BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001C04

Length=786
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     328   8e-103   Nicotiana tomentosiformis
gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               326   4e-102   Nicotiana tabacum [American tobacco]
ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     326   6e-102   Nicotiana sylvestris
ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     322   2e-100   Solanum tuberosum [potatoes]
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          320   6e-100   Solanum lycopersicum
emb|CDP16685.1|  unnamed protein product                                316   4e-98    Coffea canephora [robusta coffee]
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    314   2e-97    Vitis vinifera
ref|NP_001268190.1|  uncharacterized protein LOC100260066               311   2e-96    Vitis vinifera
ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     308   3e-95    Sesamum indicum [beniseed]
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     305   4e-94    Sesamum indicum [beniseed]
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          298   1e-91    Eucalyptus grandis [rose gum]
gb|KDO43321.1|  hypothetical protein CISIN_1g0039662mg                  289   2e-91    Citrus sinensis [apfelsine]
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like     297   4e-91    Solanum tuberosum [potatoes]
ref|XP_006447085.1|  hypothetical protein CICLE_v10014341mg             291   2e-90    
ref|XP_002509531.1|  chloride channel clc, putative                     295   2e-90    Ricinus communis
ref|XP_007031847.1|  Chloride channel B isoform 1                       291   3e-90    
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          293   1e-89    Prunus mume [ume]
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     293   3e-89    Fragaria vesca subsp. vesca
ref|XP_002300101.1|  Chloride channel protein CLC-a                     292   3e-89    Populus trichocarpa [western balsam poplar]
gb|KDO43317.1|  hypothetical protein CISIN_1g0039662mg                  288   3e-89    Citrus sinensis [apfelsine]
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             291   5e-89    Citrus clementina [clementine]
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             291   7e-89    Prunus persica
ref|XP_007031848.1|  Chloride channel B isoform 2                       290   2e-88    
ref|NP_001267676.1|  chloride channel protein CLC-b-like                290   2e-88    Cucumis sativus [cucumbers]
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     290   3e-88    Cucumis melo [Oriental melon]
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          290   3e-88    Populus euphratica
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like     289   4e-88    Solanum lycopersicum
gb|KHN24330.1|  Chloride channel protein CLC-b                          288   1e-87    Glycine soja [wild soybean]
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    288   1e-87    Glycine max [soybeans]
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    287   2e-87    Glycine max [soybeans]
gb|KHN10806.1|  Chloride channel protein CLC-b                          286   3e-87    Glycine soja [wild soybean]
ref|XP_008341308.1|  PREDICTED: chloride channel protein CLC-b          271   9e-87    
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     285   1e-86    
emb|CAN82189.1|  hypothetical protein VITISV_031114                     284   2e-86    Vitis vinifera
gb|KHG13135.1|  Chloride channel CLC-b -like protein                    282   7e-86    Gossypium arboreum [tree cotton]
gb|KEH22046.1|  ClC chloride channel family protein                     282   3e-85    Medicago truncatula
gb|KJB76407.1|  hypothetical protein B456_012G087500                    280   1e-84    Gossypium raimondii
gb|KJB76409.1|  hypothetical protein B456_012G087500                    280   1e-84    Gossypium raimondii
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                277   1e-83    Erythranthe guttata [common monkey flower]
ref|XP_010556277.1|  PREDICTED: chloride channel protein CLC-b          274   2e-83    
gb|KHN01525.1|  Chloride channel protein CLC-b                          276   5e-83    Glycine soja [wild soybean]
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                276   5e-83    Erythranthe guttata [common monkey flower]
ref|NP_001236494.1|  chloride channel                                   276   6e-83    
ref|XP_010111585.1|  Chloride channel protein CLC-b                     275   9e-83    Morus notabilis
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             274   2e-82    Phaseolus vulgaris [French bean]
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    273   4e-82    
gb|KHF97413.1|  Chloride channel CLC-b -like protein                    272   5e-82    Gossypium arboreum [tree cotton]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    272   1e-81    Gossypium raimondii
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     270   8e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          268   3e-80    Brassica rapa
emb|CDX83663.1|  BnaC07g24030D                                          267   7e-80    
gb|KDP46292.1|  hypothetical protein JCGZ_10132                         267   8e-80    Jatropha curcas
emb|CDY13685.1|  BnaA06g32380D                                          267   9e-80    Brassica napus [oilseed rape]
ref|XP_010678326.1|  PREDICTED: chloride channel protein CLC-b-li...    264   1e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          266   2e-79    Nelumbo nucifera [Indian lotus]
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             266   3e-79    Phaseolus vulgaris [French bean]
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             266   3e-79    Capsella rubella
emb|CDY28488.1|  BnaC02g36720D                                          265   6e-79    Brassica napus [oilseed rape]
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    266   6e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    263   1e-78    Camelina sativa [gold-of-pleasure]
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             264   1e-78    Eutrema salsugineum [saltwater cress]
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    263   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     264   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    263   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     263   2e-78    Brassica rapa
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    263   3e-78    Camelina sativa [gold-of-pleasure]
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    263   3e-78    Arabis alpina [alpine rockcress]
ref|NP_189353.1|  chloride channel protein CLC-b                        263   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          261   1e-77    Camelina sativa [gold-of-pleasure]
ref|XP_002875360.1|  CLC-B                                              261   2e-77    
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     260   4e-77    Tarenaya hassleriana [spider flower]
emb|CDY34173.1|  BnaA02g28670D                                          259   1e-76    Brassica napus [oilseed rape]
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     258   2e-76    
gb|KEH25445.1|  ClC chloride channel family protein                     254   5e-76    Medicago truncatula
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     257   6e-76    
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     256   8e-76    
gb|KEH25446.1|  ClC chloride channel family protein                     255   1e-75    Medicago truncatula
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     256   2e-75    
ref|XP_003618847.1|  Chloride channel protein CLC-a                     255   3e-75    
gb|AES75065.2|  ClC chloride channel family protein                     255   3e-75    Medicago truncatula
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     248   9e-73    Cicer arietinum [garbanzo]
emb|CDY11722.1|  BnaC06g13300D                                          245   1e-71    Brassica napus [oilseed rape]
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     244   4e-71    Brassica rapa
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          243   9e-71    Brassica rapa
gb|ADD09860.1|  chloride channel A                                      243   1e-70    Eutrema halophilum
ref|NP_001031990.1|  chloride channel protein CLC-a                     239   3e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CDX67478.1|  BnaA07g15180D                                          241   3e-70    
emb|CDY15925.1|  BnaA04g11860D                                          241   4e-70    Brassica napus [oilseed rape]
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          241   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          241   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             241   6e-70    Eutrema salsugineum [saltwater cress]
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             241   6e-70    Capsella rubella
gb|KJB76408.1|  hypothetical protein B456_012G087500                    241   9e-70    Gossypium raimondii
gb|AAB17007.1|  voltage-gated chloride channel                          240   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     240   1e-69    Camelina sativa [gold-of-pleasure]
gb|AAL24139.1|  putative anion channel protein                          240   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|NP_198905.1|  chloride channel protein CLC-a                        239   1e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CAA96057.1|  CLC-a chloride channel protein                         239   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868624.1|  ATCLC-A                                            239   2e-69    
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    239   2e-69    Arabis alpina [alpine rockcress]
emb|CDX99630.1|  BnaC04g33870D                                          238   4e-69    
ref|XP_007031850.1|  Chloride channel B isoform 4                       238   5e-69    
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...    228   2e-65    
dbj|BAJ92499.1|  predicted protein                                      222   6e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96369.1|  predicted protein                                      222   6e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88201.1|  predicted protein                                      222   6e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT23598.1|  hypothetical protein F775_52599                         219   1e-62    
dbj|BAJ91019.1|  predicted protein                                      221   1e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT27070.1|  Chloride channel protein CLC-b                          215   6e-62    
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like     217   3e-61    Oryza brachyantha
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like     214   2e-60    Brachypodium distachyon [annual false brome]
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090          213   6e-60    Sorghum bicolor [broomcorn]
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...    212   2e-59    Setaria italica
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1     212   2e-59    Zea mays [maize]
gb|ABA98017.1|  Chloride channel protein CLC-a, putative, expressed     208   7e-59    Oryza sativa Japonica Group [Japonica rice]
gb|EEC69202.1|  hypothetical protein OsI_38195                          208   9e-59    Oryza sativa Indica Group [Indian rice]
gb|EEE53145.1|  hypothetical protein OsJ_35963                          209   2e-58    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066692.1|  Os12g0438600                                       208   2e-58    
ref|XP_006848425.1|  hypothetical protein AMTR_s00013p00233550          201   6e-56    
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g             186   3e-50    Phaseolus vulgaris [French bean]
ref|XP_010240516.1|  PREDICTED: putative chloride channel-like pr...    177   2e-47    
gb|EMS65031.1|  Chloride channel protein CLC-b                          175   3e-47    Triticum urartu
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...    177   4e-47    Brachypodium distachyon [annual false brome]
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...    173   1e-45    Pyrus x bretschneideri [bai li]
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like     172   2e-45    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...    171   6e-45    
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...    171   6e-45    Fragaria vesca subsp. vesca
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...    171   6e-45    Fragaria vesca subsp. vesca
emb|CBI27719.3|  unnamed protein product                                169   1e-44    Vitis vinifera
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like     170   2e-44    Brachypodium distachyon [annual false brome]
ref|XP_006381102.1|  chloride channel-like family protein               169   2e-44    
ref|NP_001268085.1|  uncharacterized protein LOC100259734               169   2e-44    Vitis vinifera
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...    169   2e-44    Eucalyptus grandis [rose gum]
ref|XP_010057599.1|  PREDICTED: putative chloride channel-like pr...    169   3e-44    Eucalyptus grandis [rose gum]
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like     169   5e-44    Oryza brachyantha
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like     168   6e-44    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010905340.1|  PREDICTED: putative chloride channel-like pr...    167   7e-44    Elaeis guineensis
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...    168   7e-44    Populus euphratica
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...    168   8e-44    Sesamum indicum [beniseed]
gb|EEE60792.1|  hypothetical protein OsJ_14377                          168   8e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011084086.1|  PREDICTED: putative chloride channel-like pr...    167   8e-44    
ref|NP_001275140.1|  chloride channel protein CLC-c-like                167   1e-43    Solanum tuberosum [potatoes]
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...    167   1e-43    
gb|EAY94258.1|  hypothetical protein OsI_16029                          167   1e-43    Oryza sativa Indica Group [Indian rice]
dbj|BAB97267.1|  chloride channel                                       167   1e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...    167   1e-43    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like     167   1e-43    
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...    167   1e-43    Elaeis guineensis
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...    167   1e-43    Pyrus x bretschneideri [bai li]
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...    167   2e-43    
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g            169   2e-43    
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...    167   2e-43    
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like     166   2e-43    Nicotiana sylvestris
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                  166   3e-43    Medicago truncatula
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like     166   3e-43    Solanum lycopersicum
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like     166   3e-43    Nicotiana tomentosiformis
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...    166   3e-43    Glycine max [soybeans]
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g            166   3e-43    Glycine soja [wild soybean]
ref|XP_006389435.1|  chloride channel-like family protein               166   3e-43    Populus trichocarpa [western balsam poplar]
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g            167   3e-43    Triticum urartu
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...    166   4e-43    Phoenix dactylifera
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like     166   5e-43    Nicotiana tomentosiformis
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...    166   5e-43    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like     166   5e-43    Phoenix dactylifera
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg             166   5e-43    
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg             166   5e-43    Prunus persica
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like     166   6e-43    Nicotiana sylvestris
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890          166   8e-43    Sorghum bicolor [broomcorn]
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...    165   9e-43    Elaeis guineensis
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c          165   1e-42    Nelumbo nucifera [Indian lotus]
ref|XP_006852872.1|  hypothetical protein AMTR_s00033p00206270          165   1e-42    Amborella trichopoda
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...    166   1e-42    
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...    165   1e-42    Brachypodium distachyon [annual false brome]
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                   165   1e-42    Citrus sinensis [apfelsine]
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...    165   1e-42    Populus euphratica
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like     164   1e-42    Elaeis guineensis
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...    164   1e-42    Prunus mume [ume]
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...    164   2e-42    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001183936.1|  chloride channel protein                           164   2e-42    Zea mays [maize]
ref|NP_001105216.1|  LOC542114                                          164   2e-42    Zea mays [maize]
ref|NP_001047143.2|  Os02g0558100                                       163   2e-42    
gb|ADW93911.1|  chloride channel 1                                      164   2e-42    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570          164   2e-42    Sorghum bicolor [broomcorn]
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g             164   2e-42    Phaseolus vulgaris [French bean]
gb|KJB46914.1|  hypothetical protein B456_008G001200                    164   2e-42    Gossypium raimondii
ref|NP_001169702.1|  uncharacterized protein LOC100383583               158   3e-42    
gb|KHG08138.1|  Chloride channel CLC-c -like protein                    162   3e-42    Gossypium arboreum [tree cotton]
ref|NP_001170245.1|  uncharacterized protein LOC100384199               160   3e-42    
ref|XP_006836849.1|  hypothetical protein AMTR_s00099p00074960          163   3e-42    Amborella trichopoda
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like     163   4e-42    Cicer arietinum [garbanzo]
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                    163   4e-42    Zea mays [maize]
dbj|BAB97268.1|  chloride channel                                       163   4e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003592890.1|  Chloride channel protein CLC-c                     162   6e-42    Medicago truncatula
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...    162   6e-42    Nelumbo nucifera [Indian lotus]
ref|XP_002530769.1|  chloride channel clc, putative                     162   7e-42    Ricinus communis
dbj|BAD16425.1|  chloride channel                                       163   7e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like     164   7e-42    Setaria italica
gb|EPS68170.1|  hypothetical protein M569_06601                         162   7e-42    Genlisea aurea
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c          162   8e-42    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG07842.1|  Chloride channel CLC-c -like protein                    161   1e-41    Gossypium arboreum [tree cotton]
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...    162   1e-41    Phoenix dactylifera
gb|AAQ56538.1|  putative chloride channel                               162   1e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c          161   2e-41    Solanum lycopersicum
gb|KDO42565.1|  hypothetical protein CISIN_1g003885mg                   160   2e-41    Citrus sinensis [apfelsine]
ref|XP_006431488.1|  hypothetical protein CICLE_v10000336mg             160   2e-41    
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...    161   2e-41    Cicer arietinum [garbanzo]
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...    161   2e-41    Nelumbo nucifera [Indian lotus]
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...    161   2e-41    Solanum lycopersicum
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    161   2e-41    
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g             161   3e-41    Phaseolus vulgaris [French bean]
gb|KJB40519.1|  hypothetical protein B456_007G067500                    160   3e-41    Gossypium raimondii
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like     161   3e-41    Oryza brachyantha
gb|ACF78606.1|  unknown                                                 158   3e-41    Zea mays [maize]
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like     160   3e-41    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like     160   4e-41    Solanum tuberosum [potatoes]
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like     160   4e-41    
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...    160   5e-41    Sesamum indicum [beniseed]
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like     160   5e-41    Brachypodium distachyon [annual false brome]
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...    160   5e-41    Setaria italica
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    160   5e-41    
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c          160   5e-41    Fragaria vesca subsp. vesca
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...    160   6e-41    Solanum tuberosum [potatoes]
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg             160   7e-41    Citrus clementina [clementine]
ref|XP_006470993.1|  PREDICTED: chloride channel protein CLC-c-li...    159   7e-41    Citrus sinensis [apfelsine]
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                   160   7e-41    Citrus sinensis [apfelsine]
ref|XP_007048601.1|  Chloride channel C                                 160   7e-41    
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...    159   7e-41    
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                    159   9e-41    
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...    159   1e-40    Eucalyptus grandis [rose gum]
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c          159   1e-40    Tarenaya hassleriana [spider flower]
ref|XP_010099780.1|  Chloride channel protein CLC-c                     159   1e-40    Morus notabilis
gb|AFW70592.1|  hypothetical protein ZEAMMB73_317914                    158   1e-40    
gb|ADD09861.1|  chloride channel C                                      159   1e-40    Eutrema halophilum
