BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001F05

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           233   5e-72   
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           233   7e-72   Sesamum indicum [beniseed]
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           231   3e-71   Nicotiana tomentosiformis
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           231   4e-71   Nicotiana sylvestris
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                231   5e-71   Eucalyptus grandis [rose gum]
ref|NP_001274803.1|  uncharacterized protein LOC102577675               230   8e-71   Solanum tuberosum [potatoes]
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                230   1e-70   Solanum lycopersicum
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                229   1e-70   Prunus mume [ume]
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           229   1e-70   Nicotiana tomentosiformis
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           229   1e-70   Solanum tuberosum [potatoes]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                229   2e-70   Solanum lycopersicum
gb|KJB71614.1|  hypothetical protein B456_011G133700                    229   2e-70   Gossypium raimondii
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     231   3e-70   Eucalyptus grandis [rose gum]
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         228   3e-70   Prunus mume [ume]
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     228   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   228   4e-70   
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     228   4e-70   
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   228   4e-70   
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                228   6e-70   Erythranthe guttata [common monkey flower]
emb|CDP18434.1|  unnamed protein product                                229   6e-70   Coffea canephora [robusta coffee]
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           228   8e-70   Solanum tuberosum [potatoes]
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           227   1e-69   Fragaria vesca subsp. vesca
ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                227   1e-69   Nicotiana sylvestris
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                226   2e-69   Nicotiana tomentosiformis
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             226   3e-69   Prunus persica
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                226   3e-69   Fragaria vesca subsp. vesca
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         226   4e-69   Pyrus x bretschneideri [bai li]
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                226   4e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           225   5e-69   
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           225   5e-69   Nicotiana sylvestris
ref|XP_002524859.1|  ribosomal protein L5, putative                     225   8e-69   Ricinus communis
gb|KJB84075.1|  hypothetical protein B456_N001600                       221   9e-69   Gossypium raimondii
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           225   9e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         223   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             223   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         223   5e-68   Pyrus x bretschneideri [bai li]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           223   6e-68   Citrus sinensis [apfelsine]
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                223   7e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  222   7e-68   Citrus sinensis [apfelsine]
gb|KJB84074.1|  hypothetical protein B456_N001600                       221   7e-68   Gossypium raimondii
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     223   7e-68   Eucalyptus grandis [rose gum]
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         222   7e-68   Jatropha curcas
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                222   8e-68   Populus euphratica
gb|EMT04099.1|  60S ribosomal protein L5-2                              222   9e-68   
emb|CDP17898.1|  unnamed protein product                                224   1e-67   Coffea canephora [robusta coffee]
ref|XP_002524558.1|  ribosomal protein L5, putative                     222   1e-67   Ricinus communis
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         222   2e-67   Malus domestica [apple tree]
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                221   3e-67   Nelumbo nucifera [Indian lotus]
gb|KJB27798.1|  hypothetical protein B456_005G010200                    221   3e-67   Gossypium raimondii
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           223   4e-67   
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                221   4e-67   Cucumis melo [Oriental melon]
gb|KJB84073.1|  hypothetical protein B456_N001600                       220   4e-67   Gossypium raimondii
gb|KJB84072.1|  hypothetical protein B456_N001600                       220   5e-67   Gossypium raimondii
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           220   5e-67   
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             223   6e-67   
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           220   7e-67   
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         219   9e-67   Brachypodium distachyon [annual false brome]
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                219   9e-67   Vitis vinifera
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             219   1e-66   Citrus clementina [clementine]
emb|CBI24704.3|  unnamed protein product                                220   1e-66   Vitis vinifera
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           219   1e-66   Phoenix dactylifera
tpg|DAA56364.1|  TPA: hypothetical protein ZEAMMB73_635593              217   1e-66   
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           219   1e-66   Citrus sinensis [apfelsine]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   219   2e-66   Citrus sinensis [apfelsine]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   219   2e-66   
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           219   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                219   2e-66   
gb|EMS47485.1|  60S ribosomal protein L5-1                              218   2e-66   Triticum urartu
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           218   2e-66   Populus euphratica
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                218   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           218   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_010101365.1|  60S ribosomal protein L5                           218   3e-66   
gb|ABK93596.1|  unknown                                                 218   3e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                218   3e-66   Elaeis guineensis
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              218   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    218   4e-66   
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    218   4e-66   Elaeis guineensis
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             218   4e-66   Populus trichocarpa [western balsam poplar]
gb|AEV92989.1|  60S ribosomal protein L5                                218   5e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   219   5e-66   
gb|AFW84308.1|  hypothetical protein ZEAMMB73_937605                    215   5e-66   
gb|AES74307.2|  60S ribosomal protein L5-2                              217   7e-66   Medicago truncatula
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           217   9e-66   Phoenix dactylifera
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    217   1e-65   Phoenix dactylifera
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    217   1e-65   
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              217   1e-65   Brachypodium distachyon [annual false brome]
dbj|BAB33422.1|  putative senescence-associated protein                 216   1e-65   Pisum sativum [garden pea]
ref|XP_003604056.1|  60S ribosomal protein L5                           218   1e-65   
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         216   1e-65   Jatropha curcas
gb|ACU23594.1|  unknown                                                 216   1e-65   Glycine max [soybeans]
gb|ADR71225.1|  60S ribosomal protein L5A                               216   2e-65   Hevea brasiliensis [jebe]
gb|KHN27258.1|  60S ribosomal protein L5                                216   2e-65   Glycine soja [wild soybean]
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           216   2e-65   Cicer arietinum [garbanzo]
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                216   2e-65   Malus domestica [apple tree]
gb|ACG36552.1|  60S ribosomal protein L5-1                              216   2e-65   Zea mays [maize]
dbj|BAJ89012.1|  predicted protein                                      216   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              216   2e-65   Zea mays [maize]
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           216   2e-65   Glycine max [soybeans]
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         216   2e-65   Brachypodium distachyon [annual false brome]
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    216   2e-65   Glycine max [soybeans]
ref|NP_001267659.1|  60S ribosomal protein L5                           216   2e-65   Cucumis sativus [cucumbers]
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           216   3e-65   Populus euphratica
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           216   3e-65   Glycine max [soybeans]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           217   3e-65   Glycine max [soybeans]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         216   4e-65   Setaria italica
gb|ABK95722.1|  unknown                                                 215   4e-65   Populus trichocarpa [western balsam poplar]
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             215   4e-65   
gb|ADR71226.1|  60S ribosomal protein L5B                               215   6e-65   Hevea brasiliensis [jebe]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           215   7e-65   Cicer arietinum [garbanzo]
gb|KHN36792.1|  60S ribosomal protein L5                                214   7e-65   Glycine soja [wild soybean]
gb|ACR38045.1|  unknown                                                 215   8e-65   Zea mays [maize]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           214   8e-65   Glycine max [soybeans]
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    215   8e-65   
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    215   8e-65   
gb|EMS59984.1|  60S ribosomal protein L5-2                              214   8e-65   Triticum urartu
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    214   8e-65   Oryza brachyantha
gb|ACJ85054.1|  unknown                                                 214   1e-64   Medicago truncatula
gb|ABK93902.1|  unknown                                                 214   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                214   2e-64   Sesamum indicum [beniseed]
gb|EMT23062.1|  60S ribosomal protein L5-2                              213   3e-64   
ref|NP_001151284.1|  60S ribosomal protein L5-1                         213   3e-64   Zea mays [maize]
ref|XP_004171975.1|  PREDICTED: 60S ribosomal protein L5-like           211   3e-64   
gb|EMT20601.1|  60S ribosomal protein L5-2                              213   4e-64   
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             213   4e-64   Phaseolus vulgaris [French bean]
ref|NP_001189970.1|  60S ribosomal protein L5-1                         209   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           213   4e-64   Nelumbo nucifera [Indian lotus]
gb|KJB22668.1|  hypothetical protein B456_004G060400                    213   5e-64   Gossypium raimondii
gb|KJB22669.1|  hypothetical protein B456_004G060400                    213   5e-64   Gossypium raimondii
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   213   6e-64   Phaseolus vulgaris [French bean]
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      212   6e-64   Oryza sativa Japonica Group [Japonica rice]
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        212   7e-64   Oryza sativa Indica Group [Indian rice]
gb|AFK41086.1|  unknown                                                 212   7e-64   Medicago truncatula
ref|NP_001045083.1|  Os01g0896800                                       212   7e-64   
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         212   8e-64   Zea mays [maize]
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             212   8e-64   Eutrema salsugineum [saltwater cress]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             212   1e-63   Phaseolus vulgaris [French bean]
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        212   1e-63   
gb|AFK36106.1|  unknown                                                 211   1e-63   Lotus japonicus
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           211   1e-63   Sesamum indicum [beniseed]
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         211   2e-63   Tarenaya hassleriana [spider flower]
dbj|BAD82173.1|  putative ribosomal protein L5                          211   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             211   2e-63   Phaseolus vulgaris [French bean]
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          210   4e-63   
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           210   4e-63   Cucumis sativus [cucumbers]
gb|KJB27799.1|  hypothetical protein B456_005G010200                    210   4e-63   Gossypium raimondii
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           210   4e-63   Cucumis melo [Oriental melon]
gb|AFK46994.1|  unknown                                                 210   5e-63   Lotus japonicus
gb|AFK39593.1|  unknown                                                 210   6e-63   Lotus japonicus
dbj|BAH20263.1|  AT3G25520                                              206   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          209   1e-62   Sorghum bicolor [broomcorn]
gb|AHA84189.1|  60S ribosomal protein L5                                209   1e-62   Phaseolus vulgaris [French bean]
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         209   1e-62   Oryza brachyantha
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             209   1e-62   Arabidopsis lyrata subsp. lyrata
ref|NP_566767.1|  60S ribosomal protein L5-1                            209   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         209   2e-62   Tarenaya hassleriana [spider flower]
gb|KJB10810.1|  hypothetical protein B456_001G226000                    207   4e-62   Gossypium raimondii
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         207   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002876523.1|  predicted protein                                  207   5e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           207   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               207   6e-62   Erythranthe guttata [common monkey flower]
gb|AFK34395.1|  unknown                                                 207   7e-62   Lotus japonicus
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         207   8e-62   
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             206   1e-61   Capsella rubella
ref|NP_198790.1|  60S ribosomal protein L5-2                            206   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           207   2e-61   Elaeis guineensis
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    206   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         206   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         206   2e-61   Brassica rapa
gb|AAM64753.1|  ribosomal protein, putative                             206   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              205   3e-61   
emb|CDY52294.1|  BnaA03g57870D                                          206   3e-61   Brassica napus [oilseed rape]
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         205   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         205   4e-61   Camelina sativa [gold-of-pleasure]
emb|CDY27889.1|  BnaA07g04790D                                          205   4e-61   Brassica napus [oilseed rape]
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             205   5e-61   Capsella rubella
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             205   5e-61   
emb|CDY52293.1|  BnaA03g57860D                                          206   5e-61   Brassica napus [oilseed rape]
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             205   5e-61   
emb|CDY15088.1|  BnaC03g44490D                                          205   8e-61   Brassica napus [oilseed rape]
emb|CDY50258.1|  BnaC07g47930D                                          204   1e-60   Brassica napus [oilseed rape]
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    203   2e-60   Arabis alpina [alpine rockcress]
emb|CDY15089.1|  BnaC03g44500D                                          203   3e-60   Brassica napus [oilseed rape]
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    203   3e-60   Brassica rapa
gb|KHN15970.1|  60S ribosomal protein L5                                202   4e-60   Glycine soja [wild soybean]
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    202   4e-60   
ref|XP_009384264.1|  PREDICTED: 60S ribosomal protein L5-like iso...    197   1e-59   
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    201   1e-59   Arabis alpina [alpine rockcress]
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             201   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         201   2e-59   Brassica rapa
emb|CDX86312.1|  BnaA06g30290D                                          201   3e-59   
ref|XP_009384265.1|  PREDICTED: 60S ribosomal protein L5-like iso...    197   3e-59   
emb|CDX85331.1|  BnaC07g26420D                                          202   9e-59   
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             197   4e-58   Capsella rubella
gb|ABK21084.1|  unknown                                                 196   1e-57   Picea sitchensis
ref|XP_001759628.1|  predicted protein                                  191   7e-56   
ref|XP_010648788.1|  PREDICTED: 60S ribosomal protein L5-like           188   8e-56   Vitis vinifera
ref|XP_001783411.1|  predicted protein                                  190   3e-55   
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            188   6e-55   
gb|EYU36673.1|  hypothetical protein MIMGU_mgv1a0142632mg               184   7e-55   Erythranthe guttata [common monkey flower]
ref|XP_001767871.1|  predicted protein                                  189   8e-55   
gb|KHG04393.1|  60S ribosomal L5                                        187   2e-54   Gossypium arboreum [tree cotton]
ref|XP_001783620.1|  predicted protein                                  187   3e-54   
gb|KJB71615.1|  hypothetical protein B456_011G133700                    186   6e-54   Gossypium raimondii
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   185   1e-53   Citrus sinensis [apfelsine]
gb|KHG14330.1|  60S ribosomal L5                                        184   2e-53   Gossypium arboreum [tree cotton]
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             184   5e-53   Selaginella moellendorffii
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  182   9e-53   Citrus sinensis [apfelsine]
gb|KCW63927.1|  hypothetical protein EUGRSUZ_G016041                    179   9e-53   Eucalyptus grandis [rose gum]
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             182   3e-52   Selaginella moellendorffii
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  181   3e-52   Citrus sinensis [apfelsine]
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     181   7e-52   Eucalyptus grandis [rose gum]
gb|KHG10378.1|  60S ribosomal protein L5                                179   2e-51   Gossypium arboreum [tree cotton]
gb|KHG10377.1|  60S ribosomal protein L5                                179   2e-51   Gossypium arboreum [tree cotton]
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           178   5e-51   
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         172   1e-48   Camelina sativa [gold-of-pleasure]
gb|KHF99386.1|  60S ribosomal L5                                        172   1e-48   Gossypium arboreum [tree cotton]
gb|EPS61271.1|  hypothetical protein M569_13526                         171   1e-48   Genlisea aurea
gb|KHG15135.1|  60S ribosomal L5                                        170   4e-48   Gossypium arboreum [tree cotton]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          171   5e-48   
ref|XP_010451808.1|  PREDICTED: 60S ribosomal protein L5-1-like         165   1e-47   
sp|P93779.1|RL5_SOLME  RecName: Full=60S ribosomal protein L5           162   9e-47   Solanum melongena [aubergine]
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    164   9e-46   
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   165   1e-45   Phaseolus vulgaris [French bean]
ref|XP_009383145.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    152   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011399144.1|  60S ribosomal protein L5-1                         156   3e-42   Auxenochlorella protothecoides
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              155   5e-42   Chlorella variabilis
gb|KDD76608.1|  ribosomal L18p/L5e                                      149   2e-39   Helicosporidium sp. ATCC 50920
gb|EME50014.1|  hypothetical protein DOTSEDRAFT_31141                   143   2e-37   Dothistroma septosporum NZE10
ref|XP_003856228.1|  60S ribosomal protein L5                           142   7e-37   Zymoseptoria tritici IPO323
gb|EMF17397.1|  60S ribosomal protein L5                                140   3e-36   Sphaerulina musiva SO2202
gb|KEQ82579.1|  hypothetical protein M438DRAFT_398586                   140   4e-36   Aureobasidium pullulans EXF-150
gb|KEQ95896.1|  hypothetical protein AUEXF2481DRAFT_39748               139   6e-36   Aureobasidium subglaciale EXF-2481
dbj|GAM82159.1|  hypothetical protein ANO11243_001380                   139   1e-35   fungal sp. No.11243
gb|KEQ78036.1|  hypothetical protein M436DRAFT_59974                    137   4e-35   Aureobasidium namibiae CBS 147.97
ref|XP_007920104.1|  hypothetical protein MYCFIDRAFT_54807              137   4e-35   Pseudocercospora fijiensis CIRAD86
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             137   4e-35   Emiliania huxleyi CCMP1516
gb|KHN36791.1|  60S ribosomal protein L5                                135   4e-35   Glycine soja [wild soybean]
ref|XP_007674186.1|  hypothetical protein BAUCODRAFT_146209             137   4e-35   Baudoinia panamericana UAMH 10762
gb|KID66354.1|  Ribosomal protein L5, eukaryotic/archaeal               137   4e-35   Metarhizium anisopliae ARSEF 549
