEPMKDLRSRGLCLVPVSCTLQVGSD  354

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  355  NGADYWAP  362



>ref|XP_009117507.1| PREDICTED: transcription factor bHLH133 [Brassica rapa]
 emb|CDY13883.1| BnaA09g43850D [Brassica napus]
Length=366

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKG--XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            N LFP+DPGQL+   C+KR     S   +    +EE  KDL+SRG CLVPIS T QVG  
Sbjct  292  NGLFPQDPGQLVSEYCMKRSNGVSSSSTNKPNLNEETKKDLKSRGLCLVPISCTLQVGSY  351

Query  360  NGAXYWAP  337
            NG  YWAP
Sbjct  352  NGTDYWAP  359



>emb|CDX81959.1| BnaC08g36420D [Brassica napus]
Length=367

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKG--XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            N LFP+DPGQL+   C+KR     S   +    +EE  KDL+SRG CLVPIS T QVG  
Sbjct  293  NGLFPQDPGQLVSEYCMKRSNGVSSSSTNKPNLNEETKKDLKSRGLCLVPISCTLQVGSY  352

Query  360  NGAXYWAP  337
            NG  YWAP
Sbjct  353  NGTDYWAP  360



>ref|XP_006465638.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Citrus 
sinensis]
Length=339

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N  FPE PGQLL   CLKRK       P    +   KDLRSRG CLVP+S T QVG DNG
Sbjct  273  NGAFPEAPGQLLNDTCLKRKEA-----PNQDGQGKPKDLRSRGLCLVPLSCTQQVGSDNG  327

Query  354  AXYWAP  337
            A +WAP
Sbjct  328  ADFWAP  333



>ref|XP_006465639.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Citrus 
sinensis]
Length=338

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N  FPE PGQLL   CLKRK       P    +   KDLRSRG CLVP+S T QVG DNG
Sbjct  272  NGAFPEAPGQLLNDTCLKRKEA-----PNQDGQGKPKDLRSRGLCLVPLSCTQQVGSDNG  326

Query  354  AXYWAP  337
            A +WAP
Sbjct  327  ADFWAP  332



>gb|KDO56950.1| hypothetical protein CISIN_1g019574mg [Citrus sinensis]
Length=338

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N  FPE PGQLL   CLKRK       P    +   KDLRSRG CLVP+S T Q+G DNG
Sbjct  272  NGAFPEAPGQLLNDTCLKRKEA-----PNQDGQGKPKDLRSRGLCLVPLSCTQQIGSDNG  326

Query  354  AXYWAP  337
            A +WAP
Sbjct  327  ADFWAP  332



>gb|KDO56951.1| hypothetical protein CISIN_1g019574mg [Citrus sinensis]
Length=339

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N  FPE PGQLL   CLKRK       P    +   KDLRSRG CLVP+S T Q+G DNG
Sbjct  273  NGAFPEAPGQLLNDTCLKRKEA-----PNQDGQGKPKDLRSRGLCLVPLSCTQQIGSDNG  327

Query  354  AXYWAP  337
            A +WAP
Sbjct  328  ADFWAP  333



>ref|XP_006426930.1| hypothetical protein CICLE_v10026009mg [Citrus clementina]
 gb|ESR40170.1| hypothetical protein CICLE_v10026009mg [Citrus clementina]
Length=339

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            N  FPE PGQLL   CLKRK       P    +   KDLRSRG CLVP+S T Q+G DNG
Sbjct  273  NGAFPEAPGQLLNDTCLKRKEA-----PNQDGQGKPKDLRSRGLCLVPLSCTQQIGSDNG  327

Query  354  AXYWAP  337
            A +WAP
Sbjct  328  ADFWAP  333



>gb|KFK40379.1| hypothetical protein AALP_AA3G365900 [Arabis alpina]
Length=355

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 5/71 (7%)
 Frame = -1

Query  534  NSLFPEDPGQLLXXNCLKRK-----GXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV  370
            N +FPEDPGQL+   C+KR        S ++     + E  KDLRS+G CLVPIS T QV
Sbjct  283  NCIFPEDPGQLVNEYCMKRSKGASLSSSTNNQESNPNVEPKKDLRSKGLCLVPISCTLQV  342

Query  369  GXDNGAXYWAP  337
              DNGA YW P
Sbjct  343  SNDNGADYWTP  353



>ref|XP_008462744.1| PREDICTED: transcription factor bHLH68 isoform X3 [Cucumis melo]
Length=374

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 39/56 (70%), Gaps = 6/56 (11%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NCLKRKG S+       +EE  KDLRSRG CLVP+S T QVG DNGA YWAP
Sbjct  313  LLNENCLKRKGVSEQ------EEEGKKDLRSRGLCLVPVSCTLQVGSDNGADYWAP  362



>ref|NP_001240956.1| uncharacterized protein LOC100777095 [Glycine max]
 gb|ACU18788.1| unknown [Glycine max]
Length=331

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NCLKRK  S+    Q   EE  KDLRSRG CLVP+S T QVG DNGA YWAP
Sbjct  273  LLNENCLKRKAASE----QDSQEEPKKDLRSRGLCLVPVSCTLQVGSDNGADYWAP  324



>ref|XP_006833385.1| hypothetical protein AMTR_s00109p00114170 [Amborella trichopoda]
 gb|ERM98663.1| hypothetical protein AMTR_s00109p00114170 [Amborella trichopoda]
Length=321

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            FPEDPGQLL  +  KR+G +D        E+  KDLRSRG CLVP+S T  V  DNGA Y
Sbjct  258  FPEDPGQLLNESSKKRRGANDQDA-----EDEPKDLRSRGLCLVPLSCTLPVSSDNGADY  312

Query  345  WAP  337
            WAP
Sbjct  313  WAP  315



>gb|EEC72912.1| hypothetical protein OsI_06741 [Oryza sativa Indica Group]
Length=403

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N +K++G  D    +  +E    DLRSRG CLVP+S T  VG D 
Sbjct  328  RNSIFPEDPGQLLHDNAVKKRGQPDQD--ESCEEAKTMDLRSRGLCLVPVSCTVDVGVDA  385

Query  357  G-AXYW-APXAF  328
            G A YW AP AF
Sbjct  386  GPADYWAAPPAF  397



>gb|EEE56732.1| hypothetical protein OsJ_06238 [Oryza sativa Japonica Group]
Length=407

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N +K++G  D    +  +E    DLRSRG CLVP+S T  VG D 
Sbjct  332  RNSIFPEDPGQLLHDNAVKKRGQPDQD--ESCEEAKTMDLRSRGLCLVPVSCTVDVGVDA  389

Query  357  G-AXYW-APXAF  328
            G A YW AP AF
Sbjct  390  GPADYWAAPPAF  401



>ref|NP_001046546.1| Os02g0276900 [Oryza sativa Japonica Group]
 dbj|BAF08460.1| Os02g0276900 [Oryza sativa Japonica Group]
Length=412

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N +K++G  D    +  +E    DLRSRG CLVP+S T  VG D 
Sbjct  337  RNSIFPEDPGQLLHDNAVKKRGQPDQD--ESCEEAKTMDLRSRGLCLVPVSCTVDVGVDA  394

Query  357  G-AXYW-APXAF  328
            G A YW AP AF
Sbjct  395  GPADYWAAPPAF  406



>dbj|BAD21818.1| ethylene-responsive family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD28675.1| ethylene-responsive family protein-like [Oryza sativa Japonica 
Group]
Length=397

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RNS+FPEDPGQLL  N +K++G  D    +  +E    DLRSRG CLVP+S T  VG D 
Sbjct  322  RNSIFPEDPGQLLHDNAVKKRGQPDQD--ESCEEAKTMDLRSRGLCLVPVSCTVDVGVDA  379

Query  357  G-AXYW-APXAF  328
            G A YW AP AF
Sbjct  380  GPADYWAAPPAF  391



>gb|KJB64954.1| hypothetical protein B456_010G073600 [Gossypium raimondii]
Length=318

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            F +   +LL  N +KRKG  D    Q  DEE  KDLRSRG CLVP+S T QVG DNGA Y
Sbjct  257  FLQSQIELLNENSMKRKGGPDR---QECDEEPKKDLRSRGLCLVPVSCTLQVGSDNGADY  313