ref|XP_002527858.1|  chloride channel clc, putative                     159   1e-40    
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg             159   2e-40    Eutrema salsugineum [saltwater cress]
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250          159   2e-40    Sorghum bicolor [broomcorn]
emb|CDO97645.1|  unnamed protein product                                159   2e-40    Coffea canephora [robusta coffee]
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like     158   2e-40    Eucalyptus grandis [rose gum]
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like     158   2e-40    
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...    158   2e-40    Citrus sinensis [apfelsine]
ref|XP_010657886.1|  PREDICTED: uncharacterized protein LOC100245...    157   2e-40    Vitis vinifera
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...    158   3e-40    
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg                158   3e-40    Erythranthe guttata [common monkey flower]
ref|XP_009586705.1|  PREDICTED: putative chloride channel-like pr...    157   3e-40    Nicotiana tomentosiformis
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...    158   3e-40    Tarenaya hassleriana [spider flower]
gb|KJB64678.1|  hypothetical protein B456_010G060300                    157   4e-40    Gossypium raimondii
emb|CDP10469.1|  unnamed protein product                                157   4e-40    Coffea canephora [robusta coffee]
ref|XP_008441632.1|  PREDICTED: chloride channel protein CLC-b-like     149   4e-40    
dbj|BAJ92873.1|  predicted protein                                      158   4e-40    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009777969.1|  PREDICTED: putative chloride channel-like pr...    157   4e-40    Nicotiana sylvestris
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530          158   4e-40    Sorghum bicolor [broomcorn]
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                    157   5e-40    Arabis alpina [alpine rockcress]
gb|KHN24457.1|  Chloride channel protein CLC-c                          156   5e-40    Glycine soja [wild soybean]
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...    157   5e-40    Nicotiana tomentosiformis
gb|EEC78120.1|  hypothetical protein OsI_17660                          151   5e-40    Oryza sativa Indica Group [Indian rice]
tpg|DAA35720.1|  TPA: chloride channel G                                157   5e-40    
emb|CBI29647.3|  unnamed protein product                                157   6e-40    Vitis vinifera
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...    157   6e-40    Nicotiana sylvestris
gb|KEH26640.1|  chloride channel ClC1 protein                           156   6e-40    Medicago truncatula
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870              157   6e-40    
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870              157   7e-40    
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1           157   7e-40    Zea mays [maize]
gb|KHG01487.1|  Putative chloride channel-like protein CLC-g            156   7e-40    Gossypium arboreum [tree cotton]
ref|NP_001130407.2|  chloride channel G                                 158   8e-40    
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like     157   9e-40    
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg             157   9e-40    Prunus persica
ref|XP_006587398.1|  PREDICTED: chloride channel protein CLC-c-li...    155   1e-39    Glycine max [soybeans]
ref|NP_001268053.1|  uncharacterized protein LOC100245380               156   1e-39    Vitis vinifera
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...    156   1e-39    Vitis vinifera
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like     155   2e-39    Populus euphratica
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like     155   2e-39    Populus euphratica
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...    156   2e-39    Setaria italica
gb|AES75975.2|  chloride channel ClC1 protein                           156   2e-39    Medicago truncatula
ref|XP_003619757.1|  Chloride channel protein CLC-c                     156   2e-39    
ref|XP_006385193.1|  Chloride channel protein CLC-c                     155   2e-39    
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like     155   2e-39    Populus euphratica
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...    155   2e-39    
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g            154   2e-39    Triticum urartu
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...    156   3e-39    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like     155   3e-39    
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...    155   3e-39    
gb|KHM99790.1|  Chloride channel protein CLC-c                          155   3e-39    
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...    155   4e-39    
ref|XP_006385076.1|  Chloride channel protein CLC-c                     154   4e-39    
ref|XP_010030224.1|  PREDICTED: chloride channel protein CLC-c-li...    154   4e-39    
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like     154   5e-39    
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...    154   5e-39    
ref|XP_008379004.1|  PREDICTED: chloride channel protein CLC-c          153   5e-39    
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...    154   6e-39    
gb|KDP42489.1|  hypothetical protein JCGZ_00286                         154   6e-39    
gb|KJB53990.1|  hypothetical protein B456_009G015100                    154   7e-39    
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like     154   7e-39    
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like     154   9e-39    
emb|CDY21447.1|  BnaC03g27500D                                          153   1e-38    
ref|XP_006599665.1|  PREDICTED: chloride channel protein CLC-c-li...    152   1e-38    
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c          153   1e-38    
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c          153   1e-38    
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg             153   2e-38    
ref|NP_198313.2|  putative chloride channel-like protein CLC-g          153   2e-38    
ref|XP_004155280.1|  PREDICTED: chloride channel protein CLC-c-like     151   2e-38    
ref|XP_004512645.1|  PREDICTED: chloride channel protein CLC-c-li...    151   2e-38    
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like     152   2e-38    
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...    152   3e-38    
gb|KCW82974.1|  hypothetical protein EUGRSUZ_C04362                     151   3e-38    
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g            153   3e-38    
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...    152   3e-38    
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c          152   3e-38    
emb|CDX91539.1|  BnaC02g16210D                                          152   4e-38    
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576             152   4e-38    
gb|AIY56605.1|  CLC                                                     152   4e-38    
ref|XP_004133731.1|  PREDICTED: chloride channel protein CLC-c-li...    151   6e-38    
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...    150   6e-38    
emb|CAJ86158.1|  H0413E07.11                                            152   6e-38    
gb|ABB86548.1|  chloride channel-like protein Osclc                     152   6e-38    
emb|CDX83179.1|  BnaA03g23270D                                          151   7e-38    
emb|CAD41919.2|  OSJNBa0033G05.20                                       152   7e-38    
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    151   7e-38    
ref|NP_001267998.1|  uncharacterized protein LOC100255837               151   7e-38    
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...    151   7e-38    
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...    151   8e-38    
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...    151   8e-38    
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...    151   9e-38    
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like     151   9e-38    
emb|CAN62616.1|  hypothetical protein VITISV_036165                     151   1e-37    
gb|KCW82961.1|  hypothetical protein EUGRSUZ_C04346                     149   1e-37    
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c-li...    151   1e-37    
gb|EEE61792.1|  hypothetical protein OsJ_16396                          151   1e-37    
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...    151   1e-37    
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...    150   1e-37    
emb|CDY47559.1|  BnaA08g07280D                                          150   2e-37    
emb|CDY12393.1|  BnaC08g08120D                                          150   2e-37    
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like     150   3e-37    
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg                150   3e-37    
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...    149   3e-37    
ref|NP_199800.1|  chloride channel protein CLC-c                        149   5e-37    
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...    149   7e-37    
ref|XP_002865761.1|  CLC-C                                              148   8e-37    
gb|KEH32756.1|  chloride channel ClC1 protein                           148   9e-37    
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like     148   1e-36    
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...    148   1e-36    
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...    147   1e-36    
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...    148   2e-36    
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...    148   2e-36    
gb|EMS50378.1|  Chloride channel protein CLC-c                          147   2e-36    
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...    147   2e-36    
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...    147   2e-36    
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                     146   3e-36    
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg             146   4e-36    
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...    146   4e-36    
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...    146   5e-36    
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g       145   9e-36    
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c          145   1e-35    
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like     145   1e-35    
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like     145   1e-35    
tpg|DAA56573.1|  TPA: chloride channel protein                          145   1e-35    
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c          145   1e-35    
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like     145   2e-35    
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg             144   4e-35    
ref|XP_006388253.1|  hypothetical protein POPTR_0261s002201g            140   4e-35    
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...    142   8e-35    
gb|KDP44103.1|  hypothetical protein JCGZ_05570                         142   1e-34    
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...    142   1e-34    
gb|EEC71893.1|  hypothetical protein OsI_04638                          142   2e-34    
dbj|BAD82092.1|  putative chloride channel                              142   2e-34    
gb|EEE55755.1|  hypothetical protein OsJ_04269                          142   2e-34    
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480          141   3e-34    
ref|XP_004165980.1|  PREDICTED: putative chloride channel-like pr...    140   5e-34    
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...    140   5e-34    
gb|KDP30234.1|  hypothetical protein JCGZ_17016                         140   8e-34    
gb|ADF30876.1|  chloride channel protein                                140   8e-34    
ref|XP_006370817.1|  hypothetical protein POPTR_0019s00230g             138   1e-33    
ref|XP_002325287.2|  hypothetical protein POPTR_0019s00230g             137   1e-33    
gb|KJB40520.1|  hypothetical protein B456_007G067500                    138   2e-33    
gb|KHG02940.1|  Putative chloride channel-like protein CLC-g            138   3e-33    
gb|EMS67360.1|  Chloride channel protein CLC-c                          137   8e-33    
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c          136   1e-32    
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like     135   4e-32    
ref|XP_008385147.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    134   1e-31    
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg             132   4e-31    
gb|EMT28663.1|  Chloride channel protein CLC-c                          130   2e-30    
gb|EMT27046.1|  Chloride channel protein CLC-c                          130   3e-30    
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906             130   3e-30    
gb|ADF78069.1|  chloride channel protein                                128   1e-29    
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899             127   2e-29    
gb|EPS73799.1|  hypothetical protein M569_00956                         126   6e-29    
ref|XP_001756485.1|  predicted protein                                  120   1e-26    
emb|CDM85188.1|  unnamed protein product                                118   4e-26    
ref|XP_010646994.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-25    
gb|AFB33948.1|  hypothetical protein CL1659Contig1_02                   104   2e-24    
ref|XP_009403199.1|  PREDICTED: putative chloride channel-like pr...    111   5e-24    
ref|XP_010099521.1|  Chloride channel protein CLC-c                     104   1e-23    
gb|AFB33961.1|  hypothetical protein CL1659Contig1_02                   101   2e-23    
ref|XP_002974894.1|  hypothetical protein SELMODRAFT_442632             108   5e-23    
ref|XP_002988905.1|  hypothetical protein SELMODRAFT_427560             108   5e-23    
gb|AEW08796.1|  hypothetical protein CL1659Contig1_02                   100   7e-23    
gb|EMT05380.1|  Chloride channel protein CLC-c                          100   9e-23    
gb|AFB33956.1|  hypothetical protein CL1659Contig1_02                 99.0    2e-22    
gb|AEW08797.1|  hypothetical protein CL1659Contig1_02                 99.0    2e-22    
gb|AFG64985.1|  hypothetical protein CL1659Contig1_02                 98.6    2e-22    
dbj|BAJ97961.1|  predicted protein                                      104   2e-21    
ref|XP_009395587.1|  PREDICTED: chloride channel protein CLC-d is...    104   2e-21    
ref|XP_009395588.1|  PREDICTED: chloride channel protein CLC-d is...    104   2e-21    
ref|XP_009395586.1|  PREDICTED: chloride channel protein CLC-d is...    104   2e-21    
ref|NP_001050977.1|  Os03g0695700                                       100   3e-21    
tpg|DAA50799.1|  TPA: hypothetical protein ZEAMMB73_784473            99.4    1e-20    
ref|XP_001782456.1|  predicted protein                                  101   2e-20    
gb|ABF98344.1|  Chloride channel protein CLC-d, putative, expressed     100   2e-20    
tpg|DAA50798.1|  TPA: hypothetical protein ZEAMMB73_784473            98.6    2e-20    
tpg|DAA50797.1|  TPA: hypothetical protein ZEAMMB73_784473            98.2    2e-20    
ref|XP_002464046.1|  hypothetical protein SORBIDRAFT_01g011250        98.2    2e-20    
gb|EMS55037.1|  Chloride channel protein CLC-c                        99.8    7e-20    
gb|AAO19370.1|  putative CLC-d chloride channel protein               98.6    2e-19    
gb|EEE59743.1|  hypothetical protein OsJ_12209                        98.2    2e-19    
gb|EEC75998.1|  hypothetical protein OsI_13133                        98.2    2e-19    
ref|XP_008665233.1|  PREDICTED: chloride channel protein CLC-d is...  97.4    4e-19    
gb|EYU45643.1|  hypothetical protein MIMGU_mgv1a0022071mg             93.2    4e-19    
gb|EYU45642.1|  hypothetical protein MIMGU_mgv1a0022071mg             93.2    4e-19    
ref|XP_008665231.1|  PREDICTED: chloride channel protein CLC-d is...  96.7    7e-19    
ref|XP_006650436.1|  PREDICTED: chloride channel protein CLC-d-like   96.7    7e-19    
gb|KDO74671.1|  hypothetical protein CISIN_1g003732mg                 95.5    2e-18    
ref|XP_006419888.1|  hypothetical protein CICLE_v10004375mg           95.1    2e-18    
ref|XP_006489358.1|  PREDICTED: chloride channel protein CLC-d-li...  95.1    2e-18    
ref|XP_003561001.1|  PREDICTED: chloride channel protein CLC-d is...  94.4    4e-18    
ref|XP_010231301.1|  PREDICTED: chloride channel protein CLC-d is...  94.0    5e-18    
ref|XP_010546809.1|  PREDICTED: chloride channel protein CLC-d is...  94.0    6e-18    
ref|XP_004982102.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  94.0    6e-18    
ref|XP_010546808.1|  PREDICTED: chloride channel protein CLC-d is...  93.6    7e-18    
ref|XP_010524817.1|  PREDICTED: chloride channel protein CLC-d is...  93.6    8e-18    
gb|KDP40151.1|  hypothetical protein JCGZ_02149                       93.2    9e-18    
ref|XP_002974732.1|  hypothetical protein SELMODRAFT_101801           93.2    1e-17    
ref|XP_002963642.1|  hypothetical protein SELMODRAFT_80232            93.2    1e-17    
ref|XP_007157150.1|  hypothetical protein PHAVU_002G0470001g          90.5    1e-17    
gb|ADW93910.1|  chloride channel 1                                    92.8    1e-17    
ref|XP_010524818.1|  PREDICTED: chloride channel protein CLC-d is...  92.8    1e-17    
ref|XP_007157149.1|  hypothetical protein PHAVU_002G0470001g          90.5    1e-17    
ref|XP_010524816.1|  PREDICTED: chloride channel protein CLC-d is...  92.8    2e-17    
ref|XP_010024357.1|  PREDICTED: chloride channel protein CLC-d        89.0    2e-17    
dbj|BAK05536.1|  predicted protein                                    92.0    2e-17    
ref|XP_010255989.1|  PREDICTED: chloride channel protein CLC-d is...  92.0    2e-17    
ref|XP_010277691.1|  PREDICTED: chloride channel protein CLC-d-li...  91.7    3e-17    
ref|XP_010277685.1|  PREDICTED: chloride channel protein CLC-d-li...  91.7    3e-17    
gb|KCW60808.1|  hypothetical protein EUGRSUZ_H03545                   88.6    3e-17    
gb|EMT29473.1|  Chloride channel protein CLC-d                        91.3    5e-17    
gb|ADP02177.1|  putative chloride channel protein CLC-d               91.3    5e-17    
dbj|BAJ33844.1|  unnamed protein product                              90.1    5e-17    
ref|XP_010277677.1|  PREDICTED: chloride channel protein CLC-d-li...  90.9    6e-17    
ref|XP_010277670.1|  PREDICTED: chloride channel protein CLC-d-li...  90.9    6e-17    
ref|XP_006590398.1|  PREDICTED: chloride channel protein CLC-d-li...  90.5    6e-17    
ref|XP_011071568.1|  PREDICTED: chloride channel protein CLC-d is...  90.9    6e-17    
ref|XP_011071569.1|  PREDICTED: chloride channel protein CLC-d is...  90.9    6e-17    
ref|XP_011071570.1|  PREDICTED: chloride channel protein CLC-d is...  90.5    7e-17    
gb|AES93651.2|  chloride channel protein ClC-D protein, putative      90.1    7e-17    
ref|XP_004511351.1|  PREDICTED: chloride channel protein CLC-d-li...  90.5    8e-17    
gb|KEH27345.1|  chloride channel protein ClC-D protein, putative      90.1    8e-17    
ref|XP_011071571.1|  PREDICTED: chloride channel protein CLC-d is...  90.5    8e-17    
ref|XP_004511350.1|  PREDICTED: chloride channel protein CLC-d-li...  90.5    8e-17    
ref|XP_003610693.1|  Chloride channel protein CLC-d                   90.1    1e-16    
ref|XP_003610694.1|  Chloride channel protein CLC-d                   89.7    1e-16    
gb|EPS62511.1|  hypothetical protein M569_12278                       89.7    1e-16    
gb|KEH27344.1|  chloride channel protein ClC-D protein, putative      89.7    1e-16    
gb|KHN35186.1|  Chloride channel protein CLC-d                        89.7    1e-16    
ref|XP_003610692.1|  Chloride channel protein CLC-d                   89.7    1e-16    
ref|XP_006590397.1|  PREDICTED: chloride channel protein CLC-d-li...  89.7    1e-16    
gb|KFK26402.1|  hypothetical protein AALP_AA8G244100                  89.4    2e-16    
gb|KFK26403.1|  hypothetical protein AALP_AA8G244100                  89.4    2e-16    
gb|ENN77853.1|  hypothetical protein YQE_05531                        89.4    2e-16    
ref|XP_009366954.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  89.0    2e-16    
ref|XP_006394868.1|  hypothetical protein EUTSA_v10003643mg           89.0    2e-16    
ref|XP_006394870.1|  hypothetical protein EUTSA_v10003643mg           89.0    2e-16    
ref|XP_001771383.1|  predicted protein                                89.0    2e-16    
ref|XP_006394869.1|  hypothetical protein EUTSA_v10003643mg           89.0    2e-16    
gb|AGZ89689.2|  chloride channel protein CLC-d                        88.6    3e-16    
ref|XP_006818446.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  88.6    3e-16    
ref|XP_010554105.1|  PREDICTED: chloride channel protein CLC-b-like   81.6    3e-16    
ref|XP_002872208.1|  CLC-D                                            88.6    3e-16    
ref|XP_009151133.1|  PREDICTED: chloride channel protein CLC-d is...  88.6    4e-16    
ref|XP_006573886.1|  PREDICTED: chloride channel protein CLC-d-li...  88.6    4e-16    
ref|XP_009151132.1|  PREDICTED: chloride channel protein CLC-d is...  88.6    4e-16    
ref|XP_003517583.1|  PREDICTED: chloride channel protein CLC-d-li...  88.6    4e-16    
ref|XP_006573887.1|  PREDICTED: chloride channel protein CLC-d-li...  88.6    4e-16    
ref|XP_006573885.1|  PREDICTED: chloride channel protein CLC-d-li...  88.6    4e-16    
ref|XP_002595670.1|  hypothetical protein BRAFLDRAFT_200772           88.2    4e-16    
ref|XP_006290072.1|  hypothetical protein CARUB_v10003710mg           88.2    4e-16    
ref|XP_010493890.1|  PREDICTED: chloride channel protein CLC-d-like   88.2    4e-16    
ref|XP_010766736.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  83.6    4e-16    
emb|CDY52633.1|  BnaC07g49590D                                        88.2    4e-16    
gb|AAC26247.2|  Arabidopsis thaliana CLC-d chloride channel prote...  88.2    5e-16    
emb|CAA96065.1|  CLC-d chloride channel protein                       88.2    5e-16    
ref|NP_197996.1|  chloride channel protein CLC-d                      88.2    5e-16    
ref|XP_010454978.1|  PREDICTED: chloride channel protein CLC-d is...  88.2    5e-16    
ref|XP_010454977.1|  PREDICTED: chloride channel protein CLC-d is...  87.8    5e-16    
ref|XP_002953983.1|  hypothetical protein VOLCADRAFT_40708            87.0    9e-16    
ref|XP_004140150.1|  PREDICTED: chloride channel protein CLC-d-like   87.0    1e-15    
ref|XP_004169986.1|  PREDICTED: chloride channel protein CLC-d-like   86.7    1e-15    
ref|XP_010421498.1|  PREDICTED: chloride channel protein CLC-d-li...  86.7    1e-15    
ref|XP_010421497.1|  PREDICTED: chloride channel protein CLC-d-li...  86.7    1e-15    
dbj|BAB97269.1|  chloride channel                                     86.3    2e-15    
ref|XP_010667429.1|  PREDICTED: chloride channel protein CLC-d is...  86.3    2e-15    
ref|XP_010667430.1|  PREDICTED: chloride channel protein CLC-d is...  86.3    2e-15    
ref|XP_005096600.1|  PREDICTED: H(+)/Cl(-) exchange transporter 7...  85.9    2e-15    