gb|KEQ61687.1|  hypothetical protein M437DRAFT_67147                    137   5e-35   Aureobasidium melanogenum CBS 110374
gb|KID85893.1|  Ribosomal protein L5, eukaryotic/archaeal               137   7e-35   Metarhizium guizhouense ARSEF 977
ref|XP_007816229.1|  Ribosomal protein L5, eukaryotic/archaeal          137   7e-35   Metarhizium robertsii ARSEF 23
gb|KID72246.1|  Ribosomal protein L5, eukaryotic/archaeal               137   8e-35   Metarhizium brunneum ARSEF 3297
emb|CEJ93107.1|  Putative 60S ribosomal protein L5 (CPR4)               134   2e-34   Torrubiella hemipterigena
gb|EKG20809.1|  Ribosomal protein L18/L5                                135   2e-34   Macrophomina phaseolina MS6
ref|XP_005643753.1|  60S ribosomal protein L5                           135   2e-34   Coccomyxa subellipsoidea C-169
emb|CCE29368.1|  probable 60S ribosomal protein L5                      135   3e-34   Claviceps purpurea 20.1
gb|KEF55260.1|  60S ribosomal protein L5                                135   3e-34   Exophiala aquamarina CBS 119918
ref|XP_007813241.1|  60S ribosomal protein L5                           135   4e-34   Metarhizium acridum CQMa 102
sp|Q56FG6.1|RL5_LYSTE  RecName: Full=60S ribosomal protein L5           134   5e-34   Lysiphlebus testaceipes
ref|XP_002675028.1|  predicted protein                                  134   5e-34   Naegleria gruberi strain NEG-M
gb|KDR83692.1|  hypothetical protein GALMADRAFT_236026                  134   6e-34   Galerina marginata CBS 339.88
ref|XP_001912102.1|  hypothetical protein                               134   6e-34   Podospora anserina S mat+
ref|XP_002176750.1|  predicted protein                                  134   6e-34   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008022306.1|  hypothetical protein SETTUDRAFT_167313             132   8e-34   Exserohilum turcica Et28A
gb|KDB12690.1|  60S ribosomal protein L5                                134   1e-33   Ustilaginoidea virens
gb|KHN96356.1|  60S ribosomal protein L5                                133   1e-33   Metarhizium album ARSEF 1941
emb|CCX32875.1|  Similar to 60S ribosomal protein L5; acc. no. O5...    133   1e-33   Pyronema omphalodes CBS 100304
emb|CEJ93106.1|  Putative 60S ribosomal protein L5 (CPR4)               133   1e-33   Torrubiella hemipterigena
ref|XP_003715227.1|  60S ribosomal protein L5                           133   1e-33   Magnaporthe oryzae 70-15
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           133   1e-33   Suberites domuncula
gb|KEZ38694.1|  hypothetical protein SAPIO_CDS10715                     133   1e-33   Scedosporium apiospermum
ref|XP_007712612.1|  hypothetical protein COCCADRAFT_5332               133   2e-33   Bipolaris zeicola 26-R-13
ref|XP_008198550.1|  PREDICTED: 60S ribosomal protein L5                133   2e-33   Tribolium castaneum [rust-red flour beetle]
gb|EMR84013.1|  putative 60s ribosomal protein l5 protein               132   2e-33   Botrytis cinerea BcDW1
ref|XP_007738723.1|  60S ribosomal protein L5                           132   2e-33   Capronia epimyces CBS 606.96
gb|EMD90558.1|  hypothetical protein COCHEDRAFT_1022415                 132   2e-33   Bipolaris maydis C5
ref|XP_009847564.1|  hypothetical protein NEUTE1DRAFT_75066             132   2e-33   Neurospora tetrasperma FGSC 2508
ref|XP_007687883.1|  hypothetical protein COCMIDRAFT_36698              132   2e-33   Bipolaris oryzae ATCC 44560
gb|KIK30810.1|  hypothetical protein PISMIDRAFT_86523                   133   2e-33   Pisolithus microcarpus 441
ref|XP_011197235.1|  PREDICTED: 60S ribosomal protein L5                132   2e-33   Bactrocera dorsalis [papaya fruit fly]
gb|KDQ29411.1|  hypothetical protein PLEOSDRAFT_1055401                 132   3e-33   Pleurotus ostreatus PC15
ref|XP_001837210.1|  60S ribosomal protein L5                           132   3e-33   Coprinopsis cinerea okayama7#130
ref|XP_001547892.1|  60S ribosomal protein L5                           132   3e-33   Botrytis cinerea B05.10
gb|KIW03639.1|  60S ribosomal protein L5                                132   3e-33   Verruconis gallopava
ref|XP_007329342.1|  hypothetical protein AGABI1DRAFT_84575             132   3e-33   Agaricus bisporus var. burnettii JB137-S8
gb|KDR11979.1|  60S ribosomal protein L5                                132   4e-33   Zootermopsis nevadensis
ref|XP_006460296.1|  hypothetical protein AGABI2DRAFT_142569            132   4e-33   Agaricus bisporus var. bisporus H97
gb|EHK26573.1|  hypothetical protein TRIVIDRAFT_77851                   132   4e-33   Trichoderma virens Gv29-8
gb|EFX90266.1|  hypothetical protein DAPPUDRAFT_299917                  132   4e-33   
ref|XP_001268969.1|  60S ribosomal protein L5                           132   4e-33   
ref|XP_007705225.1|  hypothetical protein COCSADRAFT_41417              132   4e-33   
emb|CCU97371.1|  unnamed protein product                                132   5e-33   
gb|KDO24705.1|  hypothetical protein SPRG_10239                         132   5e-33   
ref|XP_007581033.1|  putative 60s ribosomal protein l5 protein          132   6e-33   
gb|KFY58522.1|  hypothetical protein V496_06088                         131   6e-33   
ref|XP_007366056.1|  hypothetical protein DICSQDRAFT_86741              131   6e-33   
ref|XP_007337949.1|  hypothetical protein AURDEDRAFT_110414             132   6e-33   
ref|XP_003349274.1|  60S ribosomal protein L5                           132   6e-33   
gb|KIO13004.1|  hypothetical protein M404DRAFT_706860                   132   6e-33   
ref|XP_004533872.1|  PREDICTED: 60S ribosomal protein L5-like           131   6e-33   
ref|XP_008605837.1|  50S ribosomal protein L5e                          131   7e-33   
gb|KFY16774.1|  hypothetical protein V492_01113                         131   7e-33   
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       131   7e-33   
ref|XP_011191002.1|  PREDICTED: 60S ribosomal protein L5                131   7e-33   
gb|KFY37418.1|  hypothetical protein V494_04756                         131   8e-33   
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   130   9e-33   
gb|KIW74224.1|  60S ribosomal protein L5                                131   9e-33   
gb|ABS18358.1|  ribosomal protein L5                                    127   1e-32   
ref|NP_983506.1|  60S ribosomal protein L5                              131   1e-32   
gb|KFY83677.1|  hypothetical protein V500_10007                         131   1e-32   
gb|KFZ19673.1|  hypothetical protein V501_00580                         131   1e-32   
ref|XP_960578.1|  60s ribosomal protein l5                              131   1e-32   
gb|KIM67945.1|  hypothetical protein SCLCIDRAFT_107388                  130   1e-32   
gb|EPT03783.1|  hypothetical protein FOMPIDRAFT_1022326                 130   1e-32   
emb|CCF48291.1|  probable RPL5-60S large subunit ribosomal protei...    130   1e-32   
ref|XP_003662289.1|  hypothetical protein MYCTH_78218                   130   1e-32   
ref|XP_003649901.1|  60S ribosomal protein L5                           130   1e-32   
gb|KFA64074.1|  hypothetical protein S40285_06737                       130   1e-32   
emb|CAJ17229.1|  ribosomal protein L5e                                  130   1e-32   
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     130   1e-32   
gb|ADQ73874.1|  60S ribosomal protein L5                                130   2e-32   
ref|XP_008715217.1|  60S ribosomal protein L5                           130   2e-32   
gb|KIY49257.1|  hypothetical protein FISHEDRAFT_72600                   130   2e-32   
gb|EHL03541.1|  putative 60S ribosomal protein L5                       130   2e-32   
ref|XP_006611949.1|  PREDICTED: 60S ribosomal protein L5-like           130   2e-32   
gb|KEY69974.1|  hypothetical protein S7711_03992                        130   2e-32   
ref|XP_624620.2|  PREDICTED: 60S ribosomal protein L5                   130   2e-32   
ref|XP_002295395.1|  RL5, ribosomal protein 5, 60S large ribosoma...    130   2e-32   
dbj|BAN20290.1|  ribosomal protein L5                                   130   2e-32   
gb|KFY79291.1|  hypothetical protein V499_01707                         130   2e-32   
ref|XP_007268728.1|  60S ribosomal protein L5                           130   2e-32   
gb|KIW58102.1|  60S ribosomal protein L5                                130   2e-32   
gb|KIK68088.1|  hypothetical protein GYMLUDRAFT_92742                   130   2e-32   
ref|XP_008083855.1|  Translational machinery component                  130   3e-32   
ref|XP_002497480.1|  60S ribosomal protein L5                           130   3e-32   
gb|KFY22525.1|  hypothetical protein V493_06526                         130   3e-32   
ref|XP_001588768.1|  60S ribosomal protein L5                           129   3e-32   
ref|XP_001940200.1|  60S ribosomal protein L5                           129   3e-32   
gb|EUC66279.1|  60S ribosomal protein L5                                129   3e-32   
ref|XP_002109848.1|  expressed hypothetical protein                     129   3e-32   
ref|NP_001037008.1|  60S ribosomal protein L5                           129   3e-32   
ref|XP_007773415.1|  60S ribosomal protein L5                           129   4e-32   
gb|KIW93473.1|  60S ribosomal protein L5                                129   4e-32   
ref|XP_001800680.1|  hypothetical protein SNOG_10409                    128   4e-32   
ref|XP_006968241.1|  ribosomal protein L5                               129   4e-32   
ref|XP_007746291.1|  60S ribosomal protein L5                           129   4e-32   
gb|AAN73355.1|  ribosomal protein L5                                    129   4e-32   
ref|XP_008730876.1|  60S ribosomal protein L5                           130   4e-32   
gb|AAV34814.1|  ribosomal protein L5                                    129   4e-32   
gb|KIW09974.1|  60S ribosomal protein L5                                129   4e-32   
ref|XP_007880337.1|  hypothetical protein PFL1_04620                    129   4e-32   
gb|KIV84110.1|  60S ribosomal protein L5                                129   4e-32   
ref|XP_009492195.1|  50S ribosomal protein L5e                          129   4e-32   
gb|KIX96197.1|  60S ribosomal protein L5                                129   4e-32   
gb|KDN36129.1|  putative RPL5-60S large subunit ribosomal protein...    129   5e-32   
gb|EPS25441.1|  hypothetical protein PDE_00374                          129   5e-32   
emb|CBN08634.1|  small nucleolar RNA, C/D box 21                        129   5e-32   
ref|XP_003424029.1|  PREDICTED: 60S ribosomal protein L5                129   5e-32   
ref|XP_001392690.2|  60S ribosomal protein L5                           129   5e-32   
ref|XP_007290078.1|  60S ribosomal protein L5                           129   5e-32   
emb|CAK45545.1|  unnamed protein product                                129   5e-32   
ref|XP_007392523.1|  hypothetical protein PHACADRAFT_250801             129   6e-32   
ref|XP_003842266.1|  similar to 60S ribosomal protein L5                129   6e-32   
gb|KIY71482.1|  hypothetical protein CYLTODRAFT_487247                  129   6e-32   
ref|XP_011264134.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    129   6e-32   
ref|XP_003648419.1|  hypothetical protein Ecym_8324                     129   6e-32   
ref|XP_003006324.1|  60S ribosomal protein L5                           129   7e-32   
gb|KIN05730.1|  hypothetical protein OIDMADRAFT_16965                   129   8e-32   
ref|XP_007381881.1|  60S ribosomal protein L5                           129   8e-32   
gb|KIK95588.1|  hypothetical protein PAXRUDRAFT_826861                  129   8e-32   
gb|ACG27083.1|  60S ribosomal protein L5-2                              128   9e-32   
gb|KII95147.1|  hypothetical protein PLICRDRAFT_97457                   129   9e-32   
ref|XP_003487475.1|  PREDICTED: 60S ribosomal protein L5-like           128   9e-32   
ref|XP_009153803.1|  60S ribosomal protein L5                           128   9e-32   
gb|EHK45382.1|  hypothetical protein TRIATDRAFT_300024                  128   9e-32   
gb|AGO11355.1|  AaceriACR104Cp                                          128   9e-32   
ref|XP_002550737.1|  60S ribosomal protein L5                           128   9e-32   
gb|KHJ35883.1|  putative 60s ribosomal protein l5                       128   9e-32   
emb|CCU76476.1|  60S ribosomal protein L5                               128   1e-31   
gb|KIX05556.1|  60S ribosomal protein L5                                128   1e-31   
ref|XP_009223169.1|  60S ribosomal protein L5                           128   1e-31   
ref|XP_001877132.1|  60S ribosomal protein L5                           128   1e-31   
ref|XP_008861011.1|  hypothetical protein H310_00139                    128   1e-31   
ref|XP_011302246.1|  PREDICTED: 60S ribosomal protein L5                128   1e-31   
ref|XP_007762113.1|  60S ribosomal protein L5                           128   1e-31   
ref|XP_007861880.1|  60S ribosomal protein L5                           128   1e-31   
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 128   1e-31   
gb|EQL01602.1|  Ribosomal protein L5, eukaryotic/archaeal               128   1e-31   
gb|KFX88354.1|  hypothetical protein V490_07682                         128   1e-31   
gb|KIM25886.1|  hypothetical protein M408DRAFT_330884                   128   1e-31   
gb|EPZ34992.1|  60S ribosomal protein L5                                128   1e-31   
ref|XP_003298671.1|  60S ribosomal protein L5                           128   1e-31   
ref|XP_007275120.1|  60s ribosomal protein l5                           128   1e-31   
ref|XP_003708145.1|  PREDICTED: 60S ribosomal protein L5-like           127   1e-31   
gb|KGG50093.1|  60S ribosomal protein L5-2                              128   2e-31   
ref|XP_009648689.1|  60S ribosomal protein L5                           127   2e-31   
gb|ELU36170.1|  60S ribosomal protein L5                                129   2e-31   
gb|ELR09388.1|  60S ribosomal protein L5                                127   2e-31   
ref|XP_007779399.1|  60S ribosomal protein L5                           127   2e-31   
ref|XP_003394373.1|  PREDICTED: 60S ribosomal protein L5-like           128   2e-31   
gb|KIK06671.1|  hypothetical protein K443DRAFT_673956                   127   2e-31   
gb|KIK48932.1|  hypothetical protein CY34DRAFT_797724                   128   2e-31   
ref|XP_011264968.1|  PREDICTED: 60S ribosomal protein L5-like           127   2e-31   
gb|EJK70557.1|  hypothetical protein THAOC_08069                        127   2e-31   
gb|KIM46136.1|  hypothetical protein M413DRAFT_441200                   127   2e-31   
ref|XP_009830190.1|  hypothetical protein H257_06606                    127   2e-31   
emb|CDI55135.1|  probable RPL5-60S large subunit ribosomal protei...    127   2e-31   
gb|KJB10809.1|  hypothetical protein B456_001G226000                    125   2e-31   
ref|XP_001639289.1|  predicted protein                                  127   2e-31   
ref|NP_001104213.1|  uncharacterized protein LOC100126642               127   2e-31   
ref|XP_002375890.1|  60S ribosomal protein L5                           127   3e-31   
gb|EQB57780.1|  hypothetical protein CGLO_02053                         127   3e-31   
ref|XP_001264474.1|  60S ribosomal protein L5                           128   3e-31   
ref|XP_001727600.2|  60S ribosomal protein L5                           127   3e-31   
ref|XP_003036567.1|  60S ribosomal protein L5                           127   3e-31   
gb|KIW40012.1|  60S ribosomal protein L5                                127   3e-31   
ref|NP_001036387.1|  ribosomal protein L5, isoform A                    127   3e-31   
ref|XP_007915920.1|  putative 60s ribosomal protein l5 protein          127   3e-31   
gb|KIJ20064.1|  hypothetical protein PAXINDRAFT_166226                  127   3e-31   
ref|XP_001973913.1|  GG21448                                            127   3e-31   
ref|XP_001634531.1|  predicted protein                                  127   3e-31   
gb|EFN62403.1|  60S ribosomal protein L5                                127   3e-31   
gb|KJA30227.1|  hypothetical protein HYPSUDRAFT_196476                  127   3e-31   
gb|EFZ13276.1|  hypothetical protein SINV_12586                         127   3e-31   
dbj|BAA31570.1|  ribosomal protein L5 homolog                           125   3e-31   
ref|XP_007725761.1|  60S ribosomal protein L5                           127   4e-31   
ref|XP_011167373.1|  PREDICTED: 60S ribosomal protein L5                127   4e-31   
ref|XP_008553482.1|  PREDICTED: 60S ribosomal protein L5                127   4e-31   
ref|XP_011390982.1|  ribosomal 60S subunit protein L5                   127   4e-31   
gb|KIJ70516.1|  hypothetical protein HYDPIDRAFT_78845                   127   4e-31   
ref|XP_002044351.1|  GM26730                                            127   4e-31   
ref|XP_003693438.1|  PREDICTED: 60S ribosomal protein L5-like           126   4e-31   
ref|XP_011150405.1|  PREDICTED: 60S ribosomal protein L5-like           126   4e-31   
gb|KFY01844.1|  hypothetical protein O988_02499                         126   5e-31   
ref|XP_006689766.1|  hypothetical protein CANTEDRAFT_116632             126   5e-31   
emb|CEL63831.1|  60S ribosomal protein L5-A OS=Schizosaccharomyce...    127   5e-31   
gb|EFQ28351.1|  ribosomal L18p/L5e family protein                       126   5e-31   
gb|EPQ65986.1|  Protein component of the large (60S) ribosomal su...    126   6e-31   
gb|KHJ99496.1|  ribosomal L18p/L5e family protein                       126   6e-31   
ref|XP_008599464.1|  60S ribosomal protein L5 (CPR4)                    126   6e-31   
ref|XP_007834039.1|  60S ribosomal protein L5                           126   6e-31   
gb|KIW22485.1|  60S ribosomal protein L5                                126   6e-31   
gb|EPY50651.1|  60S ribosomal protein L5                                126   7e-31   
gb|KIW62448.1|  60S ribosomal protein L5                                126   7e-31   
gb|EMD40741.1|  hypothetical protein CERSUDRAFT_80390                   126   7e-31   
ref|XP_002002621.1|  GI17484                                            130   8e-31   
gb|EFN77280.1|  60S ribosomal protein L5                                126   8e-31   
ref|XP_006696670.1|  60S ribosomal protein l5-like protein              126   8e-31   
ref|XP_002478553.1|  60S ribosomal protein L5                           125   8e-31   
ref|XP_002066772.1|  GK24660                                            125   9e-31   
emb|CCG82998.1|  60S ribosomal protein L5-B                             125   1e-30   
gb|EST08870.1|  60S ribosomal protein                                   125   1e-30   
emb|CCQ18634.1|  60S ribosomal protein L5                               125   1e-30   
ref|XP_002023101.1|  GL21177                                            125   1e-30   
emb|CDO75577.1|  hypothetical protein BN946_scf184858.g17               125   1e-30   
gb|EEH21335.1|  60S ribosomal protein L5                                125   1e-30   
ref|XP_002784462.1|  60S ribosomal protein L5, putative                 125   1e-30   
ref|NP_596399.1|  60S ribosomal protein L5                              125   1e-30   
ref|XP_001210567.1|  60S ribosomal protein L5                           125   1e-30   
ref|XP_002786530.1|  60S ribosomal protein L5, putative                 125   2e-30   
ref|XP_001119361.1|  PREDICTED: 60S ribosomal protein L5-like           125   2e-30   
dbj|GAA88524.1|  60S ribosomal protein L5                               125   2e-30   
ref|XP_007852257.1|  60s ribosomal protein l5                           125   2e-30   
ref|XP_011107683.1|  hypothetical protein H072_1692                     125   2e-30   
gb|KIV97220.1|  60S ribosomal protein L5                                125   2e-30   
ref|XP_002146254.1|  60S ribosomal protein L5                           125   2e-30   
ref|XP_001224676.1|  60S ribosomal protein L5                           125   2e-30   
ref|XP_002544923.1|  60S ribosomal protein L5                           125   2e-30   
ref|XP_002798009.1|  60S ribosomal protein L5                           125   2e-30   
gb|ESZ92263.1|  hypothetical protein SBOR_7352                          130   2e-30   
ref|XP_007800448.1|  60S ribosomal protein L5                           124   2e-30   
emb|CCF44686.1|  60S ribosomal protein L5                               124   2e-30   
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           124   2e-30   
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      124   3e-30   
ref|XP_752659.1|  60S ribosomal protein L5                              124   3e-30   
sp|O65353.1|RL5_HELAN  RecName: Full=60S ribosomal protein L5           124   3e-30   
ref|XP_009543697.1|  hypothetical protein HETIRDRAFT_408220             124   3e-30   
ref|XP_001966910.1|  GF22760                                            124   3e-30   
gb|KIO30996.1|  hypothetical protein M407DRAFT_241930                   124   3e-30   
ref|XP_006673626.1|  60S ribosomal protein L5 (CPR4)                    124   3e-30   
emb|CAD28431.1|  probable 60S ribosomal protein l5                      124   3e-30   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     124   3e-30   
ref|XP_007315632.1|  hypothetical protein SERLADRAFT_461185             124   3e-30   
gb|KIL96266.1|  60s ribosomal protein l5                                124   3e-30   
ref|XP_003050722.1|  60S ribosomal protein L5                           124   3e-30   
gb|KDQ64549.1|  hypothetical protein JAAARDRAFT_28194                   124   3e-30   
ref|XP_002490002.1|  60S ribosomal protein L5                           124   3e-30   
ref|XP_011054859.1|  PREDICTED: 60S ribosomal protein L5                124   3e-30   
ref|XP_003675508.1|  hypothetical protein NCAS_0C01510                  124   3e-30   
gb|KHN80572.1|  60S ribosomal protein L5                                124   3e-30   
emb|CEF66000.1|  60S ribosomal protein L5                               124   4e-30   
ref|XP_004199306.1|  Piso0_002740                                       124   4e-30   
gb|KDN68874.1|  putative ribosomal L18p/L5e family protein              124   4e-30   
gb|KFH68392.1|  60S ribosomal protein L5                                124   4e-30   
ref|XP_007303062.1|  hypothetical protein STEHIDRAFT_120627             124   4e-30   
gb|EFN62999.1|  60S ribosomal protein L5                                129   4e-30   
ref|XP_008035731.1|  60S ribosomal protein L5                           124   5e-30   
dbj|GAK66444.1|  60S ribosomal protein L5                               124   5e-30   
ref|XP_004200165.1|  Piso0_002740                                       124   5e-30   
ref|XP_001612181.1|  ribosomal L18p/L5e family protein                  124   5e-30   
sp|O22608.1|RL5_DUNSA  RecName: Full=60S ribosomal protein L5           123   5e-30   
ref|XP_003283302.1|  60S ribosomal protein L5                           123   5e-30   
gb|ETS60256.1|  hypothetical protein PaG_05805                          125   6e-30   
ref|XP_009046069.1|  hypothetical protein LOTGIDRAFT_224562             123   6e-30   
ref|XP_005188116.1|  PREDICTED: 60S ribosomal protein L5                123   6e-30   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           123   6e-30   
gb|AEL28875.1|  ribosomal protein L5                                    123   6e-30   
ref|NP_495811.1|  Protein RPL-5                                         123   7e-30   
dbj|BAN65645.1|  ribosomal L18p/L5e family protein                      123   7e-30   