Query  345  WAP  337
            WAP
Sbjct  314  WAP  316



>ref|XP_009336861.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Pyrus 
x bretschneideri]
Length=375

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NC+KRKG S+    Q   EE  KDLRSRG CLVP+S T QVG DNGA YWAP
Sbjct  316  LLNDNCMKRKGASE----QDPHEEPKKDLRSRGLCLVPVSCTLQVGSDNGADYWAP  367



>ref|XP_010924573.1| PREDICTED: transcription factor bHLH68-like [Elaeis guineensis]
Length=355

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 44/67 (66%), Gaps = 5/67 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R+S+FPEDP QLL   C+KR+G  +    Q  D+E  KDLRSRG CLVP+S T  VG   
Sbjct  256  RSSIFPEDPCQLLNDTCMKRRGAPN----QDADDEP-KDLRSRGLCLVPLSYTMDVGGVG  310

Query  357  GAXYWAP  337
            G  YW+P
Sbjct  311  GVDYWSP  317



>ref|XP_006647157.1| PREDICTED: transcription factor bHLH68-like [Oryza brachyantha]
Length=421

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R+S+FPEDPGQLL  N +K++G  D    +  +E    DLRSRG CLVP+S T  VG D 
Sbjct  346  RSSIFPEDPGQLLHDNAMKKRGQPDQD--EISEEAKKVDLRSRGLCLVPVSCTVDVGVDA  403

Query  357  G-AXYW-APXAF  328
            G A YW AP AF
Sbjct  404  GPADYWAAPPAF  415



>gb|KJB64952.1| hypothetical protein B456_010G073600 [Gossypium raimondii]
Length=319

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            F +   +LL  N +KRKG  D    +  DEE  KDLRSRG CLVP+S T QVG DNGA Y
Sbjct  257  FLQSQIELLNENSMKRKGGPDRQ--KECDEEPKKDLRSRGLCLVPVSCTLQVGSDNGADY  314

Query  345  WAP  337
            WAP
Sbjct  315  WAP  317



>ref|XP_004952222.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Setaria 
italica]
Length=400

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 44/72 (61%), Gaps = 10/72 (14%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGX-------SDHHHPQXGDEEAXKDLRSRGXCLVPISXT  379
            R+S+FPEDPGQLL  N LK++G         DH       EEA KDLRSRG CLVP+S T
Sbjct  318  RHSIFPEDPGQLLHDNALKKRGQPEQVLLVIDH---DGSCEEAKKDLRSRGLCLVPVSCT  374

Query  378  XQVGXDNGAXYW  343
              VG D  A YW
Sbjct  375  LDVGVDVVADYW  386



>ref|XP_006408924.1| hypothetical protein EUTSA_v10002020mg [Eutrema salsugineum]
 gb|ESQ50377.1| hypothetical protein EUTSA_v10002020mg [Eutrema salsugineum]
Length=366

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 5/68 (7%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKR-KGXSD---HHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            +FPEDP QL+   C+KR KG S    ++     +EE  KDL+SRG CLVPIS T Q G D
Sbjct  293  IFPEDP-QLVHEYCMKRSKGASSSSRNNQESNLNEEHKKDLKSRGLCLVPISCTLQFGSD  351

Query  360  NGAXYWAP  337
            NGA YWAP
Sbjct  352  NGADYWAP  359



>ref|XP_004952223.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Setaria 
italica]
Length=364

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 44/72 (61%), Gaps = 10/72 (14%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGX-------SDHHHPQXGDEEAXKDLRSRGXCLVPISXT  379
            R+S+FPEDPGQLL  N LK++G         DH       EEA KDLRSRG CLVP+S T
Sbjct  282  RHSIFPEDPGQLLHDNALKKRGQPEQVLLVIDH---DGSCEEAKKDLRSRGLCLVPVSCT  338

Query  378  XQVGXDNGAXYW  343
              VG D  A YW
Sbjct  339  LDVGVDVVADYW  350



>ref|XP_008793073.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Phoenix 
dactylifera]
Length=346

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = -1

Query  507  QLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            QLL   C+KR+G +D    Q  D+E  KDL+SRG CLVP+S T  VG DNGA YWAP AF
Sbjct  256  QLLHDTCIKRRGAAD----QDADDEP-KDLKSRGLCLVPVSFTLHVGGDNGADYWAPPAF  310



>emb|CDY14219.1| BnaA08g13500D [Brassica napus]
Length=387

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHH-HPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +L   C+KR+G S      Q  +EE  KDLRSRG CLVPIS T QVG DNGA YWAP
Sbjct  323  ILNDQCMKRRGASSSSTENQNANEEPKKDLRSRGLCLVPISCTLQVGSDNGADYWAP  379



>ref|XP_009109051.1| PREDICTED: transcription factor bHLH68-like [Brassica rapa]
Length=387

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHH-HPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +L   C+KR+G S      Q  +EE  KDLRSRG CLVPIS T QVG DNGA YWAP
Sbjct  323  ILNDQCMKRRGASSSSTENQNANEEPKKDLRSRGLCLVPISCTLQVGSDNGADYWAP  379



>ref|XP_008228482.1| PREDICTED: transcription factor bHLH68-like isoform X3 [Prunus 
mume]
Length=325

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NCLKRKG  + H      ++  KDLRS+G CLVP+S T  VG DNGA YWAP
Sbjct  267  LLNDNCLKRKGAPNQH---PSSQDKAKDLRSKGLCLVPVSFTQHVGSDNGADYWAP  319



>ref|XP_008462743.1| PREDICTED: transcription factor bHLH68 isoform X2 [Cucumis melo]
Length=375

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 21/67 (31%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN +FPEDPGQ                     +EE  KDLRSRG CLVP+S T QVG DN
Sbjct  318  RNCVFPEDPGQ---------------------EEEGKKDLRSRGLCLVPVSCTLQVGSDN  356

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  357  GADYWAP  363



>ref|XP_002453693.1| hypothetical protein SORBIDRAFT_04g010670 [Sorghum bicolor]
 gb|EES06669.1| hypothetical protein SORBIDRAFT_04g010670 [Sorghum bicolor]
Length=396

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 5/72 (7%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R+S+FPEDPGQLL  + +K++G  D        EEA KDLRSRG CLVP+S T  VG D 
Sbjct  318  RHSIFPEDPGQLLHDSAIKKRGLPDEQDENC--EEAKKDLRSRGLCLVPVSCTLDVGVDV  375

Query  357  GAX---YWAPXA  331
             A    YWA  A
Sbjct  376  VAGPGDYWAAAA  387



>ref|XP_010688253.1| PREDICTED: transcription factor bHLH68 [Beta vulgaris subsp. 
vulgaris]
Length=396

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -1

Query  513  PGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            P  +L  NCLKRKG  D    Q   ++  KDLRSRG CLVP+S T  VG DNGA YWAP
Sbjct  334  PHTILNDNCLKRKGGPD---DQDSYDQEPKDLRSRGLCLVPVSCTLHVGSDNGADYWAP  389



>emb|CDY48596.1| BnaA01g07690D [Brassica napus]
Length=373

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -1

Query  504  LLXXNCLKRKGXS-DHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL   C+KR+  S      Q  +EE  KDLRSRG CLVPIS T QVG DNGA YWAP
Sbjct  309  LLNDQCMKRREASFSSTETQNANEEPKKDLRSRGLCLVPISCTLQVGSDNGADYWAP  365



>ref|XP_008793074.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Phoenix 
dactylifera]
Length=345

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 5/59 (8%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            LL   C+KR+G +D    Q  D+E  KDL+SRG CLVP+S T  VG DNGA YWAP AF
Sbjct  256  LLHDTCIKRRGAAD----QDADDEP-KDLKSRGLCLVPVSFTLHVGGDNGADYWAPPAF  309



>ref|XP_010234138.1| PREDICTED: transcription factor bHLH133 [Brachypodium distachyon]
Length=389