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   328 bits (841),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 200/212 (94%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNIT GELADVKPPVVTL G+EKVGRIV+VLKNTT+NGFPVVDEGVV
Sbjct  576  GLPFLDANPEPWMRNITAGELADVKPPVVTLCGVEKVGRIVDVLKNTTYNGFPVVDEGVV  635

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   LP+GATELHGLVLRTHLLLVLKKK+F++ERRRTEE EVREKFTWIDLAER GKIE
Sbjct  636  PP-VGLPVGATELHGLVLRTHLLLVLKKKWFLNERRRTEEWEVREKFTWIDLAERGGKIE  694

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV VTKDEMEMYVDLHPLTNTTPYTVVESLSVAKA++LFRQVGLRHM+I+PKYQAAGVSP
Sbjct  695  DVVVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQVGLRHMLIVPKYQAAGVSP  754

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRAHNILSVFPHL  SK  KKGN
Sbjct  755  VVGILTRQDLRAHNILSVFPHLEKSKSGKKGN  786



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   326 bits (836),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 198/212 (93%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNIT GELADVKPPVVTL G+EKVGRIVE LKNTT+NGFPVVDEGVV
Sbjct  576  GLPFLDANPEPWMRNITAGELADVKPPVVTLCGVEKVGRIVEALKNTTYNGFPVVDEGVV  635

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   LP+GATELHGLVLRTHLLLVLKKK+F+ ERRRTEE EVREKFTWIDLAER GKIE
Sbjct  636  PP-VGLPVGATELHGLVLRTHLLLVLKKKWFLHERRRTEEWEVREKFTWIDLAERGGKIE  694

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV VTKDEMEMYVDLHPLTNTTPYTVVESLSVAKA++LFRQVGLRHM+I+PKYQAAGVSP
Sbjct  695  DVLVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQVGLRHMLIVPKYQAAGVSP  754

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRAHNILSVFPHL  SK  KKGN
Sbjct  755  VVGILTRQDLRAHNILSVFPHLEKSKSGKKGN  786



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   326 bits (835),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 198/212 (93%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNIT GELADVKPPVVTL G+EKVGRIVE LKNTT+NGFPVVDEGVV
Sbjct  576  GLPFLDANPEPWMRNITAGELADVKPPVVTLCGVEKVGRIVEALKNTTYNGFPVVDEGVV  635

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   LP+GATELHGLVLRTHLLLVLKKK+F+ ERRRTEE EVREKFTWIDLAER GKIE
Sbjct  636  PP-VGLPVGATELHGLVLRTHLLLVLKKKWFLHERRRTEEWEVREKFTWIDLAERGGKIE  694

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV VTKDEMEMYVDLHPLTNTTPYTVVESLSVAKA++LFRQVGLRHM+I+PKYQAAGVSP
Sbjct  695  DVLVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQVGLRHMLIVPKYQAAGVSP  754

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRAHNILSVFPHL  SK  KKGN
Sbjct  755  VVGILTRQDLRAHNILSVFPHLEKSKSGKKGN  786



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 199/210 (95%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV
Sbjct  575  GLPFLDANPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   LPIGATELHG+VLRTHLLLVLKKK F+ ERRRTEE EVREKF+WIDLAERWGKIE
Sbjct  635  PP-VGLPIGATELHGIVLRTHLLLVLKKKLFLHERRRTEEWEVREKFSWIDLAERWGKIE  693

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVAVTK EMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+I+PKYQAAGVSP
Sbjct  694  DVAVTKSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSP  753

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRAHNILSVFPHL  SK  KK
Sbjct  754  VVGILTRQDLRAHNILSVFPHLVKSKSGKK  783



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   320 bits (821),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 199/210 (95%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV
Sbjct  575  GLPFLDANPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   LPIGATELHG+VLRTHLLLVLKKK F+ ERRRTEE EVREKF+WIDLAERWGKIE
Sbjct  635  PP-VGLPIGATELHGIVLRTHLLLVLKKKLFLHERRRTEEWEVREKFSWIDLAERWGKIE  693

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVAVTK EMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+I+PKYQAAGVSP
Sbjct  694  DVAVTKSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSP  753

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRAHNIL+VFPHL  SK  KK
Sbjct  754  VVGILTRQDLRAHNILTVFPHLVKSKSGKK  783



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   316 bits (809),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNITVGELADVKPPVVTL GIEKVG IVEVL+NTTHNGFPVVDEGV+
Sbjct  577  GLPFLDANPEPWMRNITVGELADVKPPVVTLHGIEKVGYIVEVLRNTTHNGFPVVDEGVM  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P      GATEL GLVLR HLLLVLK+K+F+ ERRRTEE EVREKFTW+DLAERWGKI+
Sbjct  637  AP-VGTQTGATELVGLVLRAHLLLVLKRKWFLQERRRTEEWEVREKFTWVDLAERWGKID  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV VTKDEMEMYVDLHPLTNTTPYTV+ES+S AKA++LFRQVGLRHMII+PKYQA+GVSP
Sbjct  696  DVTVTKDEMEMYVDLHPLTNTTPYTVLESMSAAKAMVLFRQVGLRHMIIIPKYQASGVSP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNILS FPHLA SKG K
Sbjct  756  VVGILTRQDLRAHNILSAFPHLAKSKGKK  784



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELAD KPPVVTLRG+EKV RIV+VL+NTTHNGFPVVDEGVV
Sbjct  579  GLPFLDANPEPWMRNLTVGELADAKPPVVTLRGVEKVARIVDVLRNTTHNGFPVVDEGVV  638

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P R  L IGATELHG+VLR HL+ VLKKK+F+ ERRRTEE EVREKFTWI+LAER GK E
Sbjct  639  P-RVGLAIGATELHGIVLRAHLVKVLKKKWFLQERRRTEEWEVREKFTWIELAEREGKFE  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT DEMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+I+PKYQAAGVSP
Sbjct  698  EVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSP  757

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRA+NIL+ FPHLA SK  +KGN
Sbjct  758  VVGILTRQDLRAYNILTAFPHLAKSKEREKGN  789



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELAD KP VVTLRG+EKV RIV+VL+NTTHNGFPVVDEGVV
Sbjct  579  GLPFLDANPEPWMRNLTVGELADAKPQVVTLRGVEKVARIVDVLRNTTHNGFPVVDEGVV  638

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P R  L IGATELHG+VLR HL+ VLKKK+F+ ERRRTEE EVREKFTWI+LAER GK E
Sbjct  639  P-RVGLAIGATELHGIVLRAHLVKVLKKKWFLQERRRTEEWEVREKFTWIELAEREGKFE  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT DEMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+I+PKYQAAGVSP
Sbjct  698  EVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSP  757

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRA+NIL+ FPHLA SK  +KGN
Sbjct  758  VVGILTRQDLRAYNILTAFPHLAKSKEREKGN  789



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMRNITVGELADVKPPVVTL GIEKV  IVEVLKNTTHNGFPVVD GV+
Sbjct  577  GLPFLDAHPEPWMRNITVGELADVKPPVVTLSGIEKVSHIVEVLKNTTHNGFPVVDAGVI  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP  + P GATELHGLVLR HL+LVLKKK+F+ E+RRT+E EVREKFT IDLAER GKIE
Sbjct  637  PPMGS-PNGATELHGLVLRAHLILVLKKKWFLQEKRRTQEWEVREKFTSIDLAERGGKIE  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +V VTKDEMEMYVDLHPL+NTTPYTVVES+SVAKA++LFRQVGLRHM+ILPKYQAAGV P
Sbjct  696  EVTVTKDEMEMYVDLHPLSNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVYP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRAHNILS  P L  S GSKKG+
Sbjct  756  VVGILTRQDLRAHNILSALPQLKKSNGSKKGH  787



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 188/212 (89%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMRNITVGELADVKP VVTL GIEKV  IVEVLKNTTHNGFPVVD GV 
Sbjct  577  GLPFLDAHPEPWMRNITVGELADVKPAVVTLNGIEKVRNIVEVLKNTTHNGFPVVDSGVT  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP T  P GATELHGL+LR HL+L LKKK+F  ERRRTEE EVREKFT IDLAER   IE
Sbjct  637  PP-TGSPNGATELHGLILRAHLILALKKKWFQQERRRTEEWEVREKFTSIDLAERGATIE  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +V VTKDEMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+ILPKYQAAGVSP
Sbjct  696  EVTVTKDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVSP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL AHNILS FPHL  SKG+KKG+
Sbjct  756  VVGILTRQDLIAHNILSAFPHLERSKGNKKGH  787



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMR++TVGELADVKPPVVTL G+EKV R+VEVLKNTTHNGFPVV EGVV
Sbjct  579  GLPFLDANPEPWMRDLTVGELADVKPPVVTLCGVEKVSRVVEVLKNTTHNGFPVV-EGVV  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L    TELHGL+LR HL+ V+KKK+F+ ERRRTE+ EVRE+F+WIDLAER GKIE
Sbjct  638  PP-AGLITSTTELHGLILRAHLVQVIKKKWFLQERRRTEDWEVRERFSWIDLAEREGKIE  696

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT+DEMEMYVDLHP TNTTPYTVVES+SVAKA++LFRQVGLRHM+ILPKYQAAGVSP
Sbjct  697  EVAVTRDEMEMYVDLHPFTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVSP  756

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVG+LTRQDLRA+NIL+ FPHLA SKG + G+
Sbjct  757  VVGVLTRQDLRAYNILAAFPHLAKSKGMEGGH  788



>gb|KDO43321.1| hypothetical protein CISIN_1g0039662mg [Citrus sinensis]
Length=447

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMR +TVGEL D KPPV+TL GIEKV +IV+VL+NTTHNGFPV+DEGVV
Sbjct  238  GLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVV  297

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP + L   ATELHGL+LR HL+L LKKK+F+ E+RRTEE EVREKF+W++LAER GKIE
Sbjct  298  PP-SGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIE  356

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEMY+DLHPLTNTTPYTV+ES+SVAKA++LFRQVGLRH++++PKY+AAGVSP
Sbjct  357  EVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSP  416

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA NIL+ FPHL  SK  +K
Sbjct  417  VVGILTRQDLRAFNILTAFPHLERSKSGQK  446