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFAG++KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFAGYSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYMN+L EDEPEKYQTHFS YIK G+EADN+E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVAAYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYKKVHAAIRADPSPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA GN
Sbjct  255  SGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  293



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD+K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDNKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHV+AYMN+L EDEPEKYQ+HFS YIKK IE DNIEA+YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVSAYMNTLMEDEPEKYQSHFSEYIKKSIEPDNIEAMYKKVHAAIRADPTEKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPKEHKR+N KKLTY+ER+AKLIERLNALNAAAGN
Sbjct  255  SEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNAAAGN  293



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFSKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+EAD++E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYKKVHAAIRADPSPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+EAD++E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYKKVHAAIRADPSPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHV+AYM+SL EDEPEKYQ+HFS YIKKGIE D+ EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYKKVHAAIRADPTLKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S+K  PKEHKRFN KKLTY+ER+ KLIERLNALN+AAG
Sbjct  255  SDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  292



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFAG++KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFAGYSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RK+IYGGHV AYMN+L EDEPEKYQTHFS YIK G+EADN+E +YKKVHAAIRADP PKK
Sbjct  195  RKFIYGGHVTAYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYKKVHAAIRADPCPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA GN
Sbjct  255  SGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  293



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKYQTHFS YIKKG EAD +E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVATYMQTLIEDEPEKYQTHFSQYIKKGFEADGLEEMYKKVHAAIRADPSPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIEADNIEA+YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYKKVHAAIRADPTAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             EKQPPKEHKR+N KKLTY+ER+ KLIERLNA N+AA
Sbjct  255  IEKQPPKEHKRYNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFAGF KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFGKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHV+AYM +L EDEPEKYQ+HFS YIK G+EAD++E +YKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVSAYMKTLMEDEPEKYQSHFSEYIKTGLEADDLEEMYKKVHAAIRADPSSKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQPPK+HKR+N KKLTYDER+A+LIERLNALNAAAGN
Sbjct  255  SDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAGN  293



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AENRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKYQTHFS YIKKG+EAD +E +YKKVHAAIRADP PKK
Sbjct  195  RKYIYGGHVATYMKTLIEDEPEKYQTHFSEYIKKGLEADGLEEMYKKVHAAIRADPCPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH EKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKY +HFSGYIK+G+EADN+E +YKKVHAAIRA+PSPKK
Sbjct  195  RKYIYGGHVATYMKTLIEDEPEKYLSHFSGYIKRGLEADNLEEMYKKVHAAIRAEPSPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIPHS+KRFAGF+KD+K LDAEVH K
Sbjct  137  TRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFAGFSKDNKQLDAEVHSK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEADNIE+LYKKVHAAIRADP+ KK+E
Sbjct  197  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPTAKKTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            K+PPK+HKRFN KKLTY+ER+AKLIERL+ LNAAAG+
Sbjct  257  KEPPKQHKRFNLKKLTYEERKAKLIERLHTLNAAAGD  293



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  199  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  258

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHV+AYM+SL EDEPEKYQ+HFS YIKKGIE D+ EALYKKVHAAIRADP+ KK
Sbjct  259  RKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYKKVHAAIRADPTLKK  318

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S+K  PKEHKRFN KKLTY+ER+ KLIERLNALN+AAG
Sbjct  319  SDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  356



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD+PHSEKRFAGF+KD+K LD++VHR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKDNKQLDSDVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVAAYM  L+EDEPEK+QTHFSGYIKKG+EA+ IE +YKKVHAAIRADP+ K +
Sbjct  196  KYIYGGHVAAYMGILSEDEPEKFQTHFSGYIKKGVEAEGIEEMYKKVHAAIRADPTVKLT  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            EK+  KEHKRFN KKLTYDER+ KLIERLNA N+AAG+
Sbjct  256  EKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAGD  293



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LDAE H
Sbjct  135  AETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAETH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKYQTHFS Y+K+GIEAD +EALYKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYKKVHAAIRADPSVKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK  P++HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  255  SEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVHRK
Sbjct  137  TRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y+YGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD++EALYKKVHAAIRADP+ KKSE
Sbjct  197  YLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALYKKVHAAIRADPTAKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K+PPKEHKRFN KKLTY+ER+AKLIERL+ LN+AAG
Sbjct  257  KEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  292



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LDAE H
Sbjct  137  AETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAETH  196

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKYQTHFS Y+K+GIEAD +EALYKKVHAAIRADPS KK
Sbjct  197  RKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYKKVHAAIRADPSVKK  256

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK  P++HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  257  SEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  294



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVHRK
Sbjct  138  TRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRK  197

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y+YGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD++EALYKKVHAAIRADP+ KKSE
Sbjct  198  YLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALYKKVHAAIRADPTAKKSE  257

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K+PPKEHKRFN KKLTY+ER+AKLIERL+ LN+AAG
Sbjct  258  KEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  293



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAG+ KD+K LD EVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKDNKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA+YMN+L EDEP+KYQ+HFS Y+KKG+EADNIE +YKKVHAAIRADP+PKK
Sbjct  195  RKYIYGGHVASYMNTLMEDEPDKYQSHFSKYVKKGVEADNIEEMYKKVHAAIRADPTPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQ PK+HKR+N KKLTY+ER+AKLIERLNALNAAAGN
Sbjct  255  SDKQQPKQHKRYNLKKLTYEERKAKLIERLNALNAAAGN  293



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGF K+SK LD EVHRK
Sbjct  167  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFDKESKQLDPEVHRK  226

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPE+YQ+HFS YIK+G+EADNIE LYKKVHAAIRAD S KKSE
Sbjct  227  YIYGGHVAAYMRTLIEDEPERYQSHFSEYIKRGLEADNIEELYKKVHAAIRADSSAKKSE  286

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            K+PPKEHKR+N KKLTY+ERRAKLIERLNALN+AAGN
Sbjct  287  KEPPKEHKRYNLKKLTYEERRAKLIERLNALNSAAGN  323



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH EKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFSKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+EADN+E +YKKVHAAIRA+PSPKK
Sbjct  195  RKYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKRGLEADNLEEMYKKVHAAIRAEPSPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D+PHSEKRFAGF+KDSK+LDAE H
Sbjct  135  GESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFAGFSKDSKSLDAETH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIEA+ IE LYKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIEAEGIEELYKKVHAAIRADPLEKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            + K  PK+HKRFN KKLTY+ER+ KLIERLNA N+AA
Sbjct  255  TAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFSKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YIYGGHVA YM +L EDEPEKYQ+HFS YIKKG+EAD +E +YKKVHAAIRADP+ KK
Sbjct  195  RNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADGLEEMYKKVHAAIRADPTFKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SDKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YIYGGHVA YM +L EDEPEKYQ+HFS YIKKG+EAD++E +YKKVHAAIRADP+ KK
Sbjct  195  RNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADHLEEMYKKVHAAIRADPTFKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+K PPK+HKR+N KKLTY+ER+AKLIERLNALN+AAGN
Sbjct  255  SDKHPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD+PHSEKRFAGF+KD+K LD++VHR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKDNKQLDSDVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVAAYM  L+EDEPEK+QTHFS YIKKG+EA+ IE +YKKVHAAIRADP+ K +
Sbjct  196  KYIYGGHVAAYMGILSEDEPEKFQTHFSAYIKKGVEAEGIEEMYKKVHAAIRADPTVKLT  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            EK+  KEHKRFN KKLTYDER+ KLIERLNA N+AAG+
Sbjct  256  EKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAGD  293



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH 
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHH  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVAAYM +L EDEPEKYQTHFS Y+KKGIEADNIE +YKKVHAAIRADP+ KKS
Sbjct  196  KYIYGGHVAAYMRTLMEDEPEKYQTHFSEYLKKGIEADNIEEVYKKVHAAIRADPTMKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             K  P EHKR+N KKLTY+ER+ KLIERLNA N+AA
Sbjct  256  SKPQPSEHKRWNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYMN+L EDEPEKYQTHFS YIKKGIEADNIE LYKKVHAAIRADP+PKK
Sbjct  195  RKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYKKVHAAIRADPTPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNAL  231
            +EKQPP EHKR+N KKLT+DER+ KL+ERL A 
Sbjct  255  TEKQPPTEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LDAE H
Sbjct  135  AETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEAH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHV+ YM +L EDEPEKYQTHFS Y+K+GI+AD +EALYKKVHAAIRADP+ K+
Sbjct  195  RKYIYGGHVSGYMKTLMEDEPEKYQTHFSEYVKRGIDADGLEALYKKVHAAIRADPTAKQ  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK+ PK HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  255  SEKEAPKTHKRYNLKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYMN+L EDEPEKYQTHFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYKKVHAAIRADPTAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNAL  231
            +EKQPPKEHKR+N KKLT+DER+ KL+ERL A 
Sbjct  255  TEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             + RRPFRALLDVGLIRTTTGNRVFGALKGALDGG+DIPHSEKRFAGF KDSK LDA+VH
Sbjct  135  AEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFGKDSKQLDADVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHV+AYM +L EDEPEKYQ+HF+ YIK G+EAD++E +YKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVSAYMKTLMEDEPEKYQSHFNEYIKTGLEADDLEEMYKKVHAAIRADPSSKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
             +KQPPK+HKR+N KKLTYDER+A+LIERLNALNAAAGN
Sbjct  255  FDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAGN  293