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV-GXD  361
            RNS+FPEDPGQLL     +++G SD      G EE+ KDLRSRG CLVP+S T  + G D
Sbjct  310  RNSIFPEDPGQLLHDKATRKRGHSDLQDGSSG-EESKKDLRSRGLCLVPVSCTLDIGGAD  368

Query  360  NG-AXYWA  340
             G A YW 
Sbjct  369  AGPADYWT  376



>ref|XP_011072388.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Sesamum 
indicum]
Length=364

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN LFPE+ GQ L    ++R         + G   A  DLRSRG CLVPIS T  VG +N
Sbjct  294  RNCLFPEETGQFLNDIGMERGAPKQESEGRSG---ALMDLRSRGLCLVPISCTQHVGNEN  350

Query  357  GAXYWAPXAF  328
            GA YWAP A 
Sbjct  351  GADYWAPAAL  360



>ref|XP_004960654.1| PREDICTED: transcription factor bHLH68-like [Setaria italica]
Length=388

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = -1

Query  528  LFPEDPGQLLX--XNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            LFPE PGQLL    N   ++        Q   EEA KDLRSRG CLVP+S T   G DN 
Sbjct  315  LFPEYPGQLLNHNSNTGAQQPAVQPDEQQGASEEAKKDLRSRGLCLVPVSCTSHFGGDNA  374

Query  354  AXYWAP  337
            A YWAP
Sbjct  375  ADYWAP  380



>ref|XP_009409063.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R  +F E+ G LL  N  K++G  D    Q G+ E  KDLRSRG CLVP+S    V  DN
Sbjct  178  RRRIFAEEAGHLLNGNGSKKRGRPD----QEGNVEPKKDLRSRGLCLVPVSFFLDVESDN  233

Query  357  GAXYWAP  337
            GA YW P
Sbjct  234  GADYWVP  240



>gb|AFW82070.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=103

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = -1

Query  528  LFPEDPGQLLXXN-------CLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV  370
            LFPE PGQLL  N                    Q  D+E  +DLRSRG CLVP+S T   
Sbjct  25   LFPEYPGQLLNHNHNTGAQQQQPAAVQQPPDEKQGVDDEVKRDLRSRGLCLVPVSCTSHF  84

Query  369  GXDNGAXYWAPXAF  328
            G DN A YWAP A 
Sbjct  85   GGDNAADYWAPAAL  98



>ref|XP_009380568.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=334

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 4/64 (6%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAX  349
            LF EDPGQ    +   + G  D       ++EA KDLRSRG CLVP+S T  VG D+GA 
Sbjct  269  LFSEDPGQSSNGSGKNKSGPQDQER----NDEAKKDLRSRGLCLVPVSFTMHVGSDDGAG  324

Query  348  YWAP  337
            +WAP
Sbjct  325  FWAP  328



>ref|XP_009380567.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=339

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 4/64 (6%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAX  349
            LF EDPGQ    +   + G  D       ++EA KDLRSRG CLVP+S T  VG D+GA 
Sbjct  274  LFSEDPGQSSNGSGKNKSGPQDQER----NDEAKKDLRSRGLCLVPVSFTMHVGSDDGAG  329

Query  348  YWAP  337
            +WAP
Sbjct  330  FWAP  333



>gb|AAD24387.1| unknown protein [Arabidopsis thaliana]
 gb|AAS49064.1| At2g20100 [Arabidopsis thaliana]
Length=59

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  441  DEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +EE  KDLRSRG CLVPIS T QVG DNGA YWAP
Sbjct  18   NEEPMKDLRSRGLCLVPISCTLQVGSDNGADYWAP  52



>dbj|BAJ90320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R+S+FPE+PGQLL  N  +++G  D      G EEA  DLRSRG CL+P+S     G D 
Sbjct  297  RSSIFPEEPGQLLHGNATRKRGAPDQED-GDGGEEAKNDLRSRGLCLIPLSCAPDFGADV  355

Query  357  G-AXYWA  340
            G A YW 
Sbjct  356  GPADYWT  362



>ref|XP_009409062.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=341

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R  +F E+ G LL  N  K++G  D    Q G+ E  KDLRSRG CLVP+S    V  DN
Sbjct  273  RRRIFAEEAGHLLNGNGSKKRGRPD----QEGNVEPKKDLRSRGLCLVPVSFFLDVESDN  328

Query  357  GAXYWAP  337
            GA YW P
Sbjct  329  GADYWVP  335



>gb|EMS45220.1| hypothetical protein TRIUR3_20954 [Triticum urartu]
Length=97

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 39/71 (55%), Gaps = 9/71 (13%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHP----QXG---DEEAXKDLRSRGXCLVPISXTXQV  370
            LFPE PGQLL  N     G      P    Q G   +E + KDLRSRG CLVP+S T   
Sbjct  20   LFPEYPGQLLNHN--NNTGGVQQQAPGQPEQQGAVNEEASKKDLRSRGLCLVPVSCTSHF  77

Query  369  GXDNGAXYWAP  337
            G DN A YWAP
Sbjct  78   GGDNAADYWAP  88



>ref|XP_009409460.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=343

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 4/61 (7%)
 Frame = -1

Query  519  EDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWA  340
            EDP Q      +KR G  D    Q   EE  KDLRSRG CLVP+S T  VG DNGA +WA
Sbjct  281  EDPAQFSDGGGMKRSGPQD----QERCEEPKKDLRSRGLCLVPVSFTMHVGSDNGADFWA  336

Query  339  P  337
            P
Sbjct  337  P  337



>ref|XP_009409459.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=344

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 4/61 (7%)
 Frame = -1

Query  519  EDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWA  340
            EDP Q      +KR G  D    Q   EE  KDLRSRG CLVP+S T  VG DNGA +WA
Sbjct  282  EDPAQFSDGGGMKRSGPQD----QERCEEPKKDLRSRGLCLVPVSFTMHVGSDNGADFWA  337

Query  339  P  337
            P
Sbjct  338  P  338



>ref|XP_008342665.1| PREDICTED: transcription factor bHLH68-like [Malus domestica]
Length=325

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NCLK KG  +    Q   +   KDLRS+G CLVP+S T  VG DNGA YWAP
Sbjct  268  LLNDNCLKSKGAPN----QESQDHKAKDLRSKGLCLVPVSCTQHVGSDNGADYWAP  319



>ref|XP_008654609.1| PREDICTED: uncharacterized protein LOC100273899 isoform X1 [Zea 
mays]
 gb|ACL54054.1| unknown [Zea mays]
 gb|AFW82068.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=426

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = -1

Query  528  LFPEDPGQLLXXN-------CLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV  370
            LFPE PGQLL  N                    Q  D+E  +DLRSRG CLVP+S T   
Sbjct  348  LFPEYPGQLLNHNHNTGAQQQQPAAVQQPPDEKQGVDDEVKRDLRSRGLCLVPVSCTSHF  407

Query  369  GXDNGAXYWAPXAF  328
            G DN A YWAP A 
Sbjct  408  GGDNAADYWAPAAL  421



>ref|XP_006655114.1| PREDICTED: transcription factor bHLH68-like [Oryza brachyantha]
Length=401

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXG-DEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            LFPE PGQLL  N             Q G +EE  +DLRSRG CLVP+S T   G DN A
Sbjct  329  LFPEYPGQLLNHNGNTGAQQPAAQPEQQGVNEEGKRDLRSRGLCLVPVSCTSHFGGDNAA  388

Query  351  XYWAP  337
             YWAP
Sbjct  389  DYWAP  393



>ref|NP_001141763.1| uncharacterized protein LOC100273899 [Zea mays]
 gb|ACF87012.1| unknown [Zea mays]
 gb|AFW82069.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=404

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = -1

Query  528  LFPEDPGQLLXXN-------CLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQV  370
            LFPE PGQLL  N                    Q  D+E  +DLRSRG CLVP+S T   
Sbjct  326  LFPEYPGQLLNHNHNTGAQQQQPAAVQQPPDEKQGVDDEVKRDLRSRGLCLVPVSCTSHF  385

Query  369  GXDNGAXYWAPXAF  328
            G DN A YWAP A 
Sbjct  386  GGDNAADYWAPAAL  399



>gb|AFW70908.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=390

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD-  361
            R+S+FPEDPGQLL  +   +K        +  DEE  KDLRSRG CLVP+S T  VG D 
Sbjct  310  RHSIFPEDPGQLLHDSSAIKKRAGLQPADESCDEEKKKDLRSRGLCLVPVSCTLDVGVDV  369