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score =   297 bits (761),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 183/212 (86%), Gaps = 11/212 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AHPE WMRNITVGELADVKPPVVTL GIEKV RIVEVLK TTHNGFPVVD GV+
Sbjct  574  GLPFLEAHPEAWMRNITVGELADVKPPVVTLEGIEKVRRIVEVLKYTTHNGFPVVD-GVI  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    L +          RTHLLLVLKKK+F++ERRRTE+ EV EKFTWIDLAERWGKIE
Sbjct  633  PELHGLVL----------RTHLLLVLKKKWFLNERRRTEDWEVEEKFTWIDLAERWGKIE  682

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+AVTKDEMEMYVDLHPL NTTP+TVVESLSVAKA++ FRQVGLRHMII+PKYQAAGV P
Sbjct  683  DIAVTKDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAFRQVGLRHMIIVPKYQAAGVFP  742

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRA NIL+VFPHLA SK  KKGN
Sbjct  743  VVGILTRQDLRACNILNVFPHLAKSKSIKKGN  774



>ref|XP_006447085.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 gb|ESR60325.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=605

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMR +TVGEL D KPPV+T+ GIEKV RIV+VL+NTTHNGFPV+DEGVV
Sbjct  396  GLPFLDAHPEPWMRTLTVGELVDAKPPVITVSGIEKVSRIVDVLRNTTHNGFPVLDEGVV  455

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP + L  GATELHGL+LR HL+L LKKK+F+ E+RRTEE EVREKF+W++LAER GKIE
Sbjct  456  PP-SGLANGATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIE  514

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT  EMEMY+DLHPLTNTTPYTV+ES+SVAKA++LFRQVGLRH++++PKY+AAGVSP
Sbjct  515  EVAVTSAEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSP  574

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA NIL+ FPHL  SK  +K
Sbjct  575  VVGILTRQDLRAFNILTAFPHLERSKSGQK  604



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELAD KPP+VTL G+EKV RIV+VLKNTT+NGFPVVD+GV+
Sbjct  577  GLPFLDANPEPWMRNLTVGELADAKPPLVTLCGVEKVSRIVDVLKNTTYNGFPVVDDGVI  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L  GATELHGL+LR HL+  +KKK+F+ E+RRTEE EVR+KFTW+DLAER  KIE
Sbjct  637  PP-VGLATGATELHGLILRAHLVQAIKKKWFLREKRRTEEWEVRQKFTWVDLAERELKIE  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT+DEMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRH++I+PKY+A+GV P
Sbjct  696  EVAVTRDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYEASGVPP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA+NILS FPHLA SK  +K
Sbjct  756  VVGILTRQDLRAYNILSAFPHLARSKDREK  785



>ref|XP_007031847.1| Chloride channel B isoform 1 [Theobroma cacao]
 ref|XP_007031849.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02773.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02775.1| Chloride channel B isoform 1 [Theobroma cacao]
Length=606

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVG+LAD KPPVVTL G+EKV RIV+VLKNTTHN FP+VD+GV+
Sbjct  396  GLPFLDANPEPWMRNLTVGDLADAKPPVVTLCGVEKVSRIVDVLKNTTHNAFPIVDQGVL  455

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T +  GATELHGL+LR HL+  LKKK+FM E+RRTEE EVREKF W+DLAER  KIE
Sbjct  456  VPGT-ISTGATELHGLILRAHLVQALKKKWFMPEKRRTEEWEVREKFNWVDLAERELKIE  514

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAVT+DEMEMY DLHPLTNTTPYTVVES+SVAKA++LFRQVGLRH++I+PKYQ AGV+P
Sbjct  515  QVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQGAGVTP  574

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA+NIL+ FPHLA  KG +K
Sbjct  575  VVGILTRQDLRAYNILTAFPHLARCKGEEK  604



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 189/212 (89%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMRN+TVGELAD K PVVTLRGIEKV RIVEVL+NTTHNGFPV+D+GVV
Sbjct  581  GLPFLDAHPEPWMRNLTVGELADAKLPVVTLRGIEKVERIVEVLRNTTHNGFPVIDDGVV  640

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L +GATE+HGL+LR HL+ VLKKK+F  E+RRTEE EVREKFTW++LAER GKIE
Sbjct  641  PP-VGLAVGATEVHGLILRAHLVHVLKKKWFQREKRRTEEWEVREKFTWVELAEREGKIE  699

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEMYVDLHPLTNTTPYTV+ES+SVAKA++LFRQ+GLRH++I+PKY AAGV P
Sbjct  700  EVAVTSEEMEMYVDLHPLTNTTPYTVMESMSVAKAMVLFRQLGLRHLLIVPKYVAAGVPP  759

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL A+NIL+ FPHL  +   +KGN
Sbjct  760  VVGILTRQDLIAYNILNAFPHLTKATSREKGN  791



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMRN+ VGELAD KPPVVTLRGIEKV RIVEVL+NTTHNGFPVVD+G+V
Sbjct  580  GLPFLDAHPEPWMRNLNVGELADAKPPVVTLRGIEKVERIVEVLRNTTHNGFPVVDDGIV  639

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L +GATELHGL+LR HL+ VLKKK+F+ ERRRTEE EVREKFT ++LAER  KIE
Sbjct  640  PP-VGLAVGATELHGLILRAHLVQVLKKKWFLKERRRTEEWEVREKFTAVELAERELKIE  698

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT DEMEMYVDLHPLTNTTP+TV+E++SVAKA++LFRQVGLRH++ILPKY+AAGV P
Sbjct  699  EVAVTSDEMEMYVDLHPLTNTTPHTVLETMSVAKAMVLFRQVGLRHLLILPKYEAAGVPP  758

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL A+NIL+ FPHL N K  +KGN
Sbjct  759  VVGILTRQDLIAYNILNAFPHLKNPKSREKGN  790



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TV ELAD KPPVVTL G+EKV RIVEVL+NTTHNGFPVVDEGVV
Sbjct  575  GLPFLDANPEPWMRNLTVAELADAKPPVVTLCGVEKVSRIVEVLENTTHNGFPVVDEGVV  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    L  GATELHGL+LR HL+ VLKKK+F+ E+RRTEE EVREKF W++LAER G IE
Sbjct  635  P-LMGLATGATELHGLILRAHLVQVLKKKWFLPEKRRTEEWEVREKFDWVELAERDGTIE  693

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT++EMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+ILPKYQAAGV P
Sbjct  694  EVAVTRNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVPP  753

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRAHNIL  FPHL  SK  +K
Sbjct  754  VVGILTRQDLRAHNILLAFPHLQGSKSREK  783



>gb|KDO43317.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43318.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43319.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43320.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
Length=595

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMR +TVGEL D KPPV+TL GIEKV +IV+VL+NTTHNGFPV+DEGVV
Sbjct  386  GLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQIVDVLRNTTHNGFPVLDEGVV  445

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP + L   ATELHGL+LR HL+L LKKK+F+ E+RRTEE EVREKF+W++LAER GKIE
Sbjct  446  PP-SGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIE  504

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEMY+DLHPLTNTTPYTV+ES+SVAKA++LFRQVGLRH++++PKY+AAGVSP
Sbjct  505  EVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSP  564

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA NIL+ FPHL  SK  +K
Sbjct  565  VVGILTRQDLRAFNILTAFPHLERSKSGQK  594



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMR +TVGEL D KPPV+T+ GIEKV RIV+VL+NTTHNGFPV+DEGVV
Sbjct  574  GLPFLDAHPEPWMRTLTVGELVDAKPPVITVSGIEKVSRIVDVLRNTTHNGFPVLDEGVV  633

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP + L  GATELHGL+LR HL+L LKKK+F+ E+RRTEE EVREKF+W++LAER GKIE
Sbjct  634  PP-SGLANGATELHGLILRAHLVLALKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIE  692

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT  EMEMY+DLHPLTNTTPYTV+ES+SVAKA++LFRQVGLRH++++PKY+AAGVSP
Sbjct  693  EVAVTSAEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSP  752

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA NIL+ FPHL  SK  +K
Sbjct  753  VVGILTRQDLRAFNILTAFPHLERSKSGQK  782



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   291 bits (746),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 188/212 (89%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMRN+TVGELAD K PVVTLRGIE V RIVEVL+NTTHNGFPV+D+GVV
Sbjct  581  GLPFLDAHPEPWMRNLTVGELADAKLPVVTLRGIETVERIVEVLRNTTHNGFPVIDDGVV  640

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L +GATE+HGL+LR HL+ VLKKK+F  E+RRTEE EVREKFTW++LAER GKIE
Sbjct  641  PP-VGLAVGATEVHGLILRAHLVHVLKKKWFQREKRRTEEWEVREKFTWVELAEREGKIE  699

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEMYVDLHPLTNTTPYTV+ES+SVAKA++LFRQ+GLRH++I+PKY+AAGV P
Sbjct  700  EVAVTSEEMEMYVDLHPLTNTTPYTVMESMSVAKAMVLFRQLGLRHLLIVPKYEAAGVPP  759

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL A+NIL+ FPHL      +KGN
Sbjct  760  VVGILTRQDLIAYNILNAFPHLTKPTSREKGN  791



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVG+LAD KPPVVTL G+EKV RIV+VLKNTTHN FP+VD+GV+
Sbjct  577  GLPFLDANPEPWMRNLTVGDLADAKPPVVTLCGVEKVSRIVDVLKNTTHNAFPIVDQGVL  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T +  GATELHGL+LR HL+  LKKK+FM E+RRTEE EVREKF W+DLAER  KIE
Sbjct  637  VPGT-ISTGATELHGLILRAHLVQALKKKWFMPEKRRTEEWEVREKFNWVDLAERELKIE  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAVT+DEMEMY DLHPLTNTTPYTVVES+SVAKA++LFRQVGLRH++I+PKYQ AGV+P
Sbjct  696  QVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQGAGVTP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA+NIL+ FPHLA  KG +K
Sbjct  756  VVGILTRQDLRAYNILTAFPHLARCKGEEK  785



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNITVGELAD KP VVTLRG+EKV RIVEVL+NTTHNGFPVVD   V
Sbjct  578  GLPFLDANPEPWMRNITVGELADAKPAVVTLRGLEKVSRIVEVLRNTTHNGFPVVDADAV  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P   + +GATELHGLVLR HLL VLKKK+F+ ERRRTE+ EVREKFTW++LAER GKIE
Sbjct  638  VPPVGMAVGATELHGLVLRAHLLQVLKKKWFLRERRRTEDWEVREKFTWVELAEREGKIE  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            ++ VTK+EMEMYVDLHPLTNTTPYTV+ES+SVAKAL+LFRQVGLRH++I+PKY+AAGV P
Sbjct  698  ELVVTKEEMEMYVDLHPLTNTTPYTVLESMSVAKALVLFRQVGLRHLLIVPKYEAAGVPP  757

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDLR +NILS FP LA  KG++K N
Sbjct  758  VIGILTRQDLRPYNILSAFPDLARIKGNEKRN  789



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNITVGELAD KP VV LRG+EKV RIVEVL+NTTHNGFPVVD   V
Sbjct  578  GLPFLDANPEPWMRNITVGELADAKPAVVILRGLEKVSRIVEVLRNTTHNGFPVVDADSV  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P   + +GATELHGLVLR HLL VLKKK+F+ ERRRTEE EVREKFTW++LAER GKIE
Sbjct  638  VPPVGMAVGATELHGLVLRAHLLQVLKKKWFLRERRRTEEWEVREKFTWVELAEREGKIE  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            ++ VTK+EMEMYVDLHPLTNTTPYTV+ES+SVAKAL+LFRQVGLRH++I+PKY+AAGV P
Sbjct  698  ELVVTKEEMEMYVDLHPLTNTTPYTVMESMSVAKALVLFRQVGLRHLLIVPKYEAAGVPP  757

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDLR +NILS FP LA +KG++K N
Sbjct  758  VIGILTRQDLRPYNILSAFPDLARTKGNEKRN  789



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TV ELAD KPPVVTL  +EKV RIVEVL+NTTHNGFPVVDEGVV
Sbjct  575  GLPFLDANPEPWMRNLTVAELADAKPPVVTLCAVEKVSRIVEVLENTTHNGFPVVDEGVV  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    L  GATELHGL+LR HL+ VLKKK+F+ E+RRTEE EVREKF W++LAER G IE
Sbjct  635  P-LMGLATGATELHGLILRAHLVQVLKKKWFLPEKRRTEEWEVREKFDWVELAERDGTIE  693

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT++EMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+ILPKYQAAGV P
Sbjct  694  EVAVTRNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVPP  753

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRAHNIL  FPHL  SK  +K
Sbjct  754  VVGILTRQDLRAHNILLAFPHLQGSKNREK  783



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score =   289 bits (739),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 179/212 (84%), Gaps = 11/212 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AHPE WMRNI VGEL+DVK PVVTL GIEKV RIVEVLK TTHNGFPVVD GV+
Sbjct  563  GLPFLEAHPEAWMRNIIVGELSDVKSPVVTLEGIEKVRRIVEVLKYTTHNGFPVVD-GVI  621

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    L +          RTHLLLVLKKK+F++ERRRTE  EV EKFTWIDLAERWGKIE
Sbjct  622  PELHGLVL----------RTHLLLVLKKKWFLNERRRTENWEVEEKFTWIDLAERWGKIE  671

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+AVTKDEMEMYVDLHPL NTTP+TVVESLSVAKA++ FRQVGLRHMII+PKYQAAGV P
Sbjct  672  DIAVTKDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAFRQVGLRHMIIVPKYQAAGVFP  731

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDLRA NIL+V PHLA SK  KKGN
Sbjct  732  VVGILTRQDLRACNILNVIPHLAKSKSIKKGN  763



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP VVTL G+EKV +IV+VLKNTTHN FPV+D+GVV
Sbjct  562  GLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGVEKVAKIVDVLKNTTHNAFPVMDDGVV  621

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP      G TELHGL+LR HL+  LKKK+F+ ERRRTEE EVREKFTW++LAER G IE
Sbjct  622  PPVVGQANGGTELHGLILRAHLIQALKKKWFLKERRRTEEWEVREKFTWVELAEREGSIE  681

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFRQVGLRH++++PKYQA+GVSP
Sbjct  682  EVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVSP  741

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDL AHNIL+VFPHLA SKG +K N
Sbjct  742  VIGILTRQDLLAHNILTVFPHLAISKGREKRN  773



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP VVTL G+EKV +IV+VLKNTTHN FPV+D+GVV
Sbjct  579  GLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGVEKVAKIVDVLKNTTHNAFPVMDDGVV  638

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP      G TELHGL+LR HL+  LKKK+F+ ERRRTEE EVREKFTW++LAER G IE
Sbjct  639  PPVVGQANGGTELHGLILRAHLIQALKKKWFLKERRRTEEWEVREKFTWVELAEREGSIE  698

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFRQVGLRH++++PKYQA+GVSP
Sbjct  699  EVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVSP  758

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDL AHNIL+VFPHLA SKG +K N
Sbjct  759  VIGILTRQDLLAHNILTVFPHLAISKGREKRN  790



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP VVTL G+EKV +IV+VLKNTTHN FPV+D+GVV
Sbjct  569  GLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGVEKVAKIVDVLKNTTHNAFPVMDDGVV  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP      G TELHGL+LR HL+  LKKK+F+ ERRRTEE EVREKFTW++LAER G IE
Sbjct  629  PPVVGQANGGTELHGLILRAHLIQALKKKWFLKERRRTEEWEVREKFTWVELAEREGSIE  688

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFRQVGLRH++++PKYQA+GVSP
Sbjct  689  EVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVSP  748

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDL AHNIL+VFPHLA SKG +K N
Sbjct  749  VIGILTRQDLLAHNILTVFPHLAISKGREKRN  780