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KD K LD+EVHRK
Sbjct  137  TRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDSEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYMN+L EDEPEKYQ+HFS YIK G+EAD+IEALYKKVHAAIRADPSPKKSE
Sbjct  197  YIYGGHVAAYMNTLMEDEPEKYQSHFSKYIKSGVEADDIEALYKKVHAAIRADPSPKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            KQPPKEHKR+N KKLTY+ER+AKLIERL ALN+
Sbjct  257  KQPPKEHKRYNLKKLTYEERKAKLIERLQALNS  289



>gb|KJB84075.1| hypothetical protein B456_N001600 [Gossypium raimondii]
 gb|KJB84076.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=186

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  21   GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  80

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  81   RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  140

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  141  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  178



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LD EVHR
Sbjct  136  ESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEEKQLDPEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVA+YM +LNEDEPEKYQ+HFS YI KGI+ADNIE LY+KVHAAIRADP+ KKS
Sbjct  196  KYIYGGHVASYMRALNEDEPEKYQSHFSEYINKGIDADNIEELYRKVHAAIRADPTTKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            EKQPPKEHKR+N KKLTY+ERR+KLIERLNALN+AAG
Sbjct  256  EKQPPKEHKRYNLKKLTYEERRSKLIERLNALNSAAG  292



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+SK LD EVHRK
Sbjct  137  TRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDPEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGH+A YM  LNEDEPEKYQ+HFS YIK+GIEADN+EALYKKVHAAIRADPS KKSE
Sbjct  197  YIYGGHIADYMRLLNEDEPEKYQSHFSEYIKRGIEADNMEALYKKVHAAIRADPSVKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPKEHKRFN KKLTY+ER+A+LIERL ALN+A G
Sbjct  257  KQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   223 bits (568),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD+K LDAEVHRK
Sbjct  137  SRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFAKDNKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            KQPPKEHKR+N KKLTY+ER+AKL+ERLNALN+AA +
Sbjct  257  KQPPKEHKRYNLKKLTYEERKAKLVERLNALNSAADD  293



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   223 bits (568),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L +DEPEKYQ+HFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMTTLADDEPEKYQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            +EK  P+EHKR+N KKLT+DER+ KL+ERL A N A
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEA  290



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LDAEVHRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            K  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A
Sbjct  257  KPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  290



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   223 bits (567),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  GESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA+YM +L EDEPEKYQ HFS YIKKGI+ D++E +YKKVHAAIRADP   K
Sbjct  195  RKYIFGGHVASYMKTLMEDEPEKYQAHFSEYIKKGIDPDDMEEMYKKVHAAIRADPIAVK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S K PPKEHKR+N KKLTY+ER+AKLIERLNALNA+AG
Sbjct  255  STKPPPKEHKRYNLKKLTYEERKAKLIERLNALNASAG  292



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   222 bits (566),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LDAEVHRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            K  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A
Sbjct  257  KPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  290



>gb|KJB84074.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=252

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  87   GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  146

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  147  RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  206

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  207  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  244



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   223 bits (567),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LD +VH
Sbjct  135  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+EAD++E LYKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK+PPKEHKRFN +KLTY+ER+AKL+ERLNALN+A G
Sbjct  255  SEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAGG  292



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   222 bits (566),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGFTKD+K LDAEVHRK
Sbjct  137  NRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFTKDNKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQTHFS Y+K+GIE DN+EALYKKVHAAIRADP+ KK E
Sbjct  197  YIYGGHVAAYMKTLMEDEPEKYQTHFSEYVKRGIEPDNLEALYKKVHAAIRADPTLKKIE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            KQPPKEHKR+N +KLTY+ER+AKLIERL ALN+
Sbjct  257  KQPPKEHKRYNLRKLTYEERKAKLIERLQALNS  289



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG+ KD+K LDAEVHRK
Sbjct  137  SRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKDNKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            KQP KEHKR+N KKLTY+ER+AKL+ERLNALN+AA
Sbjct  257  KQPSKEHKRYNLKKLTYEERKAKLVERLNALNSAA  291



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKY
Sbjct  135  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKY  194

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM SL ++EPEKYQ+HFS YIKKGIEADN+EALYKKVHAAIRADP+  KS K
Sbjct  195  IYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADNMEALYKKVHAAIRADPTMAKSTK  254

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  255  EPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  289



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF K++K LD EVH
Sbjct  189  GDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKETKQLDPEVH  248

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVAAYM +L EDEPE+YQ+HFS Y K+G+EADN+E LYKKVHAAIRADP+PKK
Sbjct  249  RKYIFGGHVAAYMRTLAEDEPERYQSHFSEYHKRGLEADNLEELYKKVHAAIRADPTPKK  308

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEK PPKEHKR+N KKLTY+ER+A LIERLNALN+AAGN
Sbjct  309  SEKAPPKEHKRYNLKKLTYEERKASLIERLNALNSAAGN  347



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF K+SK LD+EVH
Sbjct  135  GESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFNKESKQLDSEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM  L EDEPEKYQ+HFS YIKKG++ DN+E +YKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVAAYMRMLLEDEPEKYQSHFSEYIKKGVDPDNMEEMYKKVHAAIRADPSAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            +EKQPPKEHKR+N KKLTY+ER+AKLIERL ALN+AA +
Sbjct  255  TEKQPPKEHKRYNLKKLTYEERKAKLIERLTALNSAADD  293



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L +DEPEK+Q+HFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMTTLADDEPEKFQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            +EK  P+EHKR+N KKLT+DER+ KL+ERL A N A
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEA  290



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LD EVHR
Sbjct  136  ENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEDKQLDPEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADNIE LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYGGHVASYMRALMEDEPEKYQSHFSEYIKRGIEADNIEELYKKVHAAIRADPTIKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            EK+PPKEHKR+N KKLTY+ER++KLIERLNALN+AAG
Sbjct  256  EKEPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIPHS+KRFAGF+KD K LDAEVHR 
Sbjct  137  TRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFAGFSKDGKQLDAEVHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM  L EDEPEKYQ+HFS YIK+GIEADNIE+LYKKVHAAIRADPS KKSE
Sbjct  197  YIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPSAKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K PPK+H RFN KKLTY+ER+AKLI+RL+ LNAAAG
Sbjct  257  KAPPKQHMRFNLKKLTYEERKAKLIDRLHTLNAAAG  292



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LD +VH
Sbjct  216  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVH  275

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+EAD++E LYKKVHAAIRADP  KK
Sbjct  276  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKK  335

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK+PPKEHKRFN +KLTY+ER+AKL+ERLNALN+A G
Sbjct  336  SEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAGG  373



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG+TK+S+ LD EVHRK
Sbjct  137  TRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYTKNSQQLDVEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD++E LYKKVHAAIRA+P+ KKS+
Sbjct  197  YIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADDLEGLYKKVHAAIRANPTVKKSD  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K  PK HKR+N KKLTYDER+A+L+ERLNALN+AA
Sbjct  257  KPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  132  GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  191

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  192  RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  251

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  252  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  135  GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  195  RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  255  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKK IEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKCIEADNIEELYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            +EK  P+EHKR+N KKLT+DER+ KL+ERL A N  AGN
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DAGN  292



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LDAEVHRK
Sbjct  224  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRK  283

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  284  YIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTTKKSE  343

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A 
Sbjct  344  KPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  378



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKK IEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKXIEADNIEELYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            +EK  P+EHKR+N KKLT+DER+ KL+ERL A N  AGN
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DAGN  292



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAEVHRKY
Sbjct  138  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHRKY  197

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM SL ++EPEK+Q+HFS YIKKGI AD++EALYKKVHAAIRADPS  KS K
Sbjct  198  IYGGHVADYMRSLADEEPEKFQSHFSEYIKKGISADDMEALYKKVHAAIRADPSMAKSTK  257

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PPK HKR+N KKLTYDER+A L++RLNALNA+AG
Sbjct  258  EPPKTHKRYNLKKLTYDERKASLVQRLNALNASAG  292



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVHRK
Sbjct  137  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+AYM +L EDEPEKYQ+HFS YIKKG+E D+IE +YKKVHAAIRA+P  KK E
Sbjct  197  YIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYKKVHAAIRANPIQKKVE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            KQPPKEHKR+N KKLTY+ER+AKLIERLNALN+
Sbjct  257  KQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  289



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            EK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  256  EKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVHRK
Sbjct  169  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRK  228

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+AYM +L EDEPEKYQ+HFS YIKKG+E D+IE +YKKVHAAIRA+P  KK E
Sbjct  229  YIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYKKVHAAIRANPIQKKVE  288

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            KQPPKEHKR+N KKLTY+ER+AKLIERLNALN+
Sbjct  289  KQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  321



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA+YM  L EDEPEKYQTHF  YIK+GIE D++E LYKKVHAAIRADP+  K
Sbjct  195  RKYIFGGHVASYMRMLMEDEPEKYQTHFIEYIKRGIEPDDMEELYKKVHAAIRADPTLVK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            S K+PPKEHKRFN KKLTYDER+A+LIERLNALN++A
Sbjct  255  SSKEPPKEHKRFNLKKLTYDERKARLIERLNALNSSA  291



>tpg|DAA56364.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=229

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA++HRKY
Sbjct  66   RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKY  125

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD++EALYKKVHAAIRADPS  KS K
Sbjct  126  IYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKSTK  185

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  186  QPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            EK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  256  EKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            EK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  256  EKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIPHS+KRFAGF KDSK LD EVH
Sbjct  137  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAGFNKDSKQLDPEVH  196

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE DN+E LYKKVHAAIRAD   KK
Sbjct  197  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYKKVHAAIRADSEAKK  256

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SE++PP EHKR+N KKL+YDER+A+LI+RL  LN+AAG
Sbjct  257  SEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  294



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF  D K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKNDEKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YI+GGHVA+YM +L EDEP+KYQTHFS YIKKGIE D+IE +YKKVHAAIRADPS  K
Sbjct  195  RNYIFGGHVASYMRALMEDEPDKYQTHFSEYIKKGIEPDDIEEMYKKVHAAIRADPSAIK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S K+PP EHKR+N KKLTY+ER+AKLIERLNALNA+ G
Sbjct  255  STKEPPTEHKRYNLKKLTYEERKAKLIERLNALNASGG  292



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KD K LDAE+H
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDAEIH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD+IE +YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            +EK  P+EHKR+N KKLT+DER+ KL+ERL A N  AGN
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFN-DAGN  292



>gb|EMS47485.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=269

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKY
Sbjct  106  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKY  165

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM SL ++EPEKYQ+HFS YIKKGIE D++EALYKKVHAAIRADP+  KS K
Sbjct  166  IYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALYKKVHAAIRADPTVAKSTK  225

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  226  EPPKTHKRYNPKKLTYEQRKANLVERLNALNSSAG  260



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+K LDAEVHRK
Sbjct  137  TRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADCMEALYKKVHAAIRADPTTKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            KQPPKEHKR+N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  257  KQPPKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  293



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRNLAEDEPEKYQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNAL  231
            +EK  P+EHKR+N KKLT+DER+ KL+ERL A 
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAF  287



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+SK LDAEVHRK
Sbjct  137  TRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYG HVA YM  + EDEPEKYQ+HFS YIK+GIEADN+EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGVHVADYMRVMMEDEPEKYQSHFSEYIKRGIEADNMEALYKKVHAAIRADPTIKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPKEHKRFN KKLTY+ER+A+LIERL ALN+A G
Sbjct  257  KQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  141  ENRRPFRALLDVGLIQTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  200

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVAAYM +L EDEPEK+  HFS Y+K+GI+ADN+E LYKKVHAAIRADP+ +KS
Sbjct  201  KYIYGGHVAAYMRTLAEDEPEKFLAHFSEYLKRGIDADNLEELYKKVHAAIRADPTGRKS  260

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            EKQPPKEHKR+N KKLTY+ER+AKLIERLNA N+AA
Sbjct  261  EKQPPKEHKRYNLKKLTYEERKAKLIERLNAFNSAA  296



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAEVHRK
Sbjct  137  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE DN+E LYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIRADPTAKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            KQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  257  KQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF+KD K LDAEVHR
Sbjct  136  ESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFSKDDKQLDAEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYI+GGHVA+YM  L EDEPEKYQTHFS YIK+GIE D++E LYKKVHAAIRADP+  KS
Sbjct  196  KYIFGGHVASYMRMLMEDEPEKYQTHFSEYIKRGIEPDDMEGLYKKVHAAIRADPTMVKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             K+PPKEHKR+N +KLTY+ER+AKLI+RLNALNA A
Sbjct  256  AKEPPKEHKRYNLRKLTYEERKAKLIDRLNALNARA  291



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF K++K LD E HR 
Sbjct  137  TRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFNKENKQLDPETHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVA YM  L EDEPEKYQTHFSGY+KKGIEADN+EA+YKKVHAAIRADP+ KKSE
Sbjct  197  YIFGGHVANYMKVLTEDEPEKYQTHFSGYVKKGIEADNLEAMYKKVHAAIRADPTLKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  P EHKR+N KKLTY+ER+ +LIERL ALN+ AG
Sbjct  257  KSAPTEHKRYNLKKLTYEERKERLIERLKALNSGAG  292



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  137  AESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGFKKDEKQLDAEVH  196

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YI GGHVA+YM ++ EDEPEKYQ HFS YIK+GIE D++E +YKKVHAAIRADP   K
Sbjct  197  RNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYKKVHAAIRADPIAIK  256

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S K+PPKEHKRFN KKLTY+ER+A+LIERLNALNA+AG 
Sbjct  257  STKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  295



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGFKKDEKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YI GGHVA+YM ++ EDEPEKYQ HFS YIK+GIE D++E +YKKVHAAIRADP   K
Sbjct  195  RNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYKKVHAAIRADPIAIK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S K+PPKEHKRFN KKLTY+ER+A+LIERLNALNA+AG 
Sbjct  255  STKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  293



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAEVHRK
Sbjct  137  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE DN+E LYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIRADPTAKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            KQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  257  KQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKY
Sbjct  138  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKY  197

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM SL ++EPEKYQ+HFS YIKKGIE D++EALYKKVHAAIRADP+  KS K
Sbjct  198  IYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALYKKVHAAIRADPTVAKSTK  257

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  258  EPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIPHS+KRFAGF KDSK LD EVH
Sbjct  191  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAGFNKDSKQLDPEVH  250

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE DN+E LYKKVHAAIRAD   KK
Sbjct  251  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYKKVHAAIRADSEAKK  310

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SE++PP EHKR+N KKL+YDER+A+LI+RL  LN+AAG
Sbjct  311  SEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  348



>gb|AFW84308.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=229

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA+ HR+Y
Sbjct  66   RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHRRY  125

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EAD IEALYKKVHAAIRADPS  KS K
Sbjct  126  IYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKSTK  185

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  186  QPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHRK
Sbjct  137  SRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVAAYM +L EDEPEKYQTHFS YIK+GIEAD IE LYKKVHAAIRADPS KK E
Sbjct  197  YIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEADGIEELYKKVHAAIRADPSIKKPE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPKEHKR+N KKLTY+ER+ KL+ RL ALN+AAG
Sbjct  257  KQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  292



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   217 bits (553),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA+YM  L EDEPEKYQTHFS YI++GIE D++E LYKKVHAAIRAD +  K
Sbjct  195  RKYIFGGHVASYMRILMEDEPEKYQTHFSEYIQRGIEPDDLEELYKKVHAAIRADATMAK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            S ++PPKEHKR+N KKLTY+ER+A+LIERLNALNA+
Sbjct  255  STREPPKEHKRYNLKKLTYEERKARLIERLNALNAS  290



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF KD K LD EVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFKKDEKQLDEEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA+YM ++ EDEPEKYQ HFS YIKKGIE DN+E +YKK HAAIRADP+  K
Sbjct  195  RKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYKKAHAAIRADPTMIK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S K+ PKEH+RFN KKLTY+ER+A+LIERLNALN +AG
Sbjct  255  STKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  292