Query  360  --NGAXYW  343
                A YW
Sbjct  370  VAGPADYW  377



>ref|XP_003568722.1| PREDICTED: transcription factor bHLH68 [Brachypodium distachyon]
Length=397

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -1

Query  528  LFPEDPGQLLXXN---CLKRKGXSDHHHPQXG--DEEAXKDLRSRGXCLVPISXTXQVGX  364
            LFPE PGQLL  N      ++       PQ    DE + KDLRSRG CLVP+S T   G 
Sbjct  321  LFPEYPGQLLNHNNNTGGVQQQAGGQPEPQGAVSDEASKKDLRSRGLCLVPVSCTSHFGG  380

Query  363  DNGAXYWAP  337
            DN A YWAP
Sbjct  381  DNAADYWAP  389



>ref|XP_009405732.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=362

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 7/73 (10%)
 Frame = -1

Query  534  NSLFPEDPG-QLLXXN-CLKRKG-----XSDHHHPQXGDEEAXKDLRSRGXCLVPISXTX  376
            +S+F EDPG QLL  + C+KR+G               DE+  KDLRSRG CLVP+S T 
Sbjct  283  SSIFVEDPGVQLLSADSCMKRRGPPADQDDGGGGDGDEDEDEPKDLRSRGLCLVPVSFTL  342

Query  375  QVGXDNGAXYWAP  337
             VG DNGA +WAP
Sbjct  343  HVGNDNGADFWAP  355



>ref|NP_001054971.2| Os05g0228400 [Oryza sativa Japonica Group]
 gb|AAS79766.2| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16885.2| Os05g0228400 [Oryza sativa Japonica Group]
Length=268

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXG-DEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            LFPE PGQLL  N             Q G +++  KDLRSRG CLVP+S T   G DN A
Sbjct  196  LFPEYPGQLLNHNGNTGAQQPAAQPEQQGANDDGKKDLRSRGLCLVPVSCTSHFGGDNAA  255

Query  351  XYWAP  337
             YWAP
Sbjct  256  DYWAP  260



>ref|XP_009381048.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=335

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = -1

Query  507  QLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            QLL  +  K++G  D H  Q G++E  KDLRSRG CLVP+S    VG D GA +W P
Sbjct  275  QLLNSSGSKKRGPPDQH--QEGNDEVKKDLRSRGLCLVPVSFFLHVGTDTGADFWPP  329



>ref|XP_009377815.1| PREDICTED: transcription factor bHLH68-like [Pyrus x bretschneideri]
 ref|XP_009346091.1| PREDICTED: transcription factor bHLH68-like [Pyrus x bretschneideri]
Length=325

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 34/56 (61%), Gaps = 4/56 (7%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  NCLK K   +    Q   +   KDLRS+G CLVP+S T  VG DNGA YWAP
Sbjct  268  LLNDNCLKSKDAPN----QESQDHKAKDLRSKGLCLVPVSCTQHVGSDNGADYWAP  319



>gb|EEC78747.1| hypothetical protein OsI_18962 [Oryza sativa Indica Group]
Length=415

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXG-DEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            LFPE PGQLL  N             Q G +++  KDLRSRG CLVP+S T   G DN A
Sbjct  343  LFPEYPGQLLNHNGNTGAQQPAAQPEQQGANDDGKKDLRSRGLCLVPVSCTSHFGGDNAA  402

Query  351  XYWAP  337
             YWAP
Sbjct  403  DYWAP  407



>gb|EYU21476.1| hypothetical protein MIMGU_mgv1a014445mg [Erythranthe guttata]
Length=189

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN ++PE+  Q L    ++ +G +     +    +   DLRSRG CLVPIS T  V  DN
Sbjct  118  RNCVYPEENCQFLNDFGVEARGAAKQ---ELESRQVVNDLRSRGLCLVPISCTQNVANDN  174

Query  357  GAXYWAPXAF  328
             A YWAP A 
Sbjct  175  AADYWAPAAL  184



>gb|EEE62815.1| hypothetical protein OsJ_17618 [Oryza sativa Japonica Group]
Length=393

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHPQXG-DEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            LFPE PGQLL  N             Q G +++  KDLRSRG CLVP+S T   G DN A
Sbjct  321  LFPEYPGQLLNHNGNTGAQQPAAQPEQQGANDDGKKDLRSRGLCLVPVSCTSHFGGDNAA  380

Query  351  XYWAP  337
             YWAP
Sbjct  381  DYWAP  385



>ref|XP_002440827.1| hypothetical protein SORBIDRAFT_09g007650 [Sorghum bicolor]
 gb|EES19257.1| hypothetical protein SORBIDRAFT_09g007650 [Sorghum bicolor]
Length=391

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 3/67 (4%)
 Frame = -1

Query  528  LFPEDPGQLLXXN---CLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            LFPE PGQLL  N     ++         Q  +++  KDLRSRG CLVP+S T   G DN
Sbjct  317  LFPEFPGQLLNHNNNTGAQQPAAVQPDEQQGVNDDMKKDLRSRGLCLVPVSCTSHFGGDN  376

Query  357  GAXYWAP  337
             A YWAP
Sbjct  377  AADYWAP  383



>ref|XP_007024222.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY26844.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
Length=317

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 36/67 (54%), Gaps = 20/67 (30%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN  FPED GQ +                    ++  KDLRSRG CLVP+S T QVG DN
Sbjct  265  RNCAFPEDQGQDI--------------------QDKPKDLRSRGLCLVPVSCTQQVGSDN  304

Query  357  GAXYWAP  337
            GA YWAP
Sbjct  305  GADYWAP  311



>gb|KJB70440.1| hypothetical protein B456_011G073400 [Gossypium raimondii]
Length=328

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 34/67 (51%), Gaps = 19/67 (28%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            RN  FPED GQ                      E   KDLRSRG CLVP+S T QVG DN
Sbjct  274  RNCAFPEDEGQ-------------------EKQEPKSKDLRSRGLCLVPVSCTQQVGSDN  314

Query  357  GAXYWAP  337
            GA YW+P
Sbjct  315  GADYWSP  321



>dbj|BAK06025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 38/71 (54%), Gaps = 9/71 (13%)
 Frame = -1

Query  528  LFPEDPGQLLXXNCLKRKGXSDHHHP----QXG---DEEAXKDLRSRGXCLVPISXTXQV  370
            LFPE PGQLL  N  K  G      P    Q G   +E + K LRSRG CLVP+S T   
Sbjct  320  LFPEYPGQLLNHN--KNTGGVQQQAPGQPEQQGTVNEEASKKGLRSRGLCLVPVSCTSHF  377

Query  369  GXDNGAXYWAP  337
              DN A YWAP
Sbjct  378  SGDNAADYWAP  388



>ref|NP_001136733.1| uncharacterized protein LOC100216872 [Zea mays]
 gb|ACF82493.1| unknown [Zea mays]
Length=366

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 42/76 (55%), Gaps = 14/76 (18%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRK--------GXSDHHHPQXGDEEAXKDLRSRGXCLVPISX  382
            R+S+FPEDPGQLL  +   +K        G  D    +  DEE  KDLRSRG CLVP+S 
Sbjct  281  RHSIFPEDPGQLLHDSSAIKKRAGLQPADGEQDE---ESCDEEKKKDLRSRGLCLVPVSC  337

Query  381  TXQVGXD---NGAXYW  343
            T  VG D     A YW
Sbjct  338  TLDVGVDVVAGPADYW  353



>ref|XP_008681289.1| PREDICTED: uncharacterized protein LOC100216872 isoform X1 [Zea 
mays]
Length=395

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 42/76 (55%), Gaps = 14/76 (18%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRK--------GXSDHHHPQXGDEEAXKDLRSRGXCLVPISX  382
            R+S+FPEDPGQLL  +   +K        G  D    +  DEE  KDLRSRG CLVP+S 
Sbjct  310  RHSIFPEDPGQLLHDSSAIKKRAGLQPADGEQDE---ESCDEEKKKDLRSRGLCLVPVSC  366