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   286 bits (733),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKPPVVTL G+EKV +IV+VLKNTTHN FPV+D GVV
Sbjct  563  GLPFIDANPEPWMRNLTVGELVDVKPPVVTLHGVEKVAKIVDVLKNTTHNAFPVMDNGVV  622

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP      G TELHGL+LR HL+  +KKK+F+ ERRRTEE EVREKFTW++LAER G IE
Sbjct  623  PPVVGQANGGTELHGLILRAHLIQAIKKKWFLKERRRTEEWEVREKFTWVELAEREGSIE  682

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT +EMEM+VDLHPLTNTTP+TV+ES+SVAKA+ LFRQVGLRH++++PKYQA+G+SP
Sbjct  683  EVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMTLFRQVGLRHLLVVPKYQASGISP  742

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDL A NIL+VFPHLA SKG +K N
Sbjct  743  VIGILTRQDLLAQNILTVFPHLAKSKGREKTN  774



>ref|XP_008341308.1| PREDICTED: chloride channel protein CLC-b [Malus domestica]
Length=283

 Score =   271 bits (694),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 186/212 (88%), Gaps = 3/212 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AHPEPWMRN+TVGELAD K PVVTLRGIEKV RIVEVL+NTTHNGFPVV EGVV
Sbjct  75   GLPFLEAHPEPWMRNLTVGELADAKXPVVTLRGIEKVDRIVEVLRNTTHNGFPVV-EGVV  133

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L +GAT +HGL+LR HLL VLKKK+F+ E+RRTEE +VREKFT ++LAER  KIE
Sbjct  134  PP-MGLAVGAT-VHGLILRAHLLQVLKKKWFLREKRRTEEWKVREKFTSVELAEREWKIE  191

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVTKDEMEMYVDLHPLTN TPYTV+E +SVAKA++LFRQVGLRH++++P Y+A+ V P
Sbjct  192  EVAVTKDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLVVPNYEASQVPP  251

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL A+NIL+ FPHLA S G +KG+
Sbjct  252  VVGILTRQDLIAYNILNAFPHLAKSAGREKGS  283



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 187/212 (88%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AHPE WMRN+TVGELAD KPPVVTLRGIEKV RIVEVL+NTTHNGFPVVDEGVV
Sbjct  577  GLPFLEAHPEQWMRNLTVGELADAKPPVVTLRGIEKVDRIVEVLRNTTHNGFPVVDEGVV  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L +GATE+HGL+LR HLL VLKKK+F+ E+RRTEE EVREKFT ++LAER GKIE
Sbjct  637  PP-MGLAVGATEVHGLILRAHLLQVLKKKWFLREKRRTEEWEVREKFTSVELAEREGKIE  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAV  DEMEMYVDLHPLTN TPYTV+E +SVAKA++LFRQVGLRH++++P Y+A+ + P
Sbjct  696  EVAVKSDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLVVPNYEASRLPP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL A+NIL+ FPHLA S G +KGN
Sbjct  756  VVGILTRQDLIAYNILNAFPHLAKSAGREKGN  787



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 183/204 (90%), Gaps = 1/204 (0%)
 Frame = -1

Query  759  PEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVVPPRTALPI  580
            P    +N+TVGELAD KPPVVTLRG+EKV RIV+VL+NTTHNGFPVVDEGVVP R  L I
Sbjct  551  PPNSQKNLTVGELADAKPPVVTLRGVEKVARIVDVLRNTTHNGFPVVDEGVVP-RVGLAI  609

Query  579  GATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIEDVAVTKDE  400
            GATELHG+VLR HL+ VLKKK+F+ ERRRTEE EVREKFTWI+LAER GK E+VAVT DE
Sbjct  610  GATELHGIVLRAHLVKVLKKKWFLQERRRTEEWEVREKFTWIELAEREGKFEEVAVTNDE  669

Query  399  MEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSPVVGILTRQ  220
            MEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+I+PKYQAAGVSPVVGILTRQ
Sbjct  670  MEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTRQ  729

Query  219  DLRAHNILSVFPHLANSKGSKKGN  148
            DLRA+NIL+ FPHLA SK  +KGN
Sbjct  730  DLRAYNILTAFPHLAKSKEREKGN  753



>gb|KHG13135.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=717

 Score =   282 bits (721),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 185/208 (89%), Gaps = 1/208 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELADVKPPVVTL G+EKV RI++VL+NTTHN FP+VD+GV+
Sbjct  511  GLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRIMDVLRNTTHNAFPIVDQGVL  570

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T +  GATELHGL+LR HL+  LKKK+F+ E+RRTEE EVREKF W++LAER  KIE
Sbjct  571  VPGT-VATGATELHGLILRAHLVQALKKKWFLPEKRRTEEWEVREKFNWVELAERELKIE  629

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAVT+DEMEMYVDLHPLTNTTP+TVVES+SVAKAL+LFRQVGLRH++I+PKYQ AGV+P
Sbjct  630  QVAVTRDEMEMYVDLHPLTNTTPFTVVESMSVAKALVLFRQVGLRHLLIVPKYQGAGVAP  689

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGS  160
            VVGILTRQDLRA+NILS FPHL   K S
Sbjct  690  VVGILTRQDLRAYNILSAFPHLERPKLS  717



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PE WMRN+TVGEL DVKP V++L+G+EKV +IV+VLKNTTHNGFPV+D+GVV
Sbjct  586  GLPFMDANPESWMRNLTVGELVDVKPAVISLQGVEKVSKIVDVLKNTTHNGFPVMDDGVV  645

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   +  GATELHGL+LR HL+  LKK++F+ ERRRTEE EVREKFTW++LAER GKIE
Sbjct  646  PPVGQVN-GATELHGLILRAHLIQALKKRFFLKERRRTEEWEVREKFTWVELAEREGKIE  704

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VA+T++EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFRQVGLRH++++PKYQA+GV P
Sbjct  705  EVAITREEMEMFVDLHPLTNTTPFTVLESISVAKAMILFRQVGLRHLLVVPKYQASGVCP  764

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDL A+NIL+VFPHLA SK  +K N
Sbjct  765  VIGILTRQDLLAYNILTVFPHLAKSKNRQKRN  796



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELADVKPPVVTL G+EKV RIV+VL+NTTHN FP+VD+GV 
Sbjct  579  GLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRIVDVLRNTTHNAFPIVDQGV-  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    +  GATELHGL+LR HL+  LKKK+F+ E+RRTEE EVREKF W++LAER  KIE
Sbjct  638  PVPGMVATGATELHGLILRAHLVQALKKKWFLPEKRRTEEWEVREKFNWVELAEREIKIE  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAVT+DEMEMYVDLHPLTNTTP+TVVESLSVAKAL+LFRQVGLRH++I+PKYQ AGV+P
Sbjct  698  QVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQVGLRHLLIVPKYQGAGVAP  757

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGS  160
            VVGILTRQDLRA+NILS FPHL   K S
Sbjct  758  VVGILTRQDLRAYNILSAFPHLERPKLS  785



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELADVKPPVVTL G+EKV RIV+VL+NTTHN FP+VD+GV 
Sbjct  579  GLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRIVDVLRNTTHNAFPIVDQGV-  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    +  GATELHGL+LR HL+  LKKK+F+ E+RRTEE EVREKF W++LAER  KIE
Sbjct  638  PVPGMVATGATELHGLILRAHLVQALKKKWFLPEKRRTEEWEVREKFNWVELAEREIKIE  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAVT+DEMEMYVDLHPLTNTTP+TVVESLSVAKAL+LFRQVGLRH++I+PKYQ AGV+P
Sbjct  698  QVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQVGLRHLLIVPKYQGAGVTP  757

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGS  160
            VVGILTRQDLRA+NILS FPHL   K S
Sbjct  758  VVGILTRQDLRAYNILSAFPHLERPKLS  785



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNIT GELAD KP +VTL G+EKVGRIVEVLKNTT+NGFPVVD GV 
Sbjct  577  GLPFLDANPEPWMRNITAGELADAKPAIVTLNGVEKVGRIVEVLKNTTYNGFPVVDCGVT  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                + P GA ELHGL+LR HLLLVLKKK F+ ERRRT+E EV EKFT +DLAER   IE
Sbjct  637  TSMGSSPNGANELHGLILRAHLLLVLKKKLFLKERRRTQEWEVIEKFTCMDLAERGATIE  696

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +V V+KDEMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQ+ LRHM+ILPKYQAAGVSP
Sbjct  697  EVTVSKDEMEMYVDLHPLTNTTPYTVVESISVAKAMVLFRQLALRHMLILPKYQAAGVSP  756

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL AHNILS FPHL  SK +KKG+
Sbjct  757  VVGILTRQDLIAHNILSAFPHLEKSKANKKGH  788



>ref|XP_010556277.1| PREDICTED: chloride channel protein CLC-b [Tarenaya hassleriana]
Length=653

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 182/209 (87%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELAD KPPVVTL G+EKV  IV+VLKNTTHN FPV+D+  V
Sbjct  444  GLPFLDANPEPWMRNLTVGELADAKPPVVTLHGVEKVANIVDVLKNTTHNAFPVLDDADV  503

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F+SE+RRTE+ EVREKFTW++LAER    E
Sbjct  504  P-QVGLADGATELHGLILRAHLIKVLKKRWFLSEKRRTEDWEVREKFTWVELAEREDNFE  562

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT  +M+MYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRH++I+PK QAAG+SP
Sbjct  563  EVAVTSADMQMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKIQAAGMSP  622

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL  SKG K
Sbjct  623  VLGILTRQDLRAYNILQAFPHLEKSKGGK  651



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP VV+ +G+EKV  IV  LKNTTHNGFPV+D G+V
Sbjct  577  GLPFMDANPEPWMRNLTVGELVDVKPAVVSFKGVEKVANIVNALKNTTHNGFPVMDCGLV  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P  T +   ATELHG++LR HL+ VLKKK+F+ ERRRTEE EVREKFTW++LAER G IE
Sbjct  637  PT-TGVANEATELHGIILRAHLIQVLKKKWFLKERRRTEEWEVREKFTWVELAEREGNIE  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVAVTK+EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFRQVGLRHM+++PKYQA+GVSP
Sbjct  696  DVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLFRQVGLRHMLVVPKYQASGVSP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            V+GILTRQDL A+NIL+VFPHLA SK
Sbjct  756  VIGILTRQDLLAYNILTVFPHLAKSK  781



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 177/211 (84%), Gaps = 8/211 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDAHPEPWMRNITVGELAD K  VVT+ GIEKVGRIV+VL+NTTHNGFPVVD GVV
Sbjct  580  GLPFLDAHPEPWMRNITVGELADAKSAVVTIEGIEKVGRIVDVLRNTTHNGFPVVDAGVV  639

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP         ELHGLVLR HL+L LKKK+F+ ERRRT+  EVRE FT  DLAER GKIE
Sbjct  640  PP--------NELHGLVLRAHLILALKKKWFLRERRRTKAEEVREIFTSADLAERGGKIE  691

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV V+ DEMEM+VDL+PL NTTPY+V+ES+SVAKA++LFR+VGLRHM+ILPKYQA+GV+P
Sbjct  692  DVIVSDDEMEMFVDLYPLINTTPYSVIESMSVAKAMVLFREVGLRHMLILPKYQASGVAP  751

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKG  151
            VVGILTRQDL AHNIL  FP L  S  SKKG
Sbjct  752  VVGILTRQDLIAHNILCAFPQLEKSNASKKG  782



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP VV+ +G+EKV  IV  LKNTTHNGFPV+D G+V
Sbjct  577  GLPFMDANPEPWMRNLTVGELVDVKPAVVSFKGVEKVANIVNALKNTTHNGFPVMDCGLV  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P  T +   ATELHG++LR HL+ V KKK+F+ ERRRTEE EVREKFTW++LAER G IE
Sbjct  637  PT-TGVANEATELHGIILRAHLIQVRKKKWFLKERRRTEEWEVREKFTWVELAEREGNIE  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVAVTK+EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFRQVGLRHM+++PKYQA+GVSP
Sbjct  696  DVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLFRQVGLRHMLVVPKYQASGVSP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            V+GILTRQDL A+NIL+VFPHLA SK
Sbjct  756  VIGILTRQDLLAYNILTVFPHLAKSK  781



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   275 bits (704),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 189/212 (89%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TV ELAD KPPVVTL G+EKV R+VEVLKNTTHNGFPVVD+  V
Sbjct  578  GLPFLDANPEPWMRNLTVAELADAKPPVVTLHGVEKVSRVVEVLKNTTHNGFPVVDD-GV  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P   LPI ATELHGL+LRTHL+ VLKKK+F+SE+RRTEE EVREKFT +DLAER G IE
Sbjct  637  VPPVGLPIEATELHGLILRTHLVQVLKKKWFLSEKRRTEEWEVREKFTSVDLAEREGTIE  696

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +V VT+DEM+MY+DLHPLTNTTPYTVVES+SVAKA++LFR VGLRHM+I+PKY+AAGV P
Sbjct  697  EVVVTRDEMDMYIDLHPLTNTTPYTVVESMSVAKAMVLFRAVGLRHMLIVPKYEAAGVPP  756

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            +VGILTRQDLRAHNILS FPHLA SK  +KG+
Sbjct  757  IVGILTRQDLRAHNILSAFPHLARSKSREKGH  788



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP V++ +G+EKV  IV  LKNTTHNGFPV+D GVV
Sbjct  576  GLPFMDANPEPWMRNLTVGELVDVKPAVISFKGVEKVANIVNALKNTTHNGFPVMDCGVV  635

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    +   ATELHG++LR HL+ VLKKK+F+ E+RRTE+ EVREKFTW++LAER G IE
Sbjct  636  PT-IGVASEATELHGIILRAHLIQVLKKKWFLKEKRRTEDWEVREKFTWVELAEREGNIE  694

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVAVTK+EMEM+VDLHPLTNTTP+TV+ES+SVAKAL+LFRQVGLRHM+++PKYQA+GVSP
Sbjct  695  DVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKALVLFRQVGLRHMLVVPKYQASGVSP  754

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            V+GILTRQDL A+NIL+VFPHL  SK
Sbjct  755  VIGILTRQDLLAYNILTVFPHLTKSK  780



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   273 bits (699),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 185/212 (87%), Gaps = 2/212 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AHPEPWMRN+TVGELA  KPPVVTL GIEKV RIVEVL+NTTHNGFPVV+E VV
Sbjct  581  GLPFLEAHPEPWMRNLTVGELAXAKPPVVTLXGIEKVDRIVEVLRNTTHNGFPVVEE-VV  639

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L +GAT +HGL+LR HL+ VLKKK+F+ E+RRTEE EVREKFT ++LAE   KIE
Sbjct  640  PP-MGLAVGATXVHGLILRAHLVQVLKKKWFLREKRRTEEWEVREKFTSVELAEXEAKIE  698

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VAVT+DEMEMYVDLHPLTN TPYTV+E +SVAKA++LFRQVGLRH++I+PKY+A+GV P
Sbjct  699  EVAVTRDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLIVPKYEASGVPP  758

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            +VGILTRQDL A+NIL+ FPHL  S G +KGN
Sbjct  759  LVGILTRQDLIAYNILNAFPHLTKSAGREKGN  790



>gb|KHF97413.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=721

 Score =   272 bits (695),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 180/210 (86%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELA+ K P VTL G+EKV RIV+VLKNTTHN FP+VD+ V 
Sbjct  511  GLPFLDANPEPWMRNLTVGELANAKSPAVTLSGVEKVSRIVDVLKNTTHNAFPIVDQDVP  570