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF KD K LD EVH
Sbjct  137  AESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFKKDEKQLDEEVH  196

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA+YM ++ EDEPEKYQ HFS YIKKGIE DN+E +YKK HAAIRADP+  K
Sbjct  197  RKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYKKAHAAIRADPTMIK  256

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S K+ PKEH+RFN KKLTY+ER+A+LIERLNALN +AG
Sbjct  257  STKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  294



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAEVHRKY
Sbjct  138  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHRKY  197

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEA  +EALYKKVHAAIRADP+  KS K
Sbjct  198  IYGGHVADYMKTLAEEEPEKYQSHFSEYIKKGIEAGGMEALYKKVHAAIRADPTLAKSTK  257

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  258  EPPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHRK
Sbjct  117  SRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRK  176

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHV AYM +L EDEPEKYQTHFS YIKKGIEAD IE LYKKVHAAIRADP+ KK+E
Sbjct  177  YIFGGHVTAYMKTLIEDEPEKYQTHFSQYIKKGIEADGIEELYKKVHAAIRADPANKKAE  236

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            KQPPKEHKR+N KKLTYDERR KLI RL ALN+A 
Sbjct  237  KQPPKEHKRYNLKKLTYDERRTKLIARLEALNSAV  271



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHRK
Sbjct  168  SRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRK  227

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVAAYM +L EDEPEKYQTHFS YIK+GIEAD IE LYKKVHAAIRADPS KK E
Sbjct  228  YIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEADGIEELYKKVHAAIRADPSIKKPE  287

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPKEHKR+N KKLTY+ER+ KL+ RL ALN+AAG
Sbjct  288  KQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  323



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAE+HRKY
Sbjct  138  RRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAELHRKY  197

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVAAYM  L EDEPEKYQ+HFS Y+K+GI+ADN+E LYKKVH+AIRADP  KK+EK
Sbjct  198  IYGGHVAAYMRILMEDEPEKYQSHFSEYVKRGIDADNMEELYKKVHSAIRADPITKKTEK  257

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            QPPKEHKR+N KKLTY+ER+ KLIERL ALN+AA
Sbjct  258  QPPKEHKRYNLKKLTYEERKNKLIERLKALNSAA  291



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADPS KKS
Sbjct  196  KYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            EKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  256  EKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  293



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVH
Sbjct  135  AETRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM  L EDEPEKYQ HFS YIK+GIE D++E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRMLMEDEPEKYQLHFSEYIKRGIEPDDMEELYKKVHAAIRADPTAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            SEKQPPKEHKR+N +K+TY+ER+AKLIERL ALN+
Sbjct  255  SEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  138  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  197

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADP+ KK
Sbjct  198  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKK  257

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQ PKEHKR+N KKLTY+ER+AKLI R+ +LN+AA N
Sbjct  258  SDKQLPKEHKRYNLKKLTYEERKAKLIARVASLNSAADN  296



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHRK
Sbjct  137  SRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHV AYM +L EDEPEKYQTHFS YIK+G+EAD IE LYKKVHAAIRADP+ KKS 
Sbjct  197  YIFGGHVTAYMKTLIEDEPEKYQTHFSEYIKRGVEADGIEELYKKVHAAIRADPTIKKSG  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPKEHKR+N KKLTY+ER+AKLI RL ALN+AAG
Sbjct  257  KQPPKEHKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KD K LDAE+H
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDAEIH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD+IE +YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            +EK  P+EHKR+N KKLT+DER+ KL++RL A N
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVDRLKAFN  288



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD++EALYKKVHAAIRADPS  KS K
Sbjct  199  IYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  259  QPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKY
Sbjct  138  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKY  197

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM SL ++EPEKYQ+HFS YIKKGIEAD +EALYKKVHAAIRADP+  KS K
Sbjct  198  IYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADGMEALYKKVHAAIRADPTIAKSTK  257

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PPK HK++N KKLTY++R+A L+ERLNALN++ G
Sbjct  258  EPPKTHKKYNPKKLTYEQRKASLVERLNALNSSGG  292



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD++EALYKKVHAAIRADPS  KS K
Sbjct  199  IYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  259  QPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQPPKEHKR+N KKLTY+ER+AKLI R+ +LN+AA N
Sbjct  255  SDKQPPKEHKRYNLKKLTYEERKAKLIARVASLNSAADN  293



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD+EVHRKY
Sbjct  138  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSEVHRKY  197

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM SL ++EPEKYQ+HFS YIKKGI AD+IE++YKKVHAAIRADP+  KS K
Sbjct  198  IYGGHVADYMRSLADEEPEKYQSHFSEYIKKGISADDIESVYKKVHAAIRADPTLVKSTK  257

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            + PK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  258  EAPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK VHAAIRADP+ KK
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNVHAAIRADPTLKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQ PKEHKR+N KKLTY+ER+AKLI R+ ALN+AA N
Sbjct  255  SDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  293



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAG+ K+ + LD EVHRK
Sbjct  137  TRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKNGQQLDVEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD +E LYKKVHAAIRA+P  KKS+
Sbjct  197  YIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADELEGLYKKVHAAIRANPIAKKSD  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K  PK HKR+N KKLTYDER+A+L+ERLNALN+AA
Sbjct  257  KPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAEVHRK
Sbjct  137  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE DN+E LYKKVHAAIR DP+ KKS 
Sbjct  197  YIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIREDPTAKKSG  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            KQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  257  KQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADP+ +K
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQPPKEHKR+N KKLTY+ER+AKL+ R+ A+N+AA N
Sbjct  255  SDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAADN  293



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  176  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  235

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADPS KK
Sbjct  236  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKK  295

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  296  SEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  334



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KNLDAE+HRKY
Sbjct  139  RRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDAEIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ HFS YIKKGIEAD++EALYKKVHAAIR +P+  K  K
Sbjct  199  IYGGHVADYMRTLAEEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRGEPTMAKITK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A L+ERLNALN++ G
Sbjct  259  QPPKEHKRYNPKKLTYEQRKASLVERLNALNSSGG  293



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+K LDAEVHRK
Sbjct  137  TRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            K+P KEHKR+N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  257  KEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  293



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+K LDAEVHRK
Sbjct  132  TRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRK  191

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  192  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSE  251

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            K+P KEHKR+N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  252  KEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  288



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGN VFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVH
Sbjct  135  AETRRPFRALLDVGLVRTTTGNHVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ HFS YIK+GIE D++E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQLHFSEYIKRGIEPDDMEELYKKVHAAIRADPTAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            SEKQPPKEHKR+N +K+TY+ER+AKLIERL ALN+
Sbjct  255  SEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   215 bits (547),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVHRK
Sbjct  137  TRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD +E LYKKVHAAIRADPS KKSE
Sbjct  197  YIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPSIKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K P KEHKRFN KKLTY+ER+AKLI RL ALNAA 
Sbjct  257  KPPRKEHKRFNLKKLTYEERKAKLIARLQALNAAV  291



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   214 bits (546),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADP+ +K
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            S+KQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA
Sbjct  255  SDKQPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   215 bits (547),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA+ HR+Y
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHRRY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EAD IEALYKKVHAAIRADPS  KS K
Sbjct  199  IYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  259  QPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADP+ +K
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            S+K+PPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA
Sbjct  255  SDKEPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   215 bits (547),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KNLDA++HRKY
Sbjct  142  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDADIHRKY  201

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            I+GGHVA YM S+ E+EPEKYQ HFS Y+K+GI+AD +EALYKKVHAAIRADP+  KS K
Sbjct  202  IFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKKVHAAIRADPTMAKSTK  261

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PP  HKR+N KKLTY++R+A+L+ERLNALN++AG
Sbjct  262  KPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  296



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   215 bits (548),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  153  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  212

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD IEALYK VHAAIRADP+ KK
Sbjct  213  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNVHAAIRADPTLKK  272

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S+KQ PKEHKR+N KKLTY+ER+AKLI R+ ALN+AA N
Sbjct  273  SDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  311



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LDAE+HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            I+GGHVA YM SL ++EPEKYQTHFS YIK+GI AD++EA+YKKVHAAIRADP+  KS K
Sbjct  199  IFGGHVADYMRSLADEEPEKYQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
             PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  259  APPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  293



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KNLDA++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDADIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            I+GGHVA YM S+ E+EPEKYQ HFS Y+K+GI+AD +EALYKKVHAAIRADP+  KS K
Sbjct  199  IFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKKVHAAIRADPTMAKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PP  HKR+N KKLTY++R+A+L+ERLNALN++AG
Sbjct  259  KPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  293



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            SEKQPPK+HKR+N KKLTY+ER+AKL+ RL ALNAA 
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+K LDAEVHRK
Sbjct  137  TRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD +EALYKKVHAAIRADP+ KKSE
Sbjct  197  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            K+P KEHK++N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  257  KEPLKEHKKYNLKKLTYEERKEKLVERLNTFNSAADD  293



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVHRK
Sbjct  154  SRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRK  213

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVA+YM +L EDEPEKYQ+HFS Y+KKG+EADN+E LYKKVHAAIRADP+ KKSE
Sbjct  214  YIYGGHVASYMTNLMEDEPEKYQSHFSKYVKKGLEADNLEELYKKVHAAIRADPTAKKSE  273

Query  323  kqppkEHKRFNQKKLTYDERRAKLIER  243
            KQPPKEHKR+N KKLTY+ER+AKLIER
Sbjct  274  KQPPKEHKRYNLKKLTYEERKAKLIER  300



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LDAE+HRKY
Sbjct  135  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHRKY  194

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            I+GGHVA YM SL ++EPEK+QTHFS YIK+GI AD++EA+YKKVHAAIRADP+  KS K
Sbjct  195  IFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKSTK  254

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
             PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  255  APPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA+ HR+Y
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHRRY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EA+ IEALYKKVHAAIRADPS  KS K
Sbjct  199  IYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEAEEIEALYKKVHAAIRADPSVVKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  259  QPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_004171975.1| PREDICTED: 60S ribosomal protein L5-like, partial [Cucumis sativus]
Length=246

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFAGF+K +  L+A+VHRK
Sbjct  82   SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHRK  141

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE DNIE L KKVH+AIRA+P  K +E
Sbjct  142  YIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLVKTTE  201

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPK HKR+N KKLTY++R+AKL+ERLNALN+AAG
Sbjct  202  KQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  237



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LDAE+HRKY
Sbjct  135  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHRKY  194

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            I+GGHVA YM SL ++EPEK+QTHFS YIK+GI AD++EA+YKKVHAAIRADP+  KS K
Sbjct  195  IFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKSTK  254

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
             PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  255  APPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD ++HRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y++GGHVA+YM +L EDEPEKYQTHFS YIK+GIEAD +E LYKKVHAAIRADP+ KKSE
Sbjct  197  YVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADCLEDLYKKVHAAIRADPTFKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AAG
Sbjct  257  KETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>ref|NP_001189970.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AEE77020.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=190

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR 
Sbjct  26   SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRN  85

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+PKK+ 
Sbjct  86   YIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTV  145

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  146  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  181



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LD EVH 
Sbjct  137  ESRRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEDKQLDPEVHH  196

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVA+YM +L EDEPEKYQ+HF  YIKKGIE DNIEALY+KVHAAIRAD    KS
Sbjct  197  KYIYGGHVASYMMTLMEDEPEKYQSHFGEYIKKGIEPDNIEALYRKVHAAIRAD-PTMKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            EKQPPKEHKR+N KKLTY+ER++KLIERLNALN+AAG
Sbjct  256  EKQPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFAGF KD K LD EVH
Sbjct  135  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFAGFNKDGKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D IE +YKKVHAAIRA P  KK
Sbjct  195  RKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYKKVHAAIRASPEAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  255  SEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIPHS+KRFAGF KD K LD EVH
Sbjct  132  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFAGFNKDGKQLDPEVH  191

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D IE +YKKVHAAIRA P  KK
Sbjct  192  RKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYKKVHAAIRASPEAKK  251

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            SEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  252  SEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD ++HRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y++GGHVA+YM +L EDEPEKYQTHFS YIK+GIEAD +E LYKKVHAAIRADP+ KK E
Sbjct  197  YVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADGLEDLYKKVHAAIRADPTFKKFE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AAG
Sbjct  257  KETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD+++HRKY
Sbjct  136  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKY  195

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +EALYKKVHAAIRADP+  KS K
Sbjct  196  IYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKSTK  255

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            + P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  256  KEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  290



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD+++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +EALYKKVHAAIRADP+  KS K
Sbjct  199  IYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            + P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  259  KEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL++TT GNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTIGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            SEKQPPK+HKR+N KKLTY+ER+AKL+ RL ALNAA 
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD+++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +EALYKKVHAAIRADP+  KS K
Sbjct  199  IYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            + P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  259  KEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   212 bits (540),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDA++H
Sbjct  136  AEERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDADIH  195

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYG HVA YM +L ++EPEKYQ HFS YIKKGIEAD++EALYKKVHAAIRADPS  K
Sbjct  196  RKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRADPSMAK  255

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S K  PKEHKR+N KKLTY++R+A+L+ERLNALN++ G
Sbjct  256  STKAQPKEHKRYNPKKLTYEQRKARLVERLNALNSSGG  293



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+SK LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAEIHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  L EDEPEK+QTHFS Y+KKG++A+NIE LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKLLTEDEPEKFQTHFSQYVKKGVDAENIEELYKKVHAAIRADPNPKKT  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
             K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  256  VKAAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDA++HRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDADIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y++GGHVA+YM +L EDEPEKYQTHFS YIK+GIE DN+E +YKKVHAAIRADP+ KKSE
Sbjct  197  YVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGIEPDNLEEVYKKVHAAIRADPTFKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K+PPKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  257  KEPPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD+++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +E+LYKKVHAAIRADP+  KS K
Sbjct  199  IYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKVHAAIRADPTMAKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            + P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  259  KEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFAGF K+ K LDAEVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD +E LYKKVHAAIRADPS KK
Sbjct  195  RKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPSTKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            S K  PKEHKR+N KKLTYDER+ KLI RL ALN+
Sbjct  255  SGKPEPKEHKRYNLKKLTYDERKNKLIARLQALNS  289



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA+YM +L EDEPEKYQ+HF  Y+KKG+E DN+E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVASYMTTLMEDEPEKYQSHFGLYVKKGLEPDNLEELYKKVHAAIRADPTAKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIER  243
            SEKQPPKEHKR+N KKLTY+ER+AKLIER
Sbjct  255  SEKQPPKEHKRYNLKKLTYEERKAKLIER  283



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNR+FGALKGALDGGLDIPHS+KRFAGF K++K LDAE HR 
Sbjct  137  TRRPFRALLDVGLLRTTTGNRIFGALKGALDGGLDIPHSDKRFAGFNKETKQLDAETHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHV +YM  + EDEPEKYQ+HFS Y KKGIEADN+EALYKKVHAAIRADP+ KKS+
Sbjct  197  YIFGGHVGSYMKLMMEDEPEKYQSHFSEYAKKGIEADNLEALYKKVHAAIRADPTLKKSD  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  P EHKR+N KKLTY+ER+A+LIERL ALN+ AG
Sbjct  257  KPAPTEHKRYNLKKLTYEERKARLIERLKALNSGAG  292



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD+++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD +E+LYKKVHAAIRADP+  KS K
Sbjct  199  IYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKVHAAIRADPTMAKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            + P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  259  KEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD ++HRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y++GGHVA+YM +L EDEPEKYQTHFS YIK+G+EAD +E LYKKVHAAIRADP+ KKS 
Sbjct  197  YVFGGHVASYMKTLMEDEPEKYQTHFSDYIKRGVEADGLEDLYKKVHAAIRADPTFKKSS  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  257  KEAPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAG++KD K+LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYSKDDKSLDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM+ L EDEPEKYQ+HF  Y+K+ IE ++IE +YKKVH AIRAD     
Sbjct  195  RKYIYGGHVAAYMSMLREDEPEKYQSHFVEYLKREIEPESIEEMYKKVHTAIRAD-PSSV  253

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
             +K  PKEHKR+N KKLTY+ER+AKL+ERLNALN+AAG+
Sbjct  254  KKKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAAGD  292