Query  381  TXQVGXD---NGAXYW  343
            T  VG D     A YW
Sbjct  367  TLDVGVDVVAGPADYW  382



>ref|XP_008681290.1| PREDICTED: uncharacterized protein LOC100216872 isoform X2 [Zea 
mays]
Length=393

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 42/76 (55%), Gaps = 14/76 (18%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRK--------GXSDHHHPQXGDEEAXKDLRSRGXCLVPISX  382
            R+S+FPEDPGQLL  +   +K        G  D    +  DEE  KDLRSRG CLVP+S 
Sbjct  308  RHSIFPEDPGQLLHDSSAIKKRAGLQPADGEQDE---ESCDEEKKKDLRSRGLCLVPVSC  364

Query  381  TXQVGXD---NGAXYW  343
            T  VG D     A YW
Sbjct  365  TLDVGVDVVAGPADYW  380



>gb|AFW70909.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=394

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 42/76 (55%), Gaps = 14/76 (18%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRK--------GXSDHHHPQXGDEEAXKDLRSRGXCLVPISX  382
            R+S+FPEDPGQLL  +   +K        G  D    +  DEE  KDLRSRG CLVP+S 
Sbjct  309  RHSIFPEDPGQLLHDSSAIKKRAGLQPADGEQDE---ESCDEEKKKDLRSRGLCLVPVSC  365

Query  381  TXQVGXD---NGAXYW  343
            T  VG D     A YW
Sbjct  366  TLDVGVDVVAGPADYW  381



>ref|XP_009381049.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=334

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -1

Query  504  LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            LL  +  K++G  D H  Q G++E  KDLRSRG CLVP+S    VG D GA +W P
Sbjct  275  LLNSSGSKKRGPPDQH--QEGNDEVKKDLRSRGLCLVPVSFFLHVGTDTGADFWPP  328



>ref|XP_008789390.1| PREDICTED: uncharacterized protein LOC103706900 [Phoenix dactylifera]
Length=218

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  441  DEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            DE   KDLRSRG CLVP+S T  VG DNGA YWAP
Sbjct  177  DEPTKKDLRSRGLCLVPVSFTLHVGGDNGADYWAP  211



>ref|XP_010920705.1| PREDICTED: transcription factor bHLH68-like [Elaeis guineensis]
Length=318

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -1

Query  444  GDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
             D+E  KDLRSRG CLVP+S T  VG DNGA YWAP
Sbjct  276  ADDEPKKDLRSRGLCLVPVSFTLHVGGDNGADYWAP  311



>ref|XP_004150346.1| PREDICTED: uncharacterized protein LOC101221798 [Cucumis sativus]
 gb|KGN58080.1| hypothetical protein Csa_3G485860 [Cucumis sativus]
Length=375

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 40/68 (59%), Gaps = 6/68 (9%)
 Frame = -1

Query  537  RNSLFPEDPGQ-LLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD  361
            R+ +F ED GQ LL  N LKRK        Q  +EE  KDLR RG CLVP+S T  V  D
Sbjct  305  RSCVFAEDLGQQLLNDNSLKRKLPPS----QEDEEEKAKDLRGRGLCLVPVSCTQHVQSD  360

Query  360  -NGAXYWA  340
             NGA YWA
Sbjct  361  INGADYWA  368



>ref|XP_002299721.1| hypothetical protein POPTR_0001s18660g [Populus trichocarpa]
 gb|EEE84526.1| hypothetical protein POPTR_0001s18660g [Populus trichocarpa]
Length=297

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  459  HHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +H Q  +++  KDLRSRG CLVP+S T  VG DNGA YWAP
Sbjct  251  NHQQSDNQDNPKDLRSRGLCLVPLSCTQHVGSDNGADYWAP  291



>gb|KHM98740.1| Transcription factor bHLH68 [Glycine soja]
Length=285

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 9/69 (13%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNC--LKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGX  364
            RNS+ PEDPGQLL  N   LKRKG  +    Q  ++   KDL+SRG CLVP+S T  +  
Sbjct  218  RNSV-PEDPGQLLNDNNIGLKRKGAPN----QDAEDHKAKDLKSRGLCLVPVSCTQNMHV  272

Query  363  DNGAXYWAP  337
              G+ YWAP
Sbjct  273  --GSYYWAP  279



>ref|XP_006597160.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Glycine 
max]
 ref|XP_006597161.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Glycine 
max]
Length=303

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 9/69 (13%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNC--LKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGX  364
            RNS+ PEDPGQLL  N   LKRKG  +    Q  ++   KDL+SRG CLVP+S T  +  
Sbjct  236  RNSV-PEDPGQLLNDNNIGLKRKGAPN----QDAEDHKAKDLKSRGLCLVPVSCTQNMHV  290

Query  363  DNGAXYWAP  337
              G+ YWAP
Sbjct  291  --GSYYWAP  297



>ref|XP_006849290.1| hypothetical protein AMTR_s00167p00019840 [Amborella trichopoda]
 gb|ERN10871.1| hypothetical protein AMTR_s00167p00019840 [Amborella trichopoda]
Length=159

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            F  D  Q+L    L+R   S     + G+EE+  DLRSRG CLVP+S T  V   NGA +
Sbjct  90   FLHDQVQVLSTPYLQRIPPSSLR--EAGEEESKYDLRSRGLCLVPVSCTLHVASSNGADF  147

Query  345  WAP  337
            WAP
Sbjct  148  WAP  150



>gb|KHG21853.1| Transcription factor bHLH68 -like protein [Gossypium arboreum]
Length=328

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  450  QXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            Q   E   KDLRSRG CLVP+S T QVG DNGA YW+P
Sbjct  284  QEKQEPKPKDLRSRGLCLVPVSCTQQVGSDNGADYWSP  321



>ref|XP_009353586.1| PREDICTED: transcription factor bHLH68-like isoform X4 [Pyrus 
x bretschneideri]
Length=306

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 32/55 (58%), Gaps = 4/55 (7%)
 Frame = -1

Query  501  LXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            L  NCLK K   +    Q   +   KDL S+G CLVP+S T  VG DNGA YWAP
Sbjct  250  LGDNCLKNKSAPN----QESQDRKAKDLGSKGLCLVPVSCTQHVGSDNGADYWAP  300



>ref|XP_002982885.1| hypothetical protein SELMODRAFT_117274, partial [Selaginella 
moellendorffii]
 ref|XP_002990993.1| hypothetical protein SELMODRAFT_132659, partial [Selaginella 
moellendorffii]
 gb|EFJ08037.1| hypothetical protein SELMODRAFT_132659, partial [Selaginella 
moellendorffii]
 gb|EFJ16130.1| hypothetical protein SELMODRAFT_117274, partial [Selaginella 
moellendorffii]
Length=108

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  426  KDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +DLRSRG CLVP+S T QV  DNGA YWAP
Sbjct  73   QDLRSRGLCLVPVSCTLQVANDNGADYWAP  102



>ref|XP_009380570.1| PREDICTED: transcription factor bHLH68-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=324

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  450  QXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            Q  ++EA KDLRSRG CLVP+S T  VG D+GA +WAP
Sbjct  281  QERNDEAKKDLRSRGLCLVPVSFTMHVGSDDGAGFWAP  318



>ref|XP_009353584.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Pyrus 
x bretschneideri]
Length=325

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 32/55 (58%), Gaps = 4/55 (7%)
 Frame = -1

Query  501  LXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            L  NCLK K   +    Q   +   KDL S+G CLVP+S T  VG DNGA YWAP
Sbjct  269  LGDNCLKNKSAPN----QESQDRKAKDLGSKGLCLVPVSCTQHVGSDNGADYWAP  319



>ref|XP_010047918.1| PREDICTED: transcription factor bHLH68 [Eucalyptus grandis]
 gb|KCW79942.1| hypothetical protein EUGRSUZ_C01274 [Eucalyptus grandis]
Length=366

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 18/66 (27%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDN  358
            R+ +F ED GQ                  +  +EE   DLRSRG CLVP+S T QVG DN
Sbjct  310  RSPMFSEDSGQ------------------ESINEEPKNDLRSRGLCLVPVSCTLQVGSDN  351