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T +  GATELHGL+LR HL+  LKKK+F++E+RRT++ EV++KF W++L+ER  KIE
Sbjct  571  VPGTVI-TGATELHGLILRAHLVQALKKKWFLAEKRRTDDWEVQKKFNWVELSERELKIE  629

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAV  DEMEMY+DLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+I+PKYQ AGV  
Sbjct  630  QVAVAHDEMEMYIDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQGAGVPA  689

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA+NIL+VFPHLA  K  +K
Sbjct  690  VVGILTRQDLRAYNILTVFPHLATHKVQQK  719



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 181/210 (86%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELA+ K P VTL G+EKV RIV+VLKNTTHN FP+VD+ V+
Sbjct  578  GLPFLDANPEPWMRNLTVGELANAKSPAVTLSGVEKVSRIVDVLKNTTHNAFPIVDQDVL  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T +  GATELHGL+LR HL+  LKKK+F++E+RRTE+ EV+EKF W++L+ER  KIE
Sbjct  638  VPGTVVT-GATELHGLILRAHLVQALKKKWFLAEKRRTEDWEVQEKFNWVELSERELKIE  696

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAVT DEMEMY+DLHPLTNTTPYTVVES+SVAKA++LFRQVGLRHM+I+PKYQ AGV  
Sbjct  697  QVAVTHDEMEMYMDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQGAGVPA  756

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            VVGILTRQDLRA+NI +VFPHLA  K  +K
Sbjct  757  VVGILTRQDLRAYNISTVFPHLATHKEQQK  786



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNI+VGELADVKPP+V+LRG+EKV RIV+VLKNTTHNGFPV+D+ V 
Sbjct  594  GLPFLDANPEPWMRNISVGELADVKPPLVSLRGLEKVSRIVDVLKNTTHNGFPVIDDDVT  653

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T+    A ELHGL+LR HL+ VLKKK+F+ + R+TEE EVREKFTW++LAER    E
Sbjct  654  IP-TSDGTKARELHGLILRAHLVAVLKKKWFLEQPRKTEEWEVREKFTWVELAERDLDFE  712

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VA++K EMEMYVDLHP TN TPYTVVE +S AKA++LFRQV LRH++I+PKYQ AG+ P
Sbjct  713  QVAISKREMEMYVDLHPFTNKTPYTVVEDMSAAKAMVLFRQVALRHLLIVPKYQGAGIYP  772

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V+GILTRQDLRAHNI +VFPH+A SKG +K N
Sbjct  773  VIGILTRQDLRAHNIQTVFPHIAKSKGREKQN  804



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 180/209 (86%), Gaps = 0/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  V
Sbjct  573  GLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKIVDVLRNTTHNAFPVLDEAEV  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP+  L  GA ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  633  PPQMGLGTGAIELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  692

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+P+ QA+G SP
Sbjct  693  DVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPRIQASGRSP  752

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL  SKG K
Sbjct  753  VIGILTRQDLRAYNILQAFPHLEKSKGRK  781



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 179/209 (86%), Gaps = 0/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  V
Sbjct  573  GLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKIVDVLRNTTHNAFPVLDEAEV  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP+  L  GA ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  633  PPQVGLGTGAIELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  692

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+P+ QA+G SP
Sbjct  693  DVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPRIQASGRSP  752

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA NIL  FPHL  SKG K
Sbjct  753  VVGILTRQDLRACNILQAFPHLEKSKGRK  781



>gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 185/212 (87%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELAD KPPVVTL G+EKV RIV+VLKNTTHN FPVVD+  V
Sbjct  578  GLPFLDANPEPWMRNLTVGELADAKPPVVTLCGVEKVSRIVDVLKNTTHNAFPVVDD-GV  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P   L  GATELHGL+LR HL+ V+KKK+F+ E+RRTEE E REKF+W+DLAER GKIE
Sbjct  637  VPPVGLAAGATELHGLILRAHLVQVIKKKWFLHEKRRTEEWEAREKFSWVDLAEREGKIE  696

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +V VT+ EMEM+VDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRH++I+PKYQAAGV P
Sbjct  697  EVPVTRAEMEMFVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQAAGVPP  756

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            VVGILTRQDL A+NIL+ FPHLA +K  +K N
Sbjct  757  VVGILTRQDLMAYNILTAFPHLARTKSREKHN  788



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 180/209 (86%), Gaps = 0/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  V
Sbjct  573  GLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKIVDVLRNTTHNAFPVLDEAEV  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP+  L  GA ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  633  PPQMGLGTGAIELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  692

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+P+ QA+G SP
Sbjct  693  DVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPRIQASGRSP  752

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL  +KG K
Sbjct  753  VIGILTRQDLRAYNILQAFPHLEKTKGRK  781



>ref|XP_010678326.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=655

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 177/210 (84%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNITVGELA+VKPP+V+LRG+EKV  IV+VLKNTTHNGFP++D+G +
Sbjct  445  GLPFLDANPEPWMRNITVGELAEVKPPLVSLRGVEKVAHIVDVLKNTTHNGFPIIDDGAM  504

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T+    A ELHGL+LRTHL+  LKKK+F+ + RRTEE EVREKFTW++L ER    E
Sbjct  505  IP-TSQGTKARELHGLILRTHLVAALKKKWFLEQPRRTEEWEVREKFTWVELTERDLNFE  563

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VA++K EMEMYVDLHP TN TPYTVVE +SVAKA++LFRQV LRHM+I+PKY  +G+ P
Sbjct  564  QVAISKHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLFRQVALRHMLIVPKYHGSGIYP  623

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            + GILTRQDLRAHNI +VFPHLA SKG +K
Sbjct  624  ITGILTRQDLRAHNIQNVFPHLARSKGREK  653



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 181/220 (82%), Gaps = 11/220 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AHPEPWMRN+TVGELAD KP VVTL G+EKV RIVEVL+NT HNGFPVVD+  +
Sbjct  562  GLPFLEAHPEPWMRNLTVGELADSKPAVVTLHGVEKVSRIVEVLRNTKHNGFPVVDQEAI  621

Query  603  ----------PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWI  454
                      P  +A P G TELHGL+LR HLL  L +K+F+SE RRTEE +VREKFT  
Sbjct  622  YPFDPVGLRLPAASAGP-GTTELHGLILRAHLLAALNEKWFLSEPRRTEEWKVREKFTSA  680

Query  453  DLAERWGKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIIL  274
             LAER  KIE+VA+T+DEMEMYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLR M+I+
Sbjct  681  VLAERGRKIEEVAITEDEMEMYVDLHPLTNTTPYTVVESMSVAKAIVLFRQVGLRQMLII  740

Query  273  PKYQAAGVSPVVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            PKY+AAG+SPVVGILTRQDLRA NILS F HLA SKG ++
Sbjct  741  PKYRAAGISPVVGILTRQDLRASNILSAFSHLAKSKGLER  780



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 184/213 (86%), Gaps = 1/213 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP VVTL GIEKV +IV+VLKNTTHNGFPV+D+GVV
Sbjct  579  GLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGIEKVAKIVDVLKNTTHNGFPVMDDGVV  638

Query  603  PPRTALPI-GATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKI  427
             P       GATELHGLVLR HL+  LKKK+F  ERRRTE+ EVR+KFTW++LAER G I
Sbjct  639  VPPVVGQANGATELHGLVLRAHLIQALKKKWFFKERRRTEDWEVRQKFTWVELAEREGSI  698

Query  426  EDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            E VAVT +EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFRQVGLRH++++PKYQA+GVS
Sbjct  699  EGVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVS  758

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            PV+GILTRQDL AHNI +VFPHLA SK   K N
Sbjct  759  PVIGILTRQDLLAHNISTVFPHLAKSKSRGKRN  791



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 180/209 (86%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++VGEL D KPPVVTL+G+E+V +IV+VL+NTTHN FPV+DE  V
Sbjct  570  GLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVERVSKIVDVLRNTTHNAFPVLDEAEV  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  630  P-QVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  688

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EMEM+VDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK QA+G+ P
Sbjct  689  DVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQASGMCP  748

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNIL  FPHL  SKG K
Sbjct  749  VVGILTRQDLRAHNILQAFPHLEKSKGRK  777



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   265 bits (677),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++V +L D KPPVVTL+G+EKV RIV+VLKNTTHN FPV+DE  V
Sbjct  573  GLPFLEANPEPWMRNLSVSDLGDAKPPVVTLQGVEKVARIVDVLKNTTHNAFPVLDEAEV  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P+  L  GA ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  633  VPQAGLATGAIELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  692

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK Q +G+SP
Sbjct  693  DVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQVSGMSP  752

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA+NIL  FPHL  SKG K
Sbjct  753  VVGILTRQDLRAYNILQAFPHLEKSKGRK  781



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   266 bits (679),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 177/210 (84%), Gaps = 1/210 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRNITVGELA+VKPP+V+LRG+EKV  IV+VLKNTTHNGFP++D+G +
Sbjct  621  GLPFLDANPEPWMRNITVGELAEVKPPLVSLRGVEKVAHIVDVLKNTTHNGFPIIDDGAM  680

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T+    A ELHGL+LRTHL+  LKKK+F+ + RRTEE EVREKFTW++L ER    E
Sbjct  681  IP-TSQGTKARELHGLILRTHLVAALKKKWFLEQPRRTEEWEVREKFTWVELTERDLNFE  739

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VA++K EMEMYVDLHP TN TPYTVVE +SVAKA++LFRQV LRHM+I+PKY  +G+ P
Sbjct  740  QVAISKHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLFRQVALRHMLIVPKYHGSGIYP  799

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKK  154
            + GILTRQDLRAHNI +VFPHLA SKG +K
Sbjct  800  ITGILTRQDLRAHNIQNVFPHLARSKGREK  829



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 178/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  V
Sbjct  534  GLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKIVDVLRNTTHNAFPVLDEAEV  593

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  594  P-QVGLVTGATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  652

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EMEM+VDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK Q +G+ P
Sbjct  653  DVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQTSGLCP  712

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNIL  FP L  SKG K
Sbjct  713  VVGILTRQDLRAHNILQAFPQLEKSKGRK  741



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 178/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  V
Sbjct  569  GLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKIVDVLRNTTHNAFPVLDEAEV  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L   A ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  629  P-QGGLATKAIELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  687

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK QA G+SP
Sbjct  688  DVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQATGMSP  747

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNIL  FPHL  +KG K
Sbjct  748  VVGILTRQDLRAHNILQAFPHLKKTKGGK  776



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  +
Sbjct  534  GLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKIVDVLRNTTHNAFPVLDEAEL  593

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  594  P-QVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  652

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EMEM+VDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK Q++G+ P
Sbjct  653  DVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQSSGLCP  712

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNIL  FP +  SKG K
Sbjct  713  VVGILTRQDLRAHNILQAFPQMEKSKGRK  741



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 180/215 (84%), Gaps = 8/215 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A PEPWMRN+TVGELA  KP +V+LRGIE+V R+V+VLK+T+HNGFPVVD+G  
Sbjct  575  GLPFLEASPEPWMRNLTVGELAAAKPRIVSLRGIERVARVVDVLKHTSHNGFPVVDQGA-  633

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P +  P G TELHGLVLR HL+ VL KK+F+ ERRRT E EVR  FT +DLAE+  K+E
Sbjct  634  -PSS--PAGTTELHGLVLRAHLVAVLSKKWFLKERRRTAEWEVRAAFTSVDLAEKGQKVE  690

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             V +T++EM+MYVDLHP TNTTPYTVVES+SVAKA++LFRQVGLRH++++PKYQ AG+SP
Sbjct  691  HVKLTEEEMDMYVDLHPFTNTTPYTVVESMSVAKAVVLFRQVGLRHLLVIPKYQGAGISP  750

Query  243  VVGILTRQDLRAHNILSVFPHLANSKG----SKKG  151
            VVGILTRQDLRAHNIL  FPHLAN +G    SKKG
Sbjct  751  VVGILTRQDLRAHNILGAFPHLANKRGEEGRSKKG  785



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 178/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  V
Sbjct  570  GLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKIVDVLRNTTHNAFPVLDEAEV  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  630  P-QVGLVTGATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  688

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EMEM+VDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK Q +G+ P
Sbjct  689  DVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQTSGLCP  748

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNIL  FP L  SKG K
Sbjct  749  VVGILTRQDLRAHNILQAFPQLEKSKGRK  777



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++VG+L D KPPVVTL+G+EKV RIV+VLKNTTHN FPV+DE  V
Sbjct  573  GLPFLEANPEPWMRNLSVGDLGDAKPPVVTLQGVEKVARIVDVLKNTTHNAFPVLDEAQV  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P+  L  GA ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  633  VPQVGLANGAIELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  692

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGL H++I+PK Q +G+SP
Sbjct  693  DVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLWHLLIVPKIQVSGMSP  752

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA+NIL  FPHL  SKG K
Sbjct  753  VVGILTRQDLRAYNILQAFPHLEKSKGRK  781



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  +
Sbjct  570  GLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKIVDVLRNTTHNAFPVLDEAEL  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  630  P-QVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  688

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EMEM+VDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK Q++G+ P
Sbjct  689  DVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQSSGLCP  748

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNIL  FP +  SKG K
Sbjct  749  VVGILTRQDLRAHNILQAFPQMEKSKGRK  777



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN++VGEL D KPPVVTL+G+E V +IV+VLKNTTHN FPV+DE  V
Sbjct  569  GLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVETVAKIVDVLKNTTHNAFPVLDEAEV  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GA ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  629  P-QVGLATGAKELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  687

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA++  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQ+GLRH++I+PK QA+G+SP
Sbjct  688  DVAISSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQLGLRHLLIVPKIQASGMSP  747

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA+NIL  FPHL  SKG K
Sbjct  748  VVGILTRQDLRAYNILQAFPHLEKSKGRK  776



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 178/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL+G+EKV  IV+VLKNTTHN FPV+DE  V
Sbjct  571  GLPFLEANPEPWMRNLTVGELGDAKPPVVTLQGVEKVSNIVDVLKNTTHNAFPVLDEAEV  630

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  631  P-QVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  689

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EMEMYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK QA+G+ P
Sbjct  690  DVAITSAEMEMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQASGMCP  749

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA+NIL  FP L  SKG K
Sbjct  750  VVGILTRQDLRAYNILQAFPLLEKSKGGK  778



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 177/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VL+NTTHN FPV+DE  V
Sbjct  570  GLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKIVDVLRNTTHNAFPVLDEAEV  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  L  GATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LA R    +
Sbjct  630  P-QVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAGREDNFD  688

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EMEM+VDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK Q +G+ P
Sbjct  689  DVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQTSGLCP  748

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRAHNIL  FP L  SKG K
Sbjct  749  VVGILTRQDLRAHNILQAFPQLEKSKGRK  777



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 178/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++VGEL D KPPVVTL+G+EKV +IV+VLKNTTHN FPV+DE  V
Sbjct  570  GLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKIVDVLKNTTHNAFPVLDEAEV  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P +  LP  ATELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  630  P-QVGLPTSATELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  688

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+   EMEMYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK QA+G+ P
Sbjct  689  DVAIRSAEMEMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQASGMCP  748

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA+NIL  FP L  SKG K
Sbjct  749  VVGILTRQDLRAYNILQAFPLLEKSKGGK  777



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELAD K  VVTL GIEKV  IV+VLKNTTHN FPV+D+   
Sbjct  572  GLPFLDANPEPWMRNLTVGELADAKTSVVTLHGIEKVANIVDVLKNTTHNAFPVLDDAD-  630