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFAGF+K +  L+A+VHRK
Sbjct  137  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE DNIE L KKVH+AIRA+P  K +E
Sbjct  197  YIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLVKTTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPK HKR+N KKLTY++R+AKL+ERLNALN+AAG
Sbjct  257  KQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIPHS+KRFAGF+KD K LDAEVHR 
Sbjct  137  TRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFAGFSKDGKQLDAEVHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM  L EDEPEKYQ+HFS YIK+GIEADNIE+LYKKVHAAIRADPS KKSE
Sbjct  197  YIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPSAKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K PPK+H R    KLTY+ER+AKLI+RL+ LNAAAG
Sbjct  257  KAPPKQHMRL---KLTYEERKAKLIDRLHTLNAAAG  289



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFAGF+K +  L+A+VHRK
Sbjct  137  SRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE DNIE L KKVH+AIRA+P  K +E
Sbjct  197  YIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLAKTTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPK HKR+N KKLTY++R+AKL+ERLNALN+AAG
Sbjct  257  KQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHSEKRFAGF K+ K LDAEVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD +E LYKKVHAAIRADPS KK
Sbjct  195  RKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPSTKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            S K  PKEHKR+N KKLTYDER+ +LI RL ALN+
Sbjct  255  SGKPEPKEHKRYNLKKLTYDERKNELIARLQALNS  289



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++R PFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AETRGPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPTSKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            SEK  PKEHKR+N KKLTYDER+ KLI RL ALN+AA
Sbjct  255  SEKPQPKEHKRYNLKKLTYDERKNKLIARLQALNSAA  291



>dbj|BAH20263.1| AT3G25520 [Arabidopsis thaliana]
Length=202

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR 
Sbjct  38   SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRN  97

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGG V+ YM  L EDEPEK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+PKK+ 
Sbjct  98   YIYGGDVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTV  157

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  158  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  193



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDA++H
Sbjct  137  AEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDADIH  196

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYG HVA YM +L ++EPEKYQ HFS YIKKGIEAD++EALYKKVHAAIRADPS  K
Sbjct  197  RKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRADPSMAK  256

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            S K PPKEHKR+N KKLTY++R+A L+ERLNALN++ 
Sbjct  257  STKTPPKEHKRYNPKKLTYEQRKASLVERLNALNSSG  293



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LD ++HRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y++GGHVA+YM +L EDEPEKYQTHFS YIK+G+EAD +E LYKKVHAAIRADP+ KKS 
Sbjct  197  YVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGVEADGLEDLYKKVHAAIRADPTFKKSS  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K+ PKEHKR+N KKLTY+ER+AKL+ RL A N+AA
Sbjct  257  KEAPKEHKRYNLKKLTYEERKAKLVARLQAFNSAA  291



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGF KD K LDAE+HRKY
Sbjct  139  RRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFKKDEKQLDAEIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM SL E+EPEK+Q HFS YIK+GIEAD++EALYKKVHAAIRA+P+  KS K
Sbjct  199  IYGGHVADYMRSLAEEEPEKFQAHFSDYIKRGIEADDMEALYKKVHAAIRANPTMVKSTK  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +PPK HKR+N KKLTY+ R+A L++RLNALN++AG
Sbjct  259  EPPKTHKRYNLKKLTYEGRKASLVQRLNALNSSAG  293



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE +YKKVHAAIRADP+PKK+E
Sbjct  197  YIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAIRADPNPKKTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+PKK+ 
Sbjct  197  YIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTV  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+SK LDAE HR 
Sbjct  137  TRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAETHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHVA YM  LN+DEPEKYQTHFS Y+KKG++ADN+EALYKKVH AIRADP+ KKSE
Sbjct  197  YIFGGHVANYMKLLNDDEPEKYQTHFSEYLKKGMDADNLEALYKKVHTAIRADPTLKKSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            K  P EHKR+N KKLTY+ER+ +LIERL ALN+
Sbjct  257  KPAPTEHKRYNLKKLTYEERKERLIERLKALNS  289



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 4/158 (3%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFAGF KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFAGFNKDSKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM       PEKYQ+HFS YIK+GIE D+IE +YKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMKM----SPEKYQSHFSEYIKRGIEPDSIEGMYKKVHAAIRADPEAKK  250

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            S+K+PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  251  SKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  288



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA +HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+EA+ IE LYKKVHAAIRADP+PKK+ 
Sbjct  197  YIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKTV  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++K LD   H 
Sbjct  137  ENRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKENKQLDFATHA  196

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVA YM +LNEDEPEK+QTHFS Y+KKGIEAD +EALYKKVHAAIRADP  KK+
Sbjct  197  KYIYGGHVADYMKTLNEDEPEKFQTHFSEYVKKGIEADEMEALYKKVHAAIRADPLAKKA  256

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             KQ  KEHKRFN KKLTY +R+A LI+R+  LN+AA
Sbjct  257  GKQSLKEHKRFNLKKLTYKQRKANLIDRITTLNSAA  292



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLD+PHS+KRFAGF KD K LDA+ H
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGVLKGALDGGLDVPHSDKRFAGFKKDEKQLDADFH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YI+GGHVA+YM +L EDEPEKYQTHFS YIK+ +  D++E LYKKVHAAIRADPS  K
Sbjct  195  RNYIFGGHVASYMRTLMEDEPEKYQTHFSDYIKRNVGPDDMEDLYKKVHAAIRADPSTVK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            S K+PPKEHKR+N KKLTY+ER+AKLI+RLNALN+A  +
Sbjct  255  STKEPPKEHKRYNLKKLTYEERKAKLIDRLNALNSATAD  293



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAG+ KD+K LD EVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKDNKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVA+YMN+L EDEPEKYQ+HF  YIK+G+EADNIE +YKKVHAAIRADP+PKK
Sbjct  195  RKYIYGGHVASYMNALMEDEPEKYQSHFKEYIKRGVEADNIEEMYKKVHAAIRADPTPKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIER  243
            S+KQ PKEHKR+N KKLTY+ER+AKLIER
Sbjct  255  SDKQQPKEHKRYNLKKLTYEERKAKLIER  283



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LD EVH
Sbjct  135  AETRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFEKEKKELDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEDLYKKVHAAIRADPTIKK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            +EK+PPK+ KR+N KKLTY+ER+AKLI RL ALN+AAG
Sbjct  255  AEKKPPKKSKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVF ALKGALDGGLDIPHS+KRFAGF KD K LDAEVH KY
Sbjct  138  RRPFRALLDVGLIRTTTGNRVFAALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHHKY  197

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            IYGGHVA YM +L E+E EKYQ+HFS YIKKGI+AD++E LYKKVHAAIRADPS  KS K
Sbjct  198  IYGGHVADYMRTLAEEEFEKYQSHFSEYIKKGIKADDVETLYKKVHAAIRADPSVAKSTK  257

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            +PPKEHKR+N KKLT++ERR++L+ERLNALN+   +
Sbjct  258  EPPKEHKRYNSKKLTHEERRSRLVERLNALNSCGDD  293



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA +HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFSGYIKKG+EA+ IE +YKKVHAAIRA+P+ KK+ 
Sbjct  197  YIYGGHVSNYMKMLAEDEPEKLQTHFSGYIKKGVEAEGIEEMYKKVHAAIRAEPNHKKTV  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE +YKKVHAAIRA+P+ KK+E
Sbjct  197  YIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAIRAEPNHKKTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LD EVHR
Sbjct  164  ESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDEKQLDPEVHR  223

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYI+GGHV++YM  L EDEPEKYQTHFS Y+K+GIE D+IE LYKKVHAAIRADP+  KS
Sbjct  224  KYIFGGHVSSYMRMLMEDEPEKYQTHFSEYVKRGIEPDDIEELYKKVHAAIRADPNMVKS  283

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIER  243
             K+PPKEHKRFN KKLTY+ER+A+LIER
Sbjct  284  TKEPPKEHKRFNLKKLTYEERKARLIER  311



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA +HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+ IE LYKKVHAAIRADP+PKK+ 
Sbjct  197  YIYGGHVSNYMKILAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKTV  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA +HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE +YKKVHAAIRADP+PKK+E
Sbjct  197  YIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAESIEEIYKKVHAAIRADPNPKKTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  256  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE LYKKVHAAIRA P+ +K+ 
Sbjct  197  YIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRAXPNXRKTV  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+ +E LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKT  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
             K  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  256  AKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  288



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  166  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  225

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  226  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  285

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  286  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  318



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA +HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+ IE +YKKVHAAIRADP+PKK+E
Sbjct  197  YIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYKKVHAAIRADPNPKKTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA +HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+ IE +YKKVHAAIRADP+PKK+E
Sbjct  197  YIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYKKVHAAIRADPNPKKTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  257  KPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  143  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  202

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+ +E LYKKVHAAIRADP+PKK+
Sbjct  203  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKT  262

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  263  EKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  295



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K L+AE HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAETHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS Y+KKG+EA++IE +YKKVHAAIRADP+PKK+E
Sbjct  197  YIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAESIEEMYKKVHAAIRADPNPKKTE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G+
Sbjct  257  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGD  293



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgg---lDIPHSEKRFAGFTKDSKNLDAE  516
            +SRRPFRALLDVGLIRTTTGNRVFGALK         LDIPHS+KRFAGF K++K LDAE
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKVLKGALDGGLDIPHSDKRFAGFNKENKQLDAE  195

Query  515  VHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp  336
            +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+P
Sbjct  196  IHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNP  255

Query  335  kksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KK+EK  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  256  KKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  295



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  160  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  219

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  220  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  279

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  280  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  312



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K L+AE HR 
Sbjct  158  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAETHRN  217

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM  L EDEPEK QTHFS Y+KKG+EA++IE +YKKVHAAIRADP+PKK+E
Sbjct  218  YIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAESIEEMYKKVHAAIRADPNPKKTE  277

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G+
Sbjct  278  KPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGD  314



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  169  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  228

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  229  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  288

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            +K  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  289  KKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  321



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA++HR
Sbjct  144  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDADIHR  203

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+ +E LYKKVHAAIRADP+PKK+
Sbjct  204  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKT  263

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  264  EKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  296



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAE+HRK
Sbjct  137  SRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKQLDAEIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV  YM  L EDEPEKYQTHFS ++KKG+E +N+E +YKKVHAAIRADP  KKS+
Sbjct  197  YIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYKKVHAAIRADPLAKKSD  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            K+ PKEHKR+N KKLTY+ER+A LIER+ ALN+
Sbjct  257  KETPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  153  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  212

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  213  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  272

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            EK  PK H R+N KKLTY+ER+ KLIER+ ALN
Sbjct  273  EKPAPKTHNRYNLKKLTYEERKNKLIERVKALN  305



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KNLDAE+HRK
Sbjct  137  TRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS+
Sbjct  197  YIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSD  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A G
Sbjct  257  KEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  292



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 141/159 (89%), Gaps = 6/159 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKY++GGH+      L EDEPEKYQ+HFS YIK+GIEAD IEALYKKVHAAIRADPS KK
Sbjct  195  RKYVFGGHI------LAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKK  248

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            SEKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  249  SEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  287



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KNLDAE+HRK
Sbjct  141  TRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRK  200

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS+
Sbjct  201  YIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSD  260

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A G
Sbjct  261  KEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  296



>ref|XP_009384264.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=173

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 6/157 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KR      D K LDAEVH
Sbjct  14   AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKR------DEKQLDAEVH  67

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YI+GGHVA+Y+ +L EDEPEKYQ HFS YIK+GIE D++E +YKKVHAAI ADP+  K
Sbjct  68   RNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVHAAIHADPTTIK  127

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            S KQPPKEH+RFN KKLTY+ER+AKLIERLNALNA+A
Sbjct  128  STKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  164



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K LDAE+HRK
Sbjct  137  SRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKQLDAEIHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV  YM  L EDEPEKYQTHFS ++KKG+E +N+E +YK VHAAIRADP  KKS+
Sbjct  197  YIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYKNVHAAIRADPLAKKSD  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            K+ PKEHKR+N KKLTY+ER+A LIER+ ALN+
Sbjct  257  KEAPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KNLDAE+HR
Sbjct  136  ETRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YKKVHAAIRADPS KKS
Sbjct  196  KYIYGGHVADYMRLLMEDEPEKYQSHFSDYLKKDLAPENMEEMYKKVHAAIRADPSVKKS  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            +K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+ 
Sbjct  256  DKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSV  290



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
             YIYGGHV+ YM  LN DEPEK+QTHFS ++KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLNYDEPEKFQTHFSQHLKKGVDAESMEELYKKVHAAIRADPNPKKT  255

Query  326  ekqppkEHKRFNQKKLTYDERRAKLIERLNALN  228
            EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  256  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KNLDAE+HRK
Sbjct  147  TRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRK  206

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS+
Sbjct  207  YIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSD  266

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A
Sbjct  267  KEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  300



>ref|XP_009384265.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 6/157 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KR      D K LDAEVH
Sbjct  65   AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKR------DEKQLDAEVH  118

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            R YI+GGHVA+Y+ +L EDEPEKYQ HFS YIK+GIE D++E +YKKVHAAI ADP+  K
Sbjct  119  RNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVHAAIHADPTTIK  178

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            S KQPPKEH+RFN KKLTY+ER+AKLIERLNALNA+A
Sbjct  179  STKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  215



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KNLDAE+HRK
Sbjct  229  TRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRK  288

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS+
Sbjct  289  YIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSD  348

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A
Sbjct  349  KEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  382



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K L+AE+HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAEIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI+GGHV+ YM  L EDEPEK QTHFS YIKKG+E ++IE +YKKVH AIRADP+PKK E
Sbjct  197  YIFGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEPESIEEMYKKVHLAIRADPNPKKCE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K  PKEHKR N KKLTY+ER+ KLIER+ ALN A+
Sbjct  257  KPAPKEHKRHNLKKLTYEERKNKLIERVKALNRAS  291



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG+ K+SK+LDA++HRK
Sbjct  137  ARRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKESKSLDADLHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YI GGHVAAYM +L EDEPEKYQ+ FS Y KKGIE +NIE LYKKVHAAIRADP+ K SE
Sbjct  197  YILGGHVAAYMKTLREDEPEKYQSQFSEYHKKGIEPENIEELYKKVHAAIRADPTIKYSE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            K  PK  K +  +KLTY+ER+ KLI RLNALNA A
Sbjct  257  KHVPKVQKHYLTRKLTYEERKNKLIARLNALNAGA  291



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAG++K+ K+L+AE+H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYSKEDKSLNAEIH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI GGHVA YM  L EDEPEKYQ+HFSG+IK+GIEAD++  +Y KVHAAIRADP+ +K
Sbjct  195  RKYILGGHVADYMRLLKEDEPEKYQSHFSGFIKEGIEADDLADMYSKVHAAIRADPTSQK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            + K+ P E +++  +KLTY+ER+A L++RLNA+N 
Sbjct  255  TAKKAPAEKRKWKIQKLTYEERQAALVKRLNAING  289



>ref|XP_010648788.1| PREDICTED: 60S ribosomal protein L5-like, partial [Vitis vinifera]
Length=191

 Score =   188 bits (477),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SR+PF   L+VGL+RTTTGNRVFGALKGALDGGLDIPHS+KRF GF+ DSK LDAEVHRK
Sbjct  24   SRKPFCVFLNVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFFGFSNDSKQLDAEVHRK  83

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
             IY GHV+AYM +  EDEPE YQ+HFS YIKK +E D IE +YKKVHA I A+P  KK E
Sbjct  84   CIYVGHVSAYMGTFMEDEPETYQSHFSEYIKKIVEQDGIEEMYKKVHATICANPIQKKVE  143

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            KQPPKEHKR+N KKLTY+ER+AKL+ERLNALN+   
Sbjct  144  KQPPKEHKRYNLKKLTYEERKAKLVERLNALNSTTA  179



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAG+ K+ K+L+AE+H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYNKEDKSLNAEIH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI GGHVA YM  L EDEPEKYQ+HFSG+IK G+EA+N+  +Y  VHAAIRADP+ +K
Sbjct  195  RKYILGGHVADYMKLLKEDEPEKYQSHFSGFIKAGVEAENLAEMYTSVHAAIRADPTQQK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            +EK+ P E +++  +KLTYDER+A L++RLNA+N 
Sbjct  255  TEKKAPAEKRKWKIQKLTYDERQAALVKRLNAING  289



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   188 bits (477),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  345
            RKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIEADNIEA+YKKV AAIRAD
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYKKVQAAIRAD  249



>gb|EYU36673.1| hypothetical protein MIMGU_mgv1a0142632mg, partial [Erythranthe 
guttata]
Length=140