Query  357  GAXYWA  340
            GA YWA
Sbjct  352  GADYWA  357



>ref|XP_009353583.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Pyrus 
x bretschneideri]
Length=328

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 32/55 (58%), Gaps = 4/55 (7%)
 Frame = -1

Query  501  LXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            L  NCLK K   +    Q   +   KDL S+G CLVP+S T  VG DNGA YWAP
Sbjct  272  LGDNCLKNKSAPN----QESQDRKAKDLGSKGLCLVPVSCTQHVGSDNGADYWAP  322



>ref|XP_010647962.1| PREDICTED: uncharacterized protein LOC100249018 isoform X2 [Vitis 
vinifera]
Length=253

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHP--QXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            F +D  Q+L    L+    S H     + G+E++ KDLRSRG CLVP+  T  V  +NGA
Sbjct  180  FLQDQVQVLCSPYLQTLPSSAHMSEGGENGEEKSSKDLRSRGLCLVPVECTEHVANNNGA  239

Query  351  XYWAP  337
             YW+P
Sbjct  240  DYWSP  244



>ref|XP_010923558.1| PREDICTED: transcription factor bHLH113-like isoform X2 [Elaeis 
guineensis]
Length=227

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -1

Query  510  GQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            G++L    L+R   S H H   G E    DLRSRG CLVP+S T  V   NGA  W+P
Sbjct  154  GKVLSSPYLQRLPSSTHLHEGKGVETRTNDLRSRGLCLVPVSCTEHVAKTNGADLWSP  211



>ref|XP_010098101.1| hypothetical protein L484_026235 [Morus notabilis]
 gb|EXB74538.1| hypothetical protein L484_026235 [Morus notabilis]
Length=298

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -1

Query  438  EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            +E  KDLRS+G CLVP+S T  VG DNGA YWAP  +
Sbjct  258  QEKLKDLRSKGLCLVPVSCTQHVGSDNGADYWAPANY  294



>emb|CBI22512.3| unnamed protein product [Vitis vinifera]
Length=202

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHP--QXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            F +D  Q+L    L+    S H     + G+E++ KDLRSRG CLVP+  T  V  +NGA
Sbjct  129  FLQDQVQVLCSPYLQTLPSSAHMSEGGENGEEKSSKDLRSRGLCLVPVECTEHVANNNGA  188

Query  351  XYWAP  337
             YW+P
Sbjct  189  DYWSP  193



>ref|XP_002976662.1| hypothetical protein SELMODRAFT_28260, partial [Selaginella moellendorffii]
 gb|EFJ22331.1| hypothetical protein SELMODRAFT_28260, partial [Selaginella moellendorffii]
Length=90

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  441  DEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            ++E  +DLRSRG CLVPIS T QV  DNGA +W P
Sbjct  56   NDEPRQDLRSRGLCLVPISCTLQVANDNGADFWTP  90



>ref|XP_010923557.1| PREDICTED: transcription factor bHLH113-like isoform X1 [Elaeis 
guineensis]
Length=249

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            F  +  Q+L    L+R   S H H   G E    DLRSRG CLVP+S T  V   NGA  
Sbjct  171  FLHEQVQVLSSPYLQRLPSSTHLHEGKGVETRTNDLRSRGLCLVPVSCTEHVAKTNGADL  230

Query  345  WAP  337
            W+P
Sbjct  231  WSP  233



>ref|XP_002973190.1| hypothetical protein SELMODRAFT_28262, partial [Selaginella moellendorffii]
 gb|EFJ25564.1| hypothetical protein SELMODRAFT_28262, partial [Selaginella moellendorffii]
Length=90

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  441  DEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            ++E  +DLRSRG CLVPIS T QV  DNGA +W P
Sbjct  56   NDEPRQDLRSRGLCLVPISCTLQVANDNGADFWTP  90



>ref|XP_010938699.1| PREDICTED: transcription factor bHLH113 [Elaeis guineensis]
Length=246

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            F  D  Q+L    L+R   S H H +   E    DLRSRG CLVP+S T  V   NGA  
Sbjct  170  FLHDQVQVLSSPYLQRLPSSAHLHEEKEVETRTNDLRSRGLCLVPVSCTEHVANSNGADL  229

Query  345  WAP  337
            W+P
Sbjct  230  WSP  232



>emb|CDO98010.1| unnamed protein product [Coffea canephora]
Length=321

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  459  HHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            H  Q   ++  KDL+SRG CLVPIS T  VG DNGA YWAP
Sbjct  275  HQQQSVVQDRPKDLKSRGLCLVPISCTQHVGSDNGADYWAP  315



>gb|ACG44542.1| hypothetical protein [Zea mays]
 gb|AFW77475.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=105

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  441  DEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            ++E  KDLRSRG CLVP+S T   G DN A YWAP
Sbjct  63   NDETKKDLRSRGLCLVPVSCTSHFGGDNAADYWAP  97



>ref|XP_010647961.1| PREDICTED: transcription factor bHLH113 isoform X1 [Vitis vinifera]
Length=286

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHP--QXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            F +D  Q+L    L+    S H     + G+E++ KDLRSRG CLVP+  T  V  +NGA
Sbjct  213  FLQDQVQVLCSPYLQTLPSSAHMSEGGENGEEKSSKDLRSRGLCLVPVECTEHVANNNGA  272

Query  351  XYWAP  337
             YW+P
Sbjct  273  DYWSP  277



>ref|XP_002269988.1| PREDICTED: transcription factor bHLH113 isoform X3 [Vitis vinifera]
Length=250

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHP--QXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGA  352
            F +D  Q+L    L+    S H     + G+E++ KDLRSRG CLVP+  T  V  +NGA
Sbjct  177  FLQDQVQVLCSPYLQTLPSSAHMSEGGENGEEKSSKDLRSRGLCLVPVECTEHVANNNGA  236

Query  351  XYWAP  337
             YW+P
Sbjct  237  DYWSP  241



>gb|KJB54234.1| hypothetical protein B456_009G026600 [Gossypium raimondii]
Length=332

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = -1

Query  474  GXSDHHHPQXGD--EEAXKDLRSRGXCLVPISXTXQV-GXDNGAXYWAP  337
            G ++  H Q  D  EEA KDLRSRG CLVP+S T +V   DNGA YWAP
Sbjct  274  GSANMRHQQQSDCKEEAKKDLRSRGLCLVPVSCTLEVWSGDNGADYWAP  322



>ref|XP_009608011.1| PREDICTED: transcription factor bHLH68-like [Nicotiana tomentosiformis]
Length=333

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 33/64 (52%), Gaps = 1/64 (2%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEE-AXKDLRSRGXCLVPISXTXQVGXDNGAX  349
            F +   Q L    L     S  H PQ  D +   KDLRSRG CLVPIS    VG D GA 
Sbjct  263  FLQGQIQALSSPYLGNASGSMGHVPQQSDSQHKTKDLRSRGLCLVPISCMQNVGSDTGAD  322

Query  348  YWAP  337
            YWAP
Sbjct  323  YWAP  326



>ref|XP_009400139.1| PREDICTED: transcription factor bHLH112-like, partial [Musa acuminata 
subsp. malaccensis]
Length=148

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 4/57 (7%)
 Frame = -1

Query  507  QLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            Q+L  N +K  G  D    Q  ++E  KDLRSRG CLVP++    VG  NGA  WAP
Sbjct  89   QILNENGMKNSGEQD----QECNDEQKKDLRSRGLCLVPVAFMMHVGSGNGADLWAP  141



>gb|KJB54235.1| hypothetical protein B456_009G026600 [Gossypium raimondii]
Length=329

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = -1

Query  474  GXSDHHHPQXGD--EEAXKDLRSRGXCLVPISXTXQV-GXDNGAXYWAP  337
            G ++  H Q  D  EEA KDLRSRG CLVP+S T +V   DNGA YWAP
Sbjct  271  GSANMRHQQQSDCKEEAKKDLRSRGLCLVPVSCTLEVWSGDNGADYWAP  319