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P+  L  GATELHGL+LR HL+ VLKK++F++E+RRTE+ EVREKFTW++LAER    E
Sbjct  631  APQVGLADGATELHGLILRAHLVKVLKKRWFLTEKRRTEDWEVREKFTWVELAEREDNFE  690

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +  VT  EM+MYVDLHPLTNTTPYTVVES+SVAKA++LFRQVGLRH++I+PK QAAG+ P
Sbjct  691  EATVTSSEMQMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKIQAAGMCP  750

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA+NIL  FPHL   K  K
Sbjct  751  VVGILTRQDLRAYNILQAFPHLVKPKDRK  779



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 177/209 (85%), Gaps = 3/209 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN++VG+L D KPPVVTL+G+EKV RIV+VLKNTTHN FPV+DE  V
Sbjct  573  GLPFLEANPEPWMRNLSVGDLGDAKPPVVTLQGVEKVARIVDVLKNTTHNAFPVLDEAQV  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P+  L  GA ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKF W +LAER    +
Sbjct  633  VPQVGLANGAIELHGLILRAHLVKVLKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFD  692

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTV+E++SVAKAL+LFRQVGLRH++I+PK Q   +SP
Sbjct  693  DVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQ---MSP  749

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDLRA+NIL  FPHL  SKG K
Sbjct  750  VVGILTRQDLRAYNILQAFPHLEKSKGRK  778



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 180/210 (86%), Gaps = 3/210 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGELA  KP VV LRGIEKV  +VEVLK+T HNGFPVVD+GV 
Sbjct  585  GLPFLEANPEPWMRNLTVGELAAAKPSVVNLRGIEKVSHVVEVLKSTKHNGFPVVDQGVA  644

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG-KI  427
             P   +P GA ELHGLVLR+HL+ VL+KK+F+ ERRRTEE EVREKFT +DLA + G K+
Sbjct  645  SP-IGMPEGAVELHGLVLRSHLIAVLRKKWFLKERRRTEEWEVREKFTSVDLARKKGPKL  703

Query  426  EDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            E++ +T+DEM+MY+DLHP TNTTPYTVVE++SVAKA++LFRQV LRH++I+PKYQ AG+S
Sbjct  704  EEMVLTEDEMDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRQVALRHLLIIPKYQGAGIS  763

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSK  157
            PVVGILTRQDLRAHNIL  FPHLA  KG K
Sbjct  764  PVVGILTRQDLRAHNILGAFPHLAE-KGEK  792



>gb|KEH25445.1| ClC chloride channel family protein [Medicago truncatula]
Length=646

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 8/213 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA PEPWMRN++VGEL DVK  VV+ RGIEKV  IV+ LKNTTHNGFPV+D+G  
Sbjct  441  GLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNIVDALKNTTHNGFPVMDDGD-  499

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                   +   +LHG++LR HL+ VLKKK+F+ E+RRTEE EVREKF+W++LAER   IE
Sbjct  500  ------EVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKFSWVELAEREENIE  553

Query  423  DV-AVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            DV  VTK+EMEM+VDLHPLTNTTP+TV+ES+SVAKA +LFRQVGLRHM+++PKYQA+GVS
Sbjct  554  DVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVS  613

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            PV+GILTRQDL A+NIL VFPHL NSKG +K N
Sbjct  614  PVIGILTRQDLLAYNILPVFPHLENSKGREKSN  646



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGELA  KP VV+L GIEKV R+VEVLK+T HNGFPVVD+GV 
Sbjct  584  GLPFLEANPEPWMRNLTVGELAAAKPSVVSLGGIEKVVRVVEVLKSTKHNGFPVVDQGV-  642

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    +P GATELHGLVLR+HL+ VL+KK+F+ ERRRTEE EVRE+F  +DLA++  KI+
Sbjct  643  PSPIGMPTGATELHGLVLRSHLVAVLRKKWFLKERRRTEEWEVREQFMSVDLAQKGPKIQ  702

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +V +T+DEM+MY+DLHP TNTTPYTVVE++SVAKA++LFRQV LRH++I+PKYQ AG+SP
Sbjct  703  EVVLTEDEMDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRQVALRHLLIVPKYQGAGISP  762

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            +VGILTRQDL AHNIL  FPHLA  + S+  N
Sbjct  763  IVGILTRQDLIAHNILGAFPHLAKKEKSESTN  794



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   256 bits (655),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 175/210 (83%), Gaps = 4/210 (2%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGELA  KP VV+LRGIEKV R+VEVLK+T HNGFPVVD+GV 
Sbjct  578  GLPFLEANPEPWMRNLTVGELAAAKPGVVSLRGIEKVARVVEVLKSTKHNGFPVVDQGV-  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG-KI  427
            P    +P GATELHG+VLR+HL+ VL+KK+F+ ERR  E      KFT +DLA++ G KI
Sbjct  637  PSPVGMPEGATELHGVVLRSHLVAVLRKKWFLQERRTGEWEVRE-KFTSVDLAQKKGPKI  695

Query  426  EDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            E++ +T+DEM+MY+DLHP TN TPYTV+E++SVAKA++LFRQV LRH++I+PKYQ AG+S
Sbjct  696  EEIVLTEDEMDMYIDLHPFTNATPYTVLETMSVAKAMVLFRQVALRHLLIVPKYQGAGIS  755

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSK  157
            PVVGILTRQDLRAHNIL  FPHL   KG K
Sbjct  756  PVVGILTRQDLRAHNILGAFPHL-EKKGEK  784



>gb|KEH25446.1| ClC chloride channel family protein [Medicago truncatula]
Length=722

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 8/213 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA PEPWMRN++VGEL DVK  VV+ RGIEKV  IV+ LKNTTHNGFPV+D+G  
Sbjct  517  GLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNIVDALKNTTHNGFPVMDDGD-  575

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                   +   +LHG++LR HL+ VLKKK+F+ E+RRTEE EVREKF+W++LAER   IE
Sbjct  576  ------EVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKFSWVELAEREENIE  629

Query  423  DV-AVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            DV  VTK+EMEM+VDLHPLTNTTP+TV+ES+SVAKA +LFRQVGLRHM+++PKYQA+GVS
Sbjct  630  DVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVS  689

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            PV+GILTRQDL A+NIL VFPHL NSKG +K N
Sbjct  690  PVIGILTRQDLLAYNILPVFPHLENSKGREKSN  722



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 177/209 (85%), Gaps = 2/209 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGELA  KP V +LRGIEKV R+VEVLK+T HNGFPVVD+GV 
Sbjct  579  GLPFLEANPEPWMRNLTVGELAAAKPSVASLRGIEKVARVVEVLKSTKHNGFPVVDQGV-  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    +P GATE HGLVLR+HL+ VL+KK+F+ ERRRTEE EVRE FT +DL ++  KI+
Sbjct  638  PSPIGMPTGATEFHGLVLRSHLVAVLRKKWFVKERRRTEEWEVRESFTSVDLTQKGPKIQ  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +V +T+DEM+MY+DLHP  NTTPYTVVE++SVAKA++LFRQV LRH++I+PKYQ AG+ P
Sbjct  698  EVVLTEDEMDMYIDLHPFANTTPYTVVETMSVAKAVVLFRQVALRHLLIVPKYQGAGIPP  757

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            +VGILTRQDL+AHNIL  FPHLA  KG K
Sbjct  758  IVGILTRQDLKAHNILGAFPHLAK-KGEK  785



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 8/213 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA PEPWMRN++VGEL DVK  VV+ RGIEKV  IV+ LKNTTHNGFPV+D+G  
Sbjct  575  GLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNIVDALKNTTHNGFPVMDDGD-  633

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                   +   +LHG++LR HL+ VLKKK+F+ E+RRTEE EVREKF+W++LAER   IE
Sbjct  634  ------EVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKFSWVELAEREENIE  687

Query  423  DV-AVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            DV  VTK+EMEM+VDLHPLTNTTP+TV+ES+SVAKA +LFRQVGLRHM+++PKYQA+GVS
Sbjct  688  DVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVS  747

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            PV+GILTRQDL A+NIL VFPHL NSKG +K N
Sbjct  748  PVIGILTRQDLLAYNILPVFPHLENSKGREKSN  780



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 8/213 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA PEPWMRN++VGEL DVK  VV+ RGIEKV  IV+ LKNTTHNGFPV+D+G  
Sbjct  570  GLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNIVDALKNTTHNGFPVMDDGD-  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                   +   +LHG++LR HL+ VLKKK+F+ E+RRTEE EVREKF+W++LAER   IE
Sbjct  629  ------EVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKFSWVELAEREENIE  682

Query  423  DV-AVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            DV  VTK+EMEM+VDLHPLTNTTP+TV+ES+SVAKA +LFRQVGLRHM+++PKYQA+GVS
Sbjct  683  DVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVS  742

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            PV+GILTRQDL A+NIL VFPHL NSKG +K N
Sbjct  743  PVIGILTRQDLLAYNILPVFPHLENSKGREKSN  775



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   248 bits (634),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVE--VLKNTTHNGFPVVDEG  610
            GLPF+ A+PEPWMRN+TVGEL DVKP V++              +LKNTTHNGFPV+D+G
Sbjct  580  GLPFMGANPEPWMRNLTVGELVDVKPAVISXXXXXXXXXXXXXXLLKNTTHNGFPVMDDG  639

Query  609  VVPP-RTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG  433
            ++PP R A   GA ELHGL+LR HL+  LKKK+F+ ERRRTEE E REKFTW++LAER G
Sbjct  640  IIPPVRHA--NGAMELHGLILRAHLIQALKKKWFLKERRRTEEWEAREKFTWVELAEREG  697

Query  432  KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAG  253
             IE+VA+T++EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LF QVGLRH++++PKYQA+G
Sbjct  698  NIEEVAITREEMEMFVDLHPLTNTTPFTVLESISVAKAMILFHQVGLRHLLVVPKYQASG  757

Query  252  VSPVVGILTRQDLRAHNILSVFPHLANSKGSKKGN  148
            V PV+GILTRQDL AHNIL+VFPHLA SK  +K N
Sbjct  758  VCPVIGILTRQDLLAHNILTVFPHLAKSKRRQKRN  792



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 171/209 (82%), Gaps = 11/209 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTLRG+EKV  IV+ L+NTTHN FPV+D    
Sbjct  571  GLPFLEANPEPWMRNLTVGELGDAKPPVVTLRGVEKVANIVDALRNTTHNAFPVLDGD--  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                     ATELHGL+LR HL+ VLKK++F++E+RRTE+ EVREKFT ++LAER    +
Sbjct  629  ---------ATELHGLILRAHLVKVLKKRWFLNEKRRTEDWEVREKFTPVELAEREDNFD  679

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++I+PK QA+G+SP
Sbjct  680  DVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSP  739

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  740  VIGILTRQDLRAYNILQAFPHLDKHKSGK  768



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 11/209 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTLRG+EKV  IV+ L+NTTHN FPV+D    
Sbjct  571  GLPFLEANPEPWMRNLTVGELGDAKPPVVTLRGVEKVANIVDALRNTTHNAFPVLDGD--  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                     ATELHGL+LR HL+ VLKK++F++E+RRTE+ EVREKFT ++LAER    +
Sbjct  629  ---------ATELHGLILRAHLVKVLKKRWFLNEKRRTEDWEVREKFTPVELAEREDNFD  679

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV +T  EM+MYVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++I+PK QA+G+SP
Sbjct  680  DVGITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSP  739

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  740  VIGILTRQDLRAYNILQAFPHLDKHKSGK  768



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 171/209 (82%), Gaps = 5/209 (2%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPV+TLRG+EKV  IV+ L+NTTHN FPV+D   V
Sbjct  571  GLPFLEANPEPWMRNLTVGELVDAKPPVITLRGVEKVANIVDALRNTTHNAFPVLDGEDV  630

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                      TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  631  DNGAG-----TELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  685

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  686  DVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  745

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  746  VIGILTRQDLRAYNILQAFPHLDKHKSGK  774



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 172/210 (82%), Gaps = 7/210 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGEL D KPPV++L G+EKV  IV+ L+NTTHN FPV+D    
Sbjct  571  GLPFLDANPEPWMRNLTVGELGDAKPPVISLHGVEKVANIVDALRNTTHNAFPVLDG---  627

Query  603  PPRTALPIGA-TElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKI  427
                 L  GA TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    
Sbjct  628  ---EDLATGAATELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNF  684

Query  426  EDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            +DVA+T  EM+MYVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+S
Sbjct  685  DDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMS  744

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSK  157
            PV+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  PVIGILTRQDLRAYNILQAFPHLDKHKSGK  774



>ref|NP_001031990.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 gb|AED94613.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=643

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 171/209 (82%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  440  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLDG---  496

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A     TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  497  ----ADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  552

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  553  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  612

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  613  VIGILTRQDLRAYNILQAFPHLDKHKSGK  641



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 169/209 (81%), Gaps = 11/209 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+ L+NTTHN FPV+D    
Sbjct  571  GLPFLEANPEPWMRNLTVGELGDAKPPVVTLSGVEKVANIVDALRNTTHNAFPVLDGD--  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                     ATELHGL+LR HL+ VLKK++F++E+RRTE+ EVREKFT ++LAER    +
Sbjct  629  ---------ATELHGLILRAHLVKVLKKRWFLNEKRRTEDWEVREKFTPVELAEREDNFD  679

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV +T  EM+MYVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++I+PK QA+G+SP
Sbjct  680  DVGITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSP  739

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  740  VIGILTRQDLRAYNILQAFPHLDKHKSGK  768



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 170/209 (81%), Gaps = 5/209 (2%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPV+TLRG+EKV  IV+ L+NTTHN FPV+D   V
Sbjct  571  GLPFLEANPEPWMRNLTVGELVDAKPPVITLRGVEKVANIVDALRNTTHNAFPVLDGEDV  630

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                      TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  631  DNGAG-----TELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  685

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+MYVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  686  DVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  745

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL      K
Sbjct  746  VIGILTRQDLRAYNILQAFPHLDKHNSGK  774



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  572  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  627

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A      ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  628  ---GADQATGAELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTAVELAEREDNFD  684

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++I+PK QA+G+SP
Sbjct  685  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSP  744

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  VIGILTRQDLRAYNILQAFPHLDKHKSGK  773



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  572  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  627

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A      ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  628  ---GADQATGAELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTAVELAEREDNFD  684

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++I+PK QA+G+SP
Sbjct  685  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSP  744

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  VIGILTRQDLRAYNILQAFPHLDKHKSGK  773



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 172/210 (82%), Gaps = 7/210 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPV++L G+EKV  IV+ L+NTTHN FPV+D    
Sbjct  571  GLPFLEANPEPWMRNLTVGELGDAKPPVISLHGVEKVANIVDALRNTTHNAFPVLDG---  627

Query  603  PPRTALPIGA-TElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKI  427
                 L  GA TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    
Sbjct  628  ---EDLATGAATELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNF  684

Query  426  EDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            +DVA+T  EM+MYVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+S
Sbjct  685  DDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMS  744

Query  246  PVVGILTRQDLRAHNILSVFPHLANSKGSK  157
            PV+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  PVIGILTRQDLRAYNILQAFPHLDKHKSGK  774



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  574  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A     TELHGL+LR HL+ VLKK++F+ E+RRTEE EVREKFT ++LAER    +
Sbjct  630  ---GADQATGTELHGLILRAHLVKVLKKRWFLDEKRRTEEWEVREKFTPVELAEREDNFD  686

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  687  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  746

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  747  VIGILTRQDLRAYNILQAFPHLDKHKSGK  775