 Score =   184 bits (466),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHS+KRFAG+ KDSK+LDAEVHRKYIYGGHVAAYMN+L EDEP+KYQTHFS Y+K G+E
Sbjct  9    IPHSDKRFAGYAKDSKSLDAEVHRKYIYGGHVAAYMNTLMEDEPDKYQTHFSKYVKNGLE  68

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            AD +EALYKKVHAAIRADP+PKKS+KQP KEHKRFN KKLTY+ER+ KLIERLNALN+AA
Sbjct  69   ADELEALYKKVHAAIRADPTPKKSDKQPRKEHKRFNLKKLTYEERKNKLIERLNALNSAA  128



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAG++K+ K+L+AE H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYSKEDKSLNAETH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI GGH+A YM  L EDEPEKYQ+HFSG+IK G+EADN+  +Y  VHAAIRADP+ +K
Sbjct  195  RKYILGGHIADYMRLLKEDEPEKYQSHFSGFIKAGVEADNLAEMYTSVHAAIRADPTQQK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            +EK+ P E +++  +KLTY+ER+A L++RLNA+N 
Sbjct  255  TEKKAPAEKRKWKIQKLTYEERQAALVKRLNAVNG  289



>gb|KHG04393.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHS+KRFAGF+KDSK LDAEVHRKYIYGGHVA+YM  L EDEPEKYQ+HFS YIK+GIE
Sbjct  133  IPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMRILMEDEPEKYQSHFSEYIKRGIE  192

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            ADNIE+LYKKVHAAIRADPS KKSEK PPK+HKRFN KKLTY+ER+AKLI+RL+ LNAAA
Sbjct  193  ADNIESLYKKVHAAIRADPSAKKSEKAPPKQHKRFNLKKLTYEERKAKLIDRLHTLNAAA  252

Query  218  G  216
            G
Sbjct  253  G  253



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAGF+K+ K+L+AE H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKEDKSLNAETH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI GGHVA YM  L EDEPEKYQ+HF+ +IK+GIEAD +  +Y KVHAAIRADP  +K
Sbjct  195  RKYILGGHVADYMRLLKEDEPEKYQSHFNKFIKEGIEADELAEMYTKVHAAIRADPDQQK  254

Query  329  sekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
            +EK+ P E +++  +KLT++ER+A L++RLNA+NA
Sbjct  255  TEKKAPAEKRKWKIQKLTFEERQAALVQRLNAINA  289



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIPHS+KRFAGF+KD+K LDAEVH K
Sbjct  137  TRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFAGFSKDNKQLDAEVHSK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEADNIE+LYKKVHAAIRADP+ KK+E
Sbjct  197  YIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPTAKKTE  256

Query  323  kqppkEHKR  297
            K+PPK+HKR
Sbjct  257  KEPPKQHKR  265



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  326  ekqppkEHKRFNQ  288
            EK+PP EHKR+ Q
Sbjct  256  EKKPPAEHKRYGQ  268



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHS+KRFAGF+KD+K LDAEVH KYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  133  IPHSDKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIE  192

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            ADNIE+LYK VHAAIRADP+ KK+EK+PPK+HKRFN KKLTY+ER++KLIERL+ LNAAA
Sbjct  193  ADNIESLYKNVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKSKLIERLHTLNAAA  252

Query  218  G  216
            G
Sbjct  253  G  253



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG++K+ K+L+AEVHR
Sbjct  137  ENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGYSKEDKSLNAEVHR  196

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVAAYM  L +++PEKYQ+HFS +IK+G+E +++E LY KVHAAIRADPSP++ 
Sbjct  197  KYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELYTKVHAAIRADPSPREP  256

Query  326  ekqpp-kEHKRFNQKKLTYDERRAKLIERLNALNAA  222
              +     HK+    KL+Y++R+A LI R+ ALNAA
Sbjct  257  PPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>gb|KDO45956.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=257

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHS+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+
Sbjct  133  IPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGID  192

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
            AD +EALYKKVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A
Sbjct  193  ADGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  251



>gb|KCW63927.1| hypothetical protein EUGRSUZ_G016041, partial [Eucalyptus grandis]
Length=150

 Score =   179 bits (453),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LD +VHR
Sbjct  22   ETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVHR  81

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  345
            KYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+EAD++E LYKKVHAAIRAD
Sbjct  82   KYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRAD  135



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  686  KSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  507
            ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG++K+ K+L+AEVHR
Sbjct  137  ENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGYSKEDKSLNAEVHR  196

Query  506  KYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  327
            KYIYGGHVAAYM  L +++PEKYQ+HFS +IK+G+E +++E LY KVHAAIR DPSP++ 
Sbjct  197  KYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELYTKVHAAIREDPSPREP  256

Query  326  ekqpp-kEHKRFNQKKLTYDERRAKLIERLNALNAA  222
              +     HK+    KL+Y++R+A LI R+ ALNAA
Sbjct  257  PPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD K LDAEVHRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  345
            YIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD +EALYKKVHAAIRAD
Sbjct  197  YIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRAD  249



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KDSK LD +VH
Sbjct  135  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVH  194

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+EAD++E LYKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKK  254

Query  329  sekqppkEHKRFN  291
            SEK+PPKEHKR+ 
Sbjct  255  SEKEPPKEHKRWG  267



>gb|KHG10378.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=261

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHSEKRFAGF KDSK LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  133  IPHSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIE  192

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            ADN+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AA
Sbjct  193  ADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  252

Query  218  G  216
            G
Sbjct  253  G  253



>gb|KHG10377.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=268

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHSEKRFAGF KDSK LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  140  IPHSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIE  199

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            ADN+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AA
Sbjct  200  ADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  259

Query  218  G  216
            G
Sbjct  260  G  260



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHS+KRFAGF++D K LDA+VHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  134  IPHSDKRFAGFSRDGKQLDADVHRKYIFGGHVAAYMTTLMEDEPEKYQSHFSEYIKRGIE  193

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             D IE +YKKVHA+IRADP+PKKSEK+PPK HKR N KKLTY+ER+AKLIERLNALN+AA
Sbjct  194  PDGIEEMYKKVHASIRADPTPKKSEKEPPKVHKRHNLKKLTYEERKAKLIERLNALNSAA  253

Query  218  G  216
            G
Sbjct  254  G  254



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++K LDA +HR 
Sbjct  137  SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRN  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+EA+ IE LYKKVHAAIRADP+PKK+ 
Sbjct  197  YIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKTV  256

Query  323  kqppkEHKR  297
            K  PK+HKR
Sbjct  257  KPAPKQHKR  265



>gb|KHF99386.1| 60S ribosomal L5 [Gossypium arboreum]
Length=259

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IP SEKRFAGF K SK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GI+
Sbjct  129  IPLSEKRFAGFNKGSKQLDPEVHRKYIYGGHVAAYMKNLMEDEPEKYQSHFSEYIKRGIQ  188

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             D+IE +YKKVHAAIRADP  KKS+K+PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AA
Sbjct  189  PDSIEGMYKKVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  248

Query  218  G  216
            G
Sbjct  249  G  249



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
             +SRRPFRALLDVGL+RTTTGNRVFGALKGALD G+DIPHS+KRFAGF+KD K LDA+VH
Sbjct  111  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAGFSKDGKQLDAKVH  170

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  345
            RKYIYGGHVAAYMN+L EDEPEKY+ HFS + K+ IEAD +E LY+KVHAAIRAD
Sbjct  171  RKYIYGGHVAAYMNTLAEDEPEKYERHFSEFAKREIEADGLEELYRKVHAAIRAD  225



>gb|KHG15135.1| 60S ribosomal L5 [Gossypium arboreum]
Length=262

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPH +KRFAGF KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE
Sbjct  133  IPHGDKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRSIE  192

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             D IE +YKKVH AIRA P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AA
Sbjct  193  PDTIEGMYKKVHTAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  252

Query  218  G  216
            G
Sbjct  253  G  253



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD K LDA++HRKY
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIR  351
            IYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEA+++E LYKKVHAAIR
Sbjct  199  IYGGHVADYMKNLAEEEPEKYQSHFSDYIKKGIEAEDMEGLYKKVHAAIR  248



>ref|XP_010451808.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=143

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHS+KRFAGF K++K LDA +HR YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+E
Sbjct  13   IPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVE  72

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            A+ IE LYKKVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A 
Sbjct  73   AEGIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAG  132

Query  218  G  216
            G
Sbjct  133  G  133



>sp|P93779.1|RL5_SOLME RecName: Full=60S ribosomal protein L5, partial [Solanum melongena]
 dbj|BAA19415.1| ribosomal protein L5 [Solanum melongena]
Length=121

 Score =   162 bits (410),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  545  TKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKV  366
            +KDSK LDAEVHRKYIYGGHVAAYMN L EDEPEKYQ+HFS YIK  +  DNIE +YKKV
Sbjct  2    SKDSKQLDAEVHRKYIYGGHVAAYMNILMEDEPEKYQSHFSSYIKADLAPDNIEEMYKKV  61

Query  365  HAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            HAAIR DPSPKKS+KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA GN
Sbjct  62   HAAIRPDPSPKKSQKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  112



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 120/155 (77%), Gaps = 24/155 (15%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF K+            
Sbjct  139  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKN------------  186

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
                        L E+EPEKYQ+HFS YIKKG+EAD IEALYKKVHAAIRADPS  KS K
Sbjct  187  ------------LAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKSTK  234

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  216
            QPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  235  QPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  269



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  683  SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRK  504
            +RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIPHS++RFAG +KD K L  E HRK
Sbjct  137  TRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDQRFAGISKDKKELGPEFHRK  196

Query  503  YIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse  324
            Y++G  +  YM +L EDEP KYQT F  Y   G + +++E ++KKVHAAIRA+P+ KK E
Sbjct  197  YVFGDWLRPYMKTLIEDEPGKYQTPFMDYFSGGKKPEDLEEVFKKVHAAIRANPTFKKVE  256

Query  323  kqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            KQPPKE KR+N KKLTY+ER+AKL+ RL ALN AA
Sbjct  257  KQPPKEPKRYNLKKLTYEERKAKLVARLQALNFAA  291



>ref|XP_009383145.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L5-2 [Musa 
acuminata subsp. malaccensis]
Length=140

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 2/121 (2%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPH++KRFAGF KD K LDAE+HRKYI+GGHVA+ M +L EDEPEK Q HF  YIK+  E
Sbjct  11   IPHNDKRFAGFKKDKKQLDAEIHRKYIFGGHVASSMRNLMEDEPEKXQAHFIEYIKRQAE  70

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
             D +E +YKKVHAAIR+  S           H RFN KKLTY+ER+A+LIERLNALNA A
Sbjct  71   PDGMEEMYKKVHAAIRS--SKIDKVTTNGALHCRFNLKKLTYEERKARLIERLNALNACA  128

Query  218  G  216
            G
Sbjct  129  G  129



>ref|XP_011399144.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
 gb|KFM26248.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
Length=293

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  677  RPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKYI  498
            RPF ALLD GL RT+TG++VF ALKGALDGGLD+PHS+KRF G+++++K LD+EV RKYI
Sbjct  140  RPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSDKRFVGYSRETKELDSEVLRKYI  199

Query  497  YGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekq  318
             GGHVA YM SL E+EPEKY+ HFS Y+K G+EA+ +E LY  VHAAIRADP  K+ E++
Sbjct  200  LGGHVAEYMESLKEEEPEKYERHFSRYVKAGLEAEGLEELYTSVHAAIRADPVQKRKERK  259

Query  317  ppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
             P + K + + KLTY+ R+ KL  +L  L AA
Sbjct  260  APADKKAWKESKLTYEARKEKLKAKLAELTAA  291



>ref|XP_005843140.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
 gb|EFN51038.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
Length=295

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  677  RPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKYI  498
            RPF+ +LD GL RT+TG++VF ALKGALDGGLDIPH+EKRF GF  DSK  DAEV RKYI
Sbjct  140  RPFQCILDAGLKRTSTGSKVFAALKGALDGGLDIPHNEKRFVGFDPDSKEFDAEVLRKYI  199

Query  497  YGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekq  318
            YGGHV  YM  + E++PEKY  HF+ Y+K G+E+D++E +Y KVH AIRADP+P+   + 
Sbjct  200  YGGHVGEYMEEMQEEDPEKYTAHFAEYLKAGLESDDLEDMYTKVHDAIRADPAPQLKARS  259

Query  317  ppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
             P E KR+ + KLTY++R+ KL  +L+ L A 
Sbjct  260  KPAESKRWKEVKLTYEQRKDKLKAKLSELMAG  291



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            +RPF ALLD GL RT+TG++VF ALKGALDGGLD+PHSEKRF G++++SK+LD++V RKY
Sbjct  139  KRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSEKRFVGYSRESKSLDSDVLRKY  198

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  321
            I+GGHV  YM S+ E++ EK++ HFS YIK G+EAD +EALY KVHAAIRA P   K  +
Sbjct  199  IFGGHVGEYMESMAEEDEEKFKRHFSCYIKAGLEADGLEALYTKVHAAIRASPEAAKKSR  258

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
              P +   +   K TY+ER+ +L  +L  L A
Sbjct  259  SKPAKAGSWKTPKSTYEERKERLKAKLAELMA  290



>gb|EME50014.1| hypothetical protein DOTSEDRAFT_31141 [Dothistroma septosporum 
NZE10]
Length=302

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+  LDVGL+RT+TG RVFGALKGA DGG+ IPHSEKRF G+  +SK LDAE  
Sbjct  139  GEERRPFKCFLDVGLVRTSTGARVFGALKGASDGGVYIPHSEKRFPGYDMESKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD-----  345
            RKYI+GGHVA YM +L +D+ E+Y++ F GYI   IEAD +E LY   H  IR D     
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYKSQFQGYIDDEIEADGLEELYADAHKQIREDPFKKD  258

Query  344  --pspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
                 KKS+ +   E K+F Q KLT+ ER+ ++ E++ AL + A
Sbjct  259  EEEGEKKSKDEWKAESKKFRQVKLTHAERKQRVQEKIKALASEA  302



>ref|XP_003856228.1| 60S ribosomal protein L5 [Zymoseptoria tritici IPO323]
 gb|EGP91204.1| hypothetical protein MYCGRDRAFT_102365 [Zymoseptoria tritici 
IPO323]
Length=300

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 113/162 (70%), Gaps = 7/162 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G++RRPF+A LDVGL RT+TG RVFGA+KGA DGGL IPHSEKRF GF  ++K LDAE  
Sbjct  139  GETRRPFKAFLDVGLARTSTGARVFGAMKGASDGGLYIPHSEKRFPGFDIETKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA YM +L +D+ E+Y++ F+GYI   IEAD +E LY+  H  IR DP  K 
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYKSQFNGYIDDEIEADGLEELYQDAHKQIREDPFKKA  258

Query  329  sekqppkEHK-------RFNQKKLTYDERRAKLIERLNALNA  225
              +   K  +       ++ QKKLT+ +R+ ++ E++ AL +
Sbjct  259  EGEGEKKTKEQWKAESLKYKQKKLTHAQRQERVQEKIKALTS  300



>gb|EMF17397.1| 60S ribosomal protein L5 [Sphaerulina musiva SO2202]
Length=302

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G++RRPF+  LDVGL RT+TG RVFGA+KGA DGGL +PHSEKRF G+  ++K LDAE  
Sbjct  139  GETRRPFKVFLDVGLTRTSTGARVFGAMKGASDGGLYVPHSEKRFPGYDIETKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIR-------  351
            RKYI+ GHVA YM +L +D+ E+Y++ FSGYI   IEAD +E LY++ H AIR       
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFSGYIDDEIEADGLEELYQEAHKAIREDPWKKD  258

Query  350  ADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNAL  231
             D   KK++++   E +++  KKLT++ERR ++ E++  L
Sbjct  259  EDAGEKKTKEEWKAESQKYKLKKLTHEERRQRVQEKIKTL  298



>gb|KEQ82579.1| hypothetical protein M438DRAFT_398586 [Aureobasidium pullulans 
EXF-150]
Length=299

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 109/161 (68%), Gaps = 6/161 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+  LDVGL RT+TG RVF A+KGA DGGL +PHSEKRF GF  ++K LDAE  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAAMKGASDGGLYVPHSEKRFPGFDIETKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  342
            RKYI+ GHVA YM +L +D+ E+Y++ F GYI   IEAD +E LY+  H  IR DP    
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKV  258