>ref|XP_007215744.1| hypothetical protein PRUPE_ppa009187mg [Prunus persica]
 gb|EMJ16943.1| hypothetical protein PRUPE_ppa009187mg [Prunus persica]
Length=303

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -1

Query  456  HPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            HP   D+   KDLRS+G CLVP+S T  VG DNGA YWAP
Sbjct  260  HPSSQDK--AKDLRSKGLCLVPVSCTQHVGSDNGADYWAP  297



>emb|CAN67722.1| hypothetical protein VITISV_006021 [Vitis vinifera]
Length=400

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  462  HHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            H   + G+E++ KDLRSRG CLVP+  T  V  +NGA YW+P
Sbjct  350  HEGGENGEEKSSKDLRSRGLCLVPVECTEHVANNNGADYWSP  391



>ref|XP_011010531.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Populus 
euphratica]
Length=312

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  426  KDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            KDLRSRG CLVP+S T  VG DNGA YWAP
Sbjct  277  KDLRSRGLCLVPVSCTQHVGSDNGADYWAP  306



>ref|XP_011010532.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Populus 
euphratica]
Length=297

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  426  KDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            KDLRSRG CLVP+S T  VG DNGA YWAP
Sbjct  262  KDLRSRGLCLVPVSCTQHVGSDNGADYWAP  291



>ref|XP_010271336.1| PREDICTED: transcription factor bHLH113 [Nelumbo nucifera]
Length=266

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHH---HPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNG  355
            F  D  Q+L    L+R   S HH     +  D+E+  DLRSRG CLVP++ T  V   NG
Sbjct  192  FLHDQVQVLSSPYLQRLPSSSHHLHEGRENEDDESRYDLRSRGLCLVPVACTVHVADSNG  251

Query  354  AXYWAP  337
            A +W+P
Sbjct  252  ADFWSP  257



>ref|XP_002304211.1| hypothetical protein POPTR_0003s05010g [Populus trichocarpa]
 gb|EEE79190.1| hypothetical protein POPTR_0003s05010g [Populus trichocarpa]
Length=297

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  426  KDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            KDLRSRG CLVP+S T  VG DNGA YWAP
Sbjct  262  KDLRSRGLCLVPVSCTQHVGSDNGADYWAP  291



>ref|XP_006605977.1| PREDICTED: transcription factor bHLH113-like isoform X4 [Glycine 
max]
 ref|XP_006605978.1| PREDICTED: transcription factor bHLH113-like isoform X5 [Glycine 
max]
Length=176

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 5/52 (10%)
 Frame = -1

Query  468  SDHHHPQXGD-----EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            S +H  Q GD     EE  KDLRSRG CL+P+  T  V   NGA +W+  A 
Sbjct  107  SSYHQNQHGDGVINEEEVNKDLRSRGLCLIPVGCTVHVAGSNGADFWSSAAI  158



>ref|NP_001142173.1| uncharacterized protein LOC100274340 [Zea mays]
 gb|ACF87815.1| unknown [Zea mays]
 gb|AFW77477.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=438

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  441  DEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            ++E  KDLRSRG CLVP+S T   G DN A YWAP
Sbjct  396  NDETKKDLRSRGLCLVPVSCTSHFGGDNAADYWAP  430



>gb|KHG01483.1| Transcription factor bHLH68 -like protein [Gossypium arboreum]
Length=333

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = -1

Query  459  HHPQXGD--EEAXKDLRSRGXCLVPISXTXQV-GXDNGAXYWAP  337
            H  Q  D  EEA KDLRSRG CLVP+S T +V   DNGA YWAP
Sbjct  280  HQQQQSDCKEEAKKDLRSRGLCLVPVSCTLEVWSGDNGADYWAP  323



>ref|XP_009628050.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Nicotiana 
tomentosiformis]
Length=310

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = -1

Query  474  GXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            G   H H Q   +   KDLRSRG CL PIS T  VG D  A YWAP
Sbjct  258  GSMGHTHQQSDSQHRAKDLRSRGLCLAPISCTQHVGNDIVADYWAP  303



>ref|XP_011008318.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Populus 
euphratica]
 ref|XP_011015969.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Populus 
euphratica]
Length=298

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = -1

Query  459  HHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD-NGAXYWAP  337
            +H Q  +++  KDLRSRG CLVP+S T  VG D NGA YWAP
Sbjct  251  NHQQSDNQDNPKDLRSRGLCLVPLSCTQHVGSDHNGADYWAP  292



>ref|XP_009628051.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Nicotiana 
tomentosiformis]
Length=308

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = -1

Query  474  GXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            G   H H Q   +   KDLRSRG CL PIS T  VG D  A YWAP
Sbjct  256  GSMGHTHQQSDSQHRAKDLRSRGLCLAPISCTQHVGNDIVADYWAP  301



>ref|XP_006605976.1| PREDICTED: transcription factor bHLH113-like isoform X3 [Glycine 
max]
Length=273

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 5/52 (10%)
 Frame = -1

Query  468  SDHHHPQXGD-----EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            S +H  Q GD     EE  KDLRSRG CL+P+  T  V   NGA +W+  A 
Sbjct  204  SSYHQNQHGDGVINEEEVNKDLRSRGLCLIPVGCTVHVAGSNGADFWSSAAI  255



>ref|XP_003555279.1| PREDICTED: transcription factor bHLH113-like isoform X1 [Glycine 
max]
Length=277

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 5/52 (10%)
 Frame = -1

Query  468  SDHHHPQXGD-----EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            S +H  Q GD     EE  KDLRSRG CL+P+  T  V   NGA +W+  A 
Sbjct  208  SSYHQNQHGDGVINEEEVNKDLRSRGLCLIPVGCTVHVAGSNGADFWSSAAI  259



>ref|XP_006605975.1| PREDICTED: transcription factor bHLH113-like isoform X2 [Glycine 
max]
Length=276

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 5/52 (10%)
 Frame = -1

Query  468  SDHHHPQXGD-----EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            S +H  Q GD     EE  KDLRSRG CL+P+  T  V   NGA +W+  A 
Sbjct  207  SSYHQNQHGDGVINEEEVNKDLRSRGLCLIPVGCTVHVAGSNGADFWSSAAI  258



>gb|KJB54236.1| hypothetical protein B456_009G026600 [Gossypium raimondii]
Length=312

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  438  EEAXKDLRSRGXCLVPISXTXQV-GXDNGAXYWAP  337
            EEA KDLRSRG CLVP+S T +V   DNGA YWAP
Sbjct  268  EEAKKDLRSRGLCLVPVSCTLEVWSGDNGADYWAP  302



>gb|KHN42348.1| Transcription factor bHLH113 [Glycine soja]
Length=273

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (57%), Gaps = 5/51 (10%)
 Frame = -1

Query  468  SDHHHPQXGD-----EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXA  331
            S +H  Q GD     EE  KDLRSRG CL+P+  T  V   NGA +W+  A
Sbjct  204  SSYHQNQHGDGVINEEEVNKDLRSRGLCLIPVGCTVHVAGSNGADFWSSAA  254



>ref|XP_010062499.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW69641.1| hypothetical protein EUGRSUZ_F03049 [Eucalyptus grandis]
Length=343

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  441  DEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +++  KDL+SRG CLVP+S T QVG ++GA YWAP
Sbjct  303  NQDNPKDLKSRGLCLVPVSCTMQVGNESGADYWAP  337



>ref|XP_009419079.1| PREDICTED: transcription factor bHLH113-like [Musa acuminata 
subsp. malaccensis]
Length=226

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 33/65 (51%), Gaps = 4/65 (6%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            F  D  Q+L    L+R   S H H    D     DLRSRG CLVP++ T  V   NGA  
Sbjct  163  FLHDQVQVLSSPYLQRLPSSAHLH----DGREKNDLRSRGLCLVPVASTEHVARSNGADL  218

Query  345  WAPXA  331
            W+P A
Sbjct  219  WSPAA  223



>ref|XP_002527479.1| transcription factor, putative [Ricinus communis]
 gb|EEF34877.1| transcription factor, putative [Ricinus communis]
Length=239