Query  341  --spkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
                KKS+    +E K+F   KLT  ER AK+ E++ AL+A
Sbjct  259  EGEEKKSKDFWKEESKKFRDNKLTKAEREAKIQEKIKALSA  299



>gb|KEQ95896.1| hypothetical protein AUEXF2481DRAFT_39748 [Aureobasidium subglaciale 
EXF-2481]
Length=299

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 109/161 (68%), Gaps = 6/161 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+  LDVGL RT+TG RVF A+KGA DGGL +PHSEKRF GF  ++K LDAE  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAAMKGASDGGLYVPHSEKRFPGFDIETKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  342
            RKYI+ GHVA YM +L +D+ E+Y++ F GYI   IEAD +E LY+  H  IR DP    
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKV  258

Query  341  --spkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
                KKS+    +E K+F   KLT  ER AK+ E++ AL+A
Sbjct  259  EGEEKKSKDFWKEESKKFRDNKLTKAERDAKIQEKIKALSA  299



>dbj|GAM82159.1| hypothetical protein ANO11243_001380 [fungal sp. No.11243]
Length=303

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 7/164 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+SRRPF+  LDVGL RT+TG RVFGA+KGA DGGL IPHSEKRF GF  +SK LDAE  
Sbjct  139  GESRRPFKCFLDVGLTRTSTGARVFGAMKGASDGGLYIPHSEKRFPGFDIESKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD-----  345
            RKYI+GGHVA YM +L +D+ E+Y++ F GYI   +EAD +E LY + H+ IR D     
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYKSQFQGYIDDEVEADGLEELYAEAHSQIREDPFKKD  258

Query  344  --pspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
                 KK ++    E K++   KL++ E++ ++ ER+  + A A
Sbjct  259  DEEEEKKDKEHWKSESKKYRSTKLSHAEKKKRVQERIKQIKADA  302



>gb|KEQ78036.1| hypothetical protein M436DRAFT_59974 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=299

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 6/161 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+  LDVGL RT+TG RVF ALKGA DGGL +PHSEKRF GF  ++K LDAE  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAALKGASDGGLYVPHSEKRFPGFDIETKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  342
            RKYI+ GHVA YM +L +D+ E+Y++ F GYI   IEAD +E LY+  H  IR DP    
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKV  258

Query  341  --spkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
                KKS+    +E K++   KLT  ER AK+ E++ AL A
Sbjct  259  EGEEKKSKDFWKEESKKYRDNKLTKAEREAKIQEKIKALAA  299



>ref|XP_007920104.1| hypothetical protein MYCFIDRAFT_54807 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME87665.1| hypothetical protein MYCFIDRAFT_54807 [Pseudocercospora fijiensis 
CIRAD86]
Length=303

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 111/161 (69%), Gaps = 8/161 (5%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G++RRPF+  LDVGL RT+TG RVFGA+KGA DGGL +PHSEKRF G+  ++K LDAE  
Sbjct  139  GETRRPFKVFLDVGLTRTSTGARVFGAMKGASDGGLYVPHSEKRFPGYDIETKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  342
            RKYI+GGHVA YM +L +D+ E+YQ+ F GYI   IEAD +E LY   H  IR DP    
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYQSQFKGYIDDEIEADGLEELYADAHKQIREDPWKKA  258

Query  341  ----spkksekqppkEHKRFNQKKLTYDERRAKLIERLNAL  231
                  KKS+++   E K+   KKLT +ERR ++ +++ AL
Sbjct  259  EDDGEQKKSKEEWKAETKKHMHKKLTREERRERVSQKIQAL  299



>ref|XP_005781727.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
 gb|EOD29298.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
Length=304

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  677  RPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKYI  498
            RPF  +LDVGLIRTTTG +VFGALKGA+DGGL+IPHS+KRF G+  D+K LD E H+KYI
Sbjct  139  RPFTCVLDVGLIRTTTGAKVFGALKGAVDGGLNIPHSDKRFPGYDPDAKELDGETHKKYI  198

Query  497  YGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  345
            +GGHVA YM  L E++P++YQT F+ YI+K IEAD++E +Y+K H AIR D
Sbjct  199  FGGHVAEYMELLEEEDPDRYQTQFANYIEKDIEADSLEEMYQKAHEAIRED  249



>gb|KHN36791.1| 60S ribosomal protein L5 [Glycine soja]
Length=240

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 95/122 (78%), Gaps = 16/122 (13%)
 Frame = -2

Query  578  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  399
            IPHS+KRFAGF K+ K LDAE+                L EDEPEKYQ+HFS YIK+GIE
Sbjct  130  IPHSDKRFAGFDKEKKELDAEI----------------LAEDEPEKYQSHFSEYIKRGIE  173

Query  398  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            AD IEALYKKVHAAIRADP+ KKS+KQPPKEHKR+N KKLTY+ER+AKL+ R+ A+N+AA
Sbjct  174  ADGIEALYKKVHAAIRADPTLKKSDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAA  233

Query  218  GN  213
             N
Sbjct  234  DN  235



>ref|XP_007674186.1| hypothetical protein BAUCODRAFT_146209 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC99242.1| hypothetical protein BAUCODRAFT_146209 [Baudoinia compniacensis 
UAMH 10762]
Length=303

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 113/165 (68%), Gaps = 8/165 (5%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+  LDVGL RT+TG RVFGA+KGA DGGL +PHSEKRF G+  +SK LDAE  
Sbjct  139  GEERRPFKCFLDVGLTRTSTGARVFGAMKGASDGGLYVPHSEKRFPGYDMESKELDAETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+ GHVA YM +L +D+ E+Y++ FSGYI   IEAD +E LY + H+ IR DP  K 
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFSGYIDDEIEADGLEELYAEAHSQIREDPWKKD  258

Query  329  sekqppkEHKRFNQ--------KKLTYDERRAKLIERLNALNAAA  219
             +++  K+ K   +        KK++YDE+R ++ E++ A+   +
Sbjct  259  EDEEGEKKTKEEWKEESKKHRTKKMSYDEKRQRVQEKIKAMTGES  303



>gb|KID66354.1| Ribosomal protein L5, eukaryotic/archaeal, partial [Metarhizium 
anisopliae ARSEF 549]
Length=297

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPF+  LDVGL RT+TG RVFGA+KGA DGG+ IPHSEKRF G+  +S+ LD+EV +KY
Sbjct  137  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGIFIPHSEKRFPGYDMESEELDSEVLQKY  196

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp-----  336
            I+GGHVA YM +L +D+ E+YQ+ F  YI  G+EAD +E LY + HAAIRADP       
Sbjct  197  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKVESD  256

Query  335  --kksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
              KK++++     K++ Q K T  E+  ++ ER+ A+ A
Sbjct  257  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  295



>gb|KEQ61687.1| hypothetical protein M437DRAFT_67147 [Aureobasidium melanogenum 
CBS 110374]
Length=300

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 108/162 (67%), Gaps = 7/162 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+  LDVGL RT+TG RVF A+KGA DGGL +PHSEKRF GF  ++K LD+E  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAAMKGASDGGLYVPHSEKRFPGFDIETKELDSETL  198

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD-----  345
            RKYI+ GHVA YM +L +D+ E+Y++ F GYI   IEAD +E LY+  H  IR D     
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKE  258

Query  344  --pspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
                 KKS+    +E K++   KLT  ER AK+ E++ AL+A
Sbjct  259  EGAGEKKSKDFWKEESKKYRDNKLTKAEREAKVQEKIKALSA  300



>gb|KID85893.1| Ribosomal protein L5, eukaryotic/archaeal [Metarhizium guizhouense 
ARSEF 977]
 gb|KID97028.1| Ribosomal protein L5, eukaryotic/archaeal, partial [Metarhizium 
majus ARSEF 297]
Length=302

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPF+  LDVGL RT+TG RVFGA+KGA DGG+ IPHSEKRF G+  +S+ LD+EV +KY
Sbjct  142  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGIFIPHSEKRFPGYDMESEELDSEVLQKY  201

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp-----  336
            I+GGHVA YM +L +D+ E+YQ+ F  YI  G+EAD +E LY + HAAIRADP       
Sbjct  202  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKVESD  261

Query  335  --kksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
              KK++++     K++ Q K T  E+  ++ ER+ A+ A
Sbjct  262  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  300



>ref|XP_007816229.1| Ribosomal protein L5, eukaryotic/archaeal [Metarhizium robertsii 
ARSEF 23]
 gb|EFZ02966.1| Ribosomal protein L5, eukaryotic/archaeal [Metarhizium robertsii 
ARSEF 23]
 gb|EXU98823.1| 60S ribosomal protein L5 [Metarhizium robertsii]
 gb|KFG80307.1| 60S ribosomal protein L5 [Metarhizium anisopliae]
Length=302

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPF+  LDVGL RT+TG RVFGA+KGA DGG+ IPHSEKRF G+  +S+ LD+EV +KY
Sbjct  142  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGIFIPHSEKRFPGYDMESEELDSEVLQKY  201

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp-----  336
            I+GGHVA YM +L +D+ E+YQ+ F  YI  G+EAD +E LY + HAAIRADP       
Sbjct  202  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKVESD  261

Query  335  --kksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
              KK++++     K++ Q K T  E+  ++ ER+ A+ A
Sbjct  262  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  300



>gb|KID72246.1| Ribosomal protein L5, eukaryotic/archaeal, partial [Metarhizium 
brunneum ARSEF 3297]
Length=317

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPF+  LDVGL RT+TG RVFGA+KGA DGG+ +PHSEKRF G+  +S+ LD+EV +KY
Sbjct  157  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGILVPHSEKRFPGYDMESEELDSEVLQKY  216

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse-  324
            I+GGHVA YM +L +D+ E+YQ+ F  YI  G+EAD +E LY + HAAIRADP  K    
Sbjct  217  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKAESD  276

Query  323  ------kqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
                  ++     K++ Q K T  E+  ++ ER+ A+ A
Sbjct  277  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  315



>emb|CEJ93107.1| Putative 60S ribosomal protein L5 (CPR4) [Torrubiella hemipterigena]
Length=243

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 112/163 (69%), Gaps = 7/163 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+A LDVGL RT+TG RVFGALKGA DGG+ +PHSEKRF G+  ++K LDA+V 
Sbjct  78   GEERRPFKAFLDVGLARTSTGARVFGALKGASDGGILVPHSEKRFPGYDMETKELDADVL  137

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD-----  345
            R YIYGGHVA YM +L +D+ E+YQ  F  YI+  +EA+++E LY + HAAIR D     
Sbjct  138  RNYIYGGHVAEYMETLADDDEERYQGQFKMYIEDDVEAESLEELYTEAHAAIREDPFKKV  197

Query  344  --pspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  222
                PKKS+++     K++   KLT  ++  ++ E++  L AA
Sbjct  198  ESSEPKKSKEEWKAISKKYRATKLTKAQKEERVQEKIKTLLAA  240



>gb|EKG20809.1| Ribosomal protein L18/L5 [Macrophomina phaseolina MS6]
Length=303

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 99/143 (69%), Gaps = 0/143 (0%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+  LDVGL+RT+TGNRVF A+KGA DGGL +PHSE RF G+  +SK LDAE  
Sbjct  140  GEERRPFKVFLDVGLVRTSTGNRVFAAMKGASDGGLYVPHSENRFPGYDIESKELDAETL  199

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  330
            RKYI+GGHVA YM +L +D+ E+Y++ F GYI   +EAD +E LY++ H  IR DP    
Sbjct  200  RKYIFGGHVAEYMETLADDDEERYKSQFQGYIDDDLEADGLEELYEEAHKQIREDPFKAD  259

Query  329  sekqppkEHKRFNQKKLTYDERR  261
             E +  K    + Q+ L Y +++
Sbjct  260  PEAKAKKSKDEYKQESLKYRQKK  282



>ref|XP_005643753.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE19209.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 1/156 (1%)
 Frame = -2

Query  677  RPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKYI  498
            RPF ALLD GL RT+TG++VF ALKGALDGGLDIPHS+KRF G++ + K LD EV RK+I
Sbjct  140  RPFTALLDTGLKRTSTGSKVFAALKGALDGGLDIPHSDKRFVGYSGEDKKLDPEVLRKHI  199

Query  497  YGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADp-spkksek  321
            YGGHVA YM  + E+ PEKYQ+HF+ +I+  ++ ++IE LYK VH  IR +P   KK   
Sbjct  200  YGGHVAEYMEEMQEEAPEKYQSHFAKWIEAEVDPEDIEELYKGVHEKIRENPIGEKKERS  259

Query  320  qppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  213
            +P    K++   KLTY+ER+A L  +L  L     +
Sbjct  260  KPETAQKKWKPSKLTYEERKAALKTKLAQLKEGGAD  295



>emb|CCE29368.1| probable 60S ribosomal protein L5 [Claviceps purpurea 20.1]
Length=302

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 111/161 (69%), Gaps = 7/161 (4%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPF+  LDVGL RT+TG RVFGA+KGA DGG+ +PHSEKRF G+  +SK LDAE   KY
Sbjct  142  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGILVPHSEKRFPGYDMESKELDAETLSKY  201

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRAD-------p  342
            I+GGHVA YM +L +D+ E+YQ+ F  YI   +EAD +E LY   HAAIRAD        
Sbjct  202  IFGGHVAEYMETLADDDEERYQSQFQKYIDDDVEADGLEELYTAAHAAIRADPFKKADGE  261

Query  341  spkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  219
            +PKK++++     K++ Q K +  E++A++ E++ A+ A A
Sbjct  262  APKKTKEEWKAISKKYRQTKSSKAEKQARVQEKIKAILAEA  302



>gb|KEF55260.1| 60S ribosomal protein L5 [Exophiala aquamarina CBS 119918]
Length=301

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  689  GKSRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  510
            G+ RRPF+A LDVGL RT+TG RVFGALKGA DGGL IPH+EKRF G+ ++SK LDA+  
Sbjct  140  GEGRRPFKAFLDVGLHRTSTGARVFGALKGASDGGLYIPHNEKRFPGYDQESKELDADTL  199

Query  509  RKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIR-------  351
            RKYI+GGHVA YM +L +D+ E+Y++ FS YI   +EAD +E LY + HAAIR       
Sbjct  200  RKYIFGGHVAEYMETLADDDEERYKSQFSKYIDNDVEADGLEELYSEAHAAIREDPFKKD  259

Query  350  ADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNAL  231
             D   KKS+ +   E K+  Q+KL+ +E+  ++ E++ +L
Sbjct  260  EDEGEKKSKDEWKAEGKKHRQQKLSKEEKEQRIKEKIASL  299



>ref|XP_007813241.1| 60S ribosomal protein L5 [Metarhizium acridum CQMa 102]
 gb|EFY87003.1| 60S ribosomal protein L5 [Metarhizium acridum CQMa 102]
Length=302

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = -2

Query  680  RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  501
            RRPF+  LDVGL RT+TG RVFGA+KGA DGG+ IPHSEKRF G+  +S+ LD EV +KY
Sbjct  142  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGIFIPHSEKRFPGYDMESEELDTEVLQKY  201

Query  500  IYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp-----  336
            I+GGHVA YM +L +D+ E+YQ+ F  YI  G+EAD++E LY + HAAIRADP       
Sbjct  202  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADSLEDLYTEAHAAIRADPWKKVESD  261

Query  335  --kksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  225
              KK++++     K++ Q K T  E+  ++ +++ AL A
Sbjct  262  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQDKIKALLA  300



>sp|Q56FG6.1|RL5_LYSTE RecName: Full=60S ribosomal protein L5 [Lysiphlebus testaceipes]
 gb|AAX62436.1| ribosomal protein L5 [Lysiphlebus testaceipes]
Length=297

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  671  FRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKYIYG  492
            FR  LD GL+RTTTG R+FGA+KGA+DGGL+IPHS KRF G+  +SK+ +A+VHR++I+ 
Sbjct  142  FRCYLDTGLMRTTTGARIFGAMKGAVDGGLNIPHSTKRFPGYDNESKSFNADVHRQHIFA  201

Query  491  GHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksekqpp  312
             H+A YM +L E+EPE +Q  FS YIK GI AD IE +YKK H AIRADP   +  K   
Sbjct  202  HHIANYMKTLEENEPENFQRQFSQYIKNGITADGIEEMYKKAHEAIRADPDRAEIVKTKE  261

Query  311  kEHKRFNQKKLTYDERRAKL  252
               KR+N+ KLT  ER+ ++
Sbjct  262  PVKKRWNRAKLTLSERKDRV  281



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520