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 2/44 (5%)
 Frame = -1

Query  462  HHHPQXGD--EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
             H P+  +  EE  KDLRSRG CLVP+  T  V   NGA YW+P
Sbjct  181  QHQPEVEENGEEPRKDLRSRGLCLVPVECTAHVASSNGADYWSP  224



>ref|XP_008787215.1| PREDICTED: transcription factor bHLH113-like [Phoenix dactylifera]
Length=165

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 33/64 (52%), Gaps = 2/64 (3%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKD--LRSRGXCLVPISXTXQVGXDNGA  352
            F  D  Q+L    L+R   S       GDEE  +D  LRSRG CLVP+S T  V   NGA
Sbjct  86   FLHDQVQVLISPYLQRLTTSKRQLENGGDEEESRDDELRSRGLCLVPVSCTEDVAGSNGA  145

Query  351  XYWA  340
              W+
Sbjct  146  DIWS  149



>ref|XP_004241741.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Solanum 
lycopersicum]
Length=338

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 32/63 (51%), Gaps = 5/63 (8%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
             P+     L  N LKR+  +     +   +    DLRSRG CLVPIS    +G D GA Y
Sbjct  275  IPQQSLNFLDGNFLKRRPAN-----KQDSQHKPMDLRSRGLCLVPISCMANIGSDTGADY  329

Query  345  WAP  337
            WAP
Sbjct  330  WAP  332



>ref|XP_008447522.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Cucumis 
melo]
Length=382

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD-  361
            R+ +F ED GQLL  N LKRK           +E+A KDLR RG CLVP+S T  V  D 
Sbjct  310  RSCVFAEDLGQLLNDNSLKRK-LPPSQEEDEEEEKAAKDLRGRGLCLVPVSCTQHVQSDI  368

Query  360  NGAXYWA  340
            NGA YWA
Sbjct  369  NGADYWA  375



>ref|XP_006847529.1| hypothetical protein AMTR_s00014p00103240 [Amborella trichopoda]
 gb|ERN09110.1| hypothetical protein AMTR_s00014p00103240 [Amborella trichopoda]
Length=385

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = -1

Query  444  GDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            GD E  +DL+SRG CLVP+S T  V  DNGA  W P  F
Sbjct  344  GDGEPKRDLKSRGLCLVPLSCTTLVTSDNGAPLWPPSKF  382



>ref|XP_007042552.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX98383.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=262

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -1

Query  444  GDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            G EE+ KDL+SRG CLVP++ T  V   NGA +W+P
Sbjct  218  GGEESRKDLKSRGLCLVPVACTLHVANSNGADFWSP  253



>ref|XP_007201519.1| hypothetical protein PRUPE_ppa015566mg [Prunus persica]
 gb|EMJ02718.1| hypothetical protein PRUPE_ppa015566mg [Prunus persica]
Length=260

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  438  EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            EEA KDLRSRG CL P+  T  V  +NGA +W+P
Sbjct  213  EEARKDLRSRGLCLAPVEYTMHVADNNGADFWSP  246



>ref|XP_008236390.1| PREDICTED: transcription factor bHLH113 [Prunus mume]
Length=260

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  438  EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            EEA KDLRSRG CL P+  T  V  +NGA +W+P
Sbjct  213  EEARKDLRSRGLCLAPVEYTMHVTNNNGADFWSP  246



>ref|XP_004496925.1| PREDICTED: transcription factor bHLH113-like isoform X1 [Cicer 
arietinum]
Length=277

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -1

Query  438  EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            EE  KDLRSRG CL+P+  T  V   NGA +W+P + 
Sbjct  229  EEVNKDLRSRGLCLIPVGCTLHVASSNGADFWSPASI  265



>ref|XP_004496926.1| PREDICTED: transcription factor bHLH113-like isoform X2 [Cicer 
arietinum]
Length=274

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -1

Query  438  EEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            EE  KDLRSRG CL+P+  T  V   NGA +W+P + 
Sbjct  226  EEVNKDLRSRGLCLIPVGCTLHVASSNGADFWSPASI  262



>ref|XP_008447524.1| PREDICTED: transcription factor bHLH68-like isoform X4 [Cucumis 
melo]
Length=381

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = -1

Query  537  RNSLFPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXD-  361
            R+ +F ED GQLL  N LKRK           +E+A KDLR RG CLVP+S T  V  D 
Sbjct  310  RSCVFAEDLGQLLNDNSLKRKLPPSQE--DEEEEKAAKDLRGRGLCLVPVSCTQHVQSDI  367

Query  360  NGAXYWA  340
            NGA YWA
Sbjct  368  NGADYWA  374



>ref|XP_004232764.1| PREDICTED: transcription factor bHLH112 [Solanum lycopersicum]
Length=440

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 27/48 (56%), Gaps = 0/48 (0%)
 Frame = -1

Query  480  RKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            + G +   H Q  D+   +DLRSRG CLVPIS T  V  ++   +W P
Sbjct  386  KNGSTTTQHQQIADKVKEEDLRSRGLCLVPISSTFPVATESSTDFWTP  433



>ref|XP_008785926.1| PREDICTED: transcription factor bHLH113-like [Phoenix dactylifera]
Length=255

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 30/63 (48%), Gaps = 0/63 (0%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXY  346
            F  +  Q+L    L+R   S H H   G E    DLRSRG CLVP+S T  V   N    
Sbjct  175  FLHEQVQVLSSPYLRRLPSSAHLHEGRGVEARTNDLRSRGLCLVPVSCTEHVANSNRVDL  234

Query  345  WAP  337
            W P
Sbjct  235  WFP  237



>gb|KDP44432.1| hypothetical protein JCGZ_16265 [Jatropha curcas]
Length=181

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  432  AXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            + KDLRSRG CLVPI  T  V   NGA YW+P
Sbjct  143  SRKDLRSRGLCLVPIESTVHVASSNGADYWSP  174



>ref|XP_009774580.1| PREDICTED: transcription factor bHLH68-like isoform X1 [Nicotiana 
sylvestris]
Length=305

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -1

Query  477  KGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +G   H H Q   +   KDLRSRG CLVPIS T  VG D    YWAP
Sbjct  254  EGSMGHTHQQ--SDSQVKDLRSRGLCLVPISCTQHVGNDTVGDYWAP  298



>ref|XP_009774581.1| PREDICTED: transcription factor bHLH68-like isoform X2 [Nicotiana 
sylvestris]
Length=303

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -1

Query  477  KGXSDHHHPQXGDEEAXKDLRSRGXCLVPISXTXQVGXDNGAXYWAP  337
            +G   H H Q   +   KDLRSRG CLVPIS T  VG D    YWAP
Sbjct  252  EGSMGHTHQQ--SDSQVKDLRSRGLCLVPISCTQHVGNDTVGDYWAP  296



>emb|CDO97231.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 4/67 (6%)
 Frame = -1

Query  525  FPEDPGQLLXXNCLKRKGXSDHHHPQXGDE----EAXKDLRSRGXCLVPISXTXQVGXDN  358
            F +D  Q+L    L+R   S  +  + G E    E+  DLRS+G CLVP+  T  V   N
Sbjct  153  FLQDQVQVLCSPYLQRLPSSPRYLLEKGGECKEGESTTDLRSKGLCLVPVELTLHVAETN  212

Query  357  GAXYWAP  337
            GA +W+P
Sbjct  213  GADFWSP  219



>ref|XP_006406495.1| hypothetical protein EUTSA_v10021324mg [Eutrema salsugineum]
 gb|ESQ47948.1| hypothetical protein EUTSA_v10021324mg [Eutrema salsugineum]
Length=269

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = -1

Query  426  KDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAFggggXRSXNLR  295
            KDLRSRG CLVP+S T  V   NGA +W+P   G     S NL 
Sbjct  226  KDLRSRGLCLVPVSSTVHVENSNGADFWSPATMGHTTSPSMNLE  269



>dbj|BAH30460.1| hypothetical protein [Arabidopsis thaliana]
Length=84

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -1

Query  426  KDLRSRGXCLVPISXTXQVGXDNGAXYWAPXAF  328
            KDLRSRG CLVP+S T  V   NGA +W+P   
Sbjct  40   KDLRSRGLCLVPVSSTVHVENSNGADFWSPATM  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490