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   241 bits (614),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVGELADVKPPVVTL G+EKV RIV+VL+NTTHN FP+VD+GV 
Sbjct  579  GLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRIVDVLRNTTHNAFPIVDQGV-  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            P    +  GATELHGL+LR HL+  LKKK+F+ E+RRTEE EVREKF W++LAER  KIE
Sbjct  638  PVPGMVATGATELHGLILRAHLVQALKKKWFLPEKRRTEEWEVREKFNWVELAEREIKIE  697

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             VAVT+DEMEMYVDLHPLTNTTP+TVVESLSVAKAL+LFRQVGLRH++I+PKYQ AGVS 
Sbjct  698  QVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQVGLRHLLIVPKYQGAGVSL  757

Query  243  VVGILTRQDLRAHNILSVFPHL  178
            +        L  H   S+F HL
Sbjct  758  LT---INTSLLFHAYSSIFVHL  776



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 171/209 (82%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  570  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  625

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A     TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  626  ---GADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  682

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  683  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  742

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  743  VIGILTRQDLRAYNILQAFPHLDKHKSGK  771



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 169/209 (81%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  572  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  627

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A      ELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  628  ---GADQATGAELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTAVELAEREDNFD  684

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+ YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++I+PK QA+G+SP
Sbjct  685  DVAITSSEMQFYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSP  744

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  VIGILTRQDLRAYNILQAFPHLDKHKSGK  773



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 171/209 (82%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  572  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  627

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A     TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  628  ---GADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  684

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  685  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  744

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  VIGILTRQDLRAYNILQAFPHLDKHKSGK  773



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 171/209 (82%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  572  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  627

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A     TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  628  ---GADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  684

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  685  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  744

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  VIGILTRQDLRAYNILQAFPHLDKHKSGK  773



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 171/209 (82%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  572  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLD----  627

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                A     TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  628  ---GADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  684

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  685  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  744

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  745  VIGILTRQDLRAYNILQAFPHLDKHKSGK  773



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 172/209 (82%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL G+EKV  IV+VL+NTTHN FPV+D    
Sbjct  573  GLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANIVDVLRNTTHNAFPVLDG---  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
              +T      TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  630  TDQTT----GTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  685

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  686  DVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  745

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  746  VIGILTRQDLRAYNILQAFPHLDKHKSGK  774



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 172/209 (82%), Gaps = 5/209 (2%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPVVTL+G+EKV  IV+ L+NTTHN FPV+D    
Sbjct  571  GLPFLEANPEPWMRNLTVGELGDAKPPVVTLQGVEKVANIVDALRNTTHNAFPVLD----  626

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                ++    TELHGL+LR HL+ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  627  -GSDSVTGAGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  685

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            +VA+T  EM++YVDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  686  EVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  745

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FPHL   K  K
Sbjct  746  VIGILTRQDLRAYNILQAFPHLDKHKSGK  774



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 170/209 (81%), Gaps = 5/209 (2%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A+PEPWMRN+TVGEL D KPPV+TLRG+EKV  IV+ L+NTTHN FPV+D   V
Sbjct  571  GLPFLEANPEPWMRNLTVGELVDAKPPVITLRGVEKVANIVDALRNTTHNAFPVLDGEDV  630

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                      TELHGL+LR H++ VLKK++F++E+RRTEE EVREKFT ++LAER    +
Sbjct  631  DTGAG-----TELHGLILRAHIVKVLKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFD  685

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DVA+T  EM+M+VDLHPLTNTTPYTVV+S+SVAKAL+LFR VGLRH++++PK QA+G+SP
Sbjct  686  DVAITSSEMQMWVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSP  745

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            V+GILTRQDLRA+NIL  FP L   K  K
Sbjct  746  VIGILTRQDLRAYNILQAFPRLDKHKSGK  774



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFLDA+PEPWMRN+TVG+LAD KPPVVTL G+EKV RIV+VLKNTTHN FP+VD+GV+
Sbjct  575  GLPFLDANPEPWMRNLTVGDLADAKPPVVTLCGVEKVSRIVDVLKNTTHNAFPIVDQGVL  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             P T +  GATELHGL+LR HL+  LKKK+FM E+RRTEE EVREKF W+DLAER  KIE
Sbjct  635  VPGT-ISTGATELHGLILRAHLVQALKKKWFMPEKRRTEEWEVREKFNWVDLAERELKIE  693

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAG  253
             VAVT+DEMEMY DLHPLTNTTPYTVVES+SVAKA++LFRQVGLRH++I+PKYQ AG
Sbjct  694  QVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQGAG  750



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AHPEPWMRN+TVGELA  KPPVVTL GIEKV RIVEVL+NTTHNGFPVV+E VV
Sbjct  581  GLPFLEAHPEPWMRNLTVGELAXAKPPVVTLXGIEKVDRIVEVLRNTTHNGFPVVEE-VV  639

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP   L +GAT +HGL+LR HL+ VLKKK+F+ E+RRTEE EVREKFT ++LAE   KIE
Sbjct  640  PP-MGLAVGATXVHGLILRAHLVQVLKKKWFLREKRRTEEWEVREKFTSVELAEXEAKIE  698

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            +VAVT+DEMEMYVDLHPLTN TPYTV+E +SVAKA++LFRQVGLRH++I+PKY+A+GVS
Sbjct  699  EVAVTRDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLIVPKYEASGVS  757



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 166/204 (81%), Gaps = 8/204 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  KP  + L+ +EKV  I++VL+NT HNGFPVVD    
Sbjct  587  GLPFLEPKPEPWMKDLTVGELAAAKPRTINLQVVEKVSTIIQVLRNTGHNGFPVVDR---  643

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR  L    +ELHGLVLR+HL+ VL+K++F++E+RRTEE E RE+F+ ++LA++  KI+
Sbjct  644  -PRPGL----SELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFSSVELADKNCKID  698

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+ +T +E+EMY+DLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PKYQ   +SP
Sbjct  699  DIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISP  758

Query  243  VVGILTRQDLRAHNILSVFPHLAN  172
            +VGILTRQDLRAHNIL  FPHLAN
Sbjct  759  IVGILTRQDLRAHNILGAFPHLAN  782



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 166/204 (81%), Gaps = 8/204 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  KP  + L+ +EKV  I++VL+NT HNGFPVVD    
Sbjct  587  GLPFLEPKPEPWMKDLTVGELAAAKPRTINLQVVEKVSTIIQVLRNTGHNGFPVVDR---  643

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR  L    +ELHGLVLR+HL+ VL+K++F++E+RRTEE E RE+F+ ++LA++  KI+
Sbjct  644  -PRPGL----SELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFSSVELADKNCKID  698

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+ +T +E+EMY+DLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PKYQ   +SP
Sbjct  699  DIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISP  758

Query  243  VVGILTRQDLRAHNILSVFPHLAN  172
            +VGILTRQDLRAHNIL  FPHLAN
Sbjct  759  IVGILTRQDLRAHNILGAFPHLAN  782



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 166/204 (81%), Gaps = 8/204 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  KP  + L+ +EKV  I++VL+NT HNGFPVVD    
Sbjct  587  GLPFLEPKPEPWMKDLTVGELAAAKPRTINLQVVEKVSTIIQVLRNTGHNGFPVVDR---  643

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR  L    +ELHGLVLR+HL+ VL+K++F++E+RRTEE E RE+F+ ++LA++  KI+
Sbjct  644  -PRPGL----SELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFSSVELADKNCKID  698

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+ +T +E+EMY+DLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PKYQ   +SP
Sbjct  699  DIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISP  758

Query  243  VVGILTRQDLRAHNILSVFPHLAN  172
            +VGILTRQDLRAHNIL  FPHLAN
Sbjct  759  IVGILTRQDLRAHNILGAFPHLAN  782



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 166/204 (81%), Gaps = 8/204 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  KP  ++L+ +EKV  ++EVLKNT HNGFPVVD    
Sbjct  464  GLPFLEPKPEPWMKDLTVGELAAAKPRTISLQVVEKVSTVLEVLKNTGHNGFPVVDR---  520

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR  L    +ELHGLVLR+HL+ VL+K++F++E+RRTEE E RE+F+ ++LA++  KI+
Sbjct  521  -PRPGL----SELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFSSVELADKNCKID  575

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+ +T +E+EMY+DLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PKYQ   +SP
Sbjct  576  DLELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISP  635

Query  243  VVGILTRQDLRAHNILSVFPHLAN  172
            +VGILTRQDLRAHNIL  FPHLA 
Sbjct  636  LVGILTRQDLRAHNILGAFPHLAK  659



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 167/204 (82%), Gaps = 8/204 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  KP  ++L+ IEKV  ++EVL++T HNGFPVVD    
Sbjct  582  GLPFLEPKPEPWMKDLTVGELAAAKPRTISLQVIEKVSNVLEVLRSTGHNGFPVVDR---  638

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR  L    +ELHGLVLR+HL+ VL+K++F++E+RRTEE E RE+F+ ++LA++  KI+
Sbjct  639  -PRPGL----SELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFSSVELADKNCKID  693

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+ +T +E+EMY+DLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PKYQ   +SP
Sbjct  694  DIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISP  753

Query  243  VVGILTRQDLRAHNILSVFPHLAN  172
            +VGILTRQDLRAHNIL  FPHLAN
Sbjct  754  IVGILTRQDLRAHNILGAFPHLAN  777



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 168/209 (80%), Gaps = 10/209 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  K   ++L+ +EKV  ++EVL+NT HNGFPVVD    
Sbjct  337  GLPFLEPKPEPWMKDLTVGELAAAKARTISLQVVEKVSTVLEVLRNTGHNGFPVVDR---  393

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+ VL+K++F++E+RRTEE E RE+F+ ++LA++  KI+
Sbjct  394  -PRP----GLSELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFSSVELADKNCKID  448

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            D+ +T +E+EMYVDLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PKYQ   +SP
Sbjct  449  DLELTPEELEMYVDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISP  508

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            +VGILTRQDLRAHNIL  FPHL  SK SK
Sbjct  509  LVGILTRQDLRAHNILGAFPHL--SKKSK  535



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 164/206 (80%), Gaps = 8/206 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A PEPWM+++TVGELA  KP  VTL+ +E+V  +VE L++T HNGFPV+D    
Sbjct  584  GLPFLEAKPEPWMKDLTVGELAAAKPRAVTLQVLERVSTVVEALRSTRHNGFPVLDR---  640

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+ VLKK++F+ ERRRTEE E RE+FT  +LA++ G ++
Sbjct  641  -PRP----GVSELHGLVLRSHLVAVLKKRWFLPERRRTEEWEARERFTSAELADKAGDVD  695

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             +  + +EM MYVDLHPLTNTTPYTVVE++SVAKA++LFR V LRHM+I+PK+Q   +SP
Sbjct  696  GLDFSPEEMAMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISP  755

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            +VGILTRQDLRAHNIL  FPHLAN +
Sbjct  756  IVGILTRQDLRAHNILGAFPHLANKR  781



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 166/207 (80%), Gaps = 9/207 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  KP  V+L+ +E+V  IVEVL+ T HNGFPVV     
Sbjct  589  GLPFLEPKPEPWMKDLTVGELAAAKPRTVSLQVVERVSTIVEVLRGTGHNGFPVVGR---  645

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR  L    +ELHGLVLR+HL+ VL+K++F++E+RRTE+ E RE+F+ ++LA++  K+E
Sbjct  646  -PRPGL----SELHGLVLRSHLVAVLRKRWFLTEQRRTEDWEARERFSSVELADKSAKLE  700

Query  423  DVA-VTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            D+  +T +EMEM+VDLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PK+Q   +S
Sbjct  701  DLQEITPEEMEMFVDLHPFTNTTPYTVVETMSVAKAVVLFRAVALRHMLIMPKFQGPEIS  760

Query  246  PVVGILTRQDLRAHNILSVFPHLANSK  166
            P+VGILTRQDLRAHNIL  FPHLAN +
Sbjct  761  PIVGILTRQDLRAHNILGAFPHLANKR  787



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 166/208 (80%), Gaps = 10/208 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PE WM+++ VGELA  KP VVTL+ IEKV  +VEVL++T HNGFPV+D    
Sbjct  599  GLPFLEPKPETWMKDLAVGELAAAKPRVVTLQVIEKVSTVVEVLRSTPHNGFPVLDR---  655

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+ VLKK++F++E+RRTEE E RE+F+  +LAE+ G I+
Sbjct  656  -PRP----GVSELHGLVLRSHLMAVLKKRWFLTEKRRTEEWEARERFSSTELAEKSGSID  710

Query  423  DVAV--TKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGV  250
            +VAV  T +E++MY+DLHP TNTTPYTVVE++SVAKA++LFR   LRHM+I+PK+Q   +
Sbjct  711  EVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQGPEI  770

Query  249  SPVVGILTRQDLRAHNILSVFPHLANSK  166
            +P+VGILTRQDLRAHNIL  FPHLAN +
Sbjct  771  APIVGILTRQDLRAHNILGAFPHLANKR  798



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PE WM+++TVGELA  KP  VTL+ +EKV  IV VL+ T HNGFPV+D    
Sbjct  594  GLPFLEPKPETWMKDLTVGELAAAKPRAVTLQVVEKVSTIVAVLRATPHNGFPVLDR---  650

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR HL+ VL+K++F+ E+RRTEE E RE+F+  +LAE+ G I+
Sbjct  651  -PRP----GVSELHGLVLRQHLMAVLRKRWFLQEKRRTEEWEARERFSSTELAEKAGSID  705

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV ++ +E++MY+DLHP TNTTPYTVVE++SVAKA++LFR   LRHM+I+PK+Q   +SP
Sbjct  706  DVQLSPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQGLEISP  765

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            ++GILTRQDLRAHNIL  FPHLAN +
Sbjct  766  IMGILTRQDLRAHNILGAFPHLANKR  791



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 166/208 (80%), Gaps = 10/208 (5%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PE WM+++ VGELA  KP VVTL+ IEKV  +VEVL++T HNGFPV+D    
Sbjct  599  GLPFLEPKPETWMKDLAVGELAAAKPRVVTLQVIEKVSTVVEVLRSTPHNGFPVLDW---  655

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+ VLKK++F++++RRTEE E RE+F+  +LAE+ G I+
Sbjct  656  -PRP----GVSELHGLVLRSHLMAVLKKRWFLTDKRRTEEWEARERFSSTELAEKSGSID  710

Query  423  DVAV--TKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGV  250
            +VAV  T +E++MY+DLHP TNTTPYTVVE++SVAKA++LFR   LRHM+I+PK+Q   +
Sbjct  711  EVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQGPEI  770

Query  249  SPVVGILTRQDLRAHNILSVFPHLANSK  166
            +P+VGILTRQDLRAHNIL  FPHLAN +
Sbjct  771  APIVGILTRQDLRAHNILGAFPHLANKR  798



>gb|ABA98017.1| Chloride channel protein CLC-a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95101.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97716.1| unnamed protein product [Oryza sativa Japonica Group]
Length=625

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A PEPWM+++TVGELA  KP  V L+ +E+V  +VE L+ T HNGFPV+D    
Sbjct  425  GLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTVVEALRATRHNGFPVLDR---  481

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+  L+K++F+ ERRRTEE E RE F+  +LA++ G ++
Sbjct  482  -PRP----GVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFSSAELADKCGGVD  536

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            ++ ++ +EM MYVDLHPLTNTTPYTVVE++SVAKA++LFR V LRHM+I+PK+Q   +SP
Sbjct  537  ELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISP  596

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            +VGILTRQDL AHNIL  FPHLA+ +
Sbjct  597  IVGILTRQDLIAHNILGAFPHLASKR  622



>gb|EEC69202.1| hypothetical protein OsI_38195 [Oryza sativa Indica Group]
Length=621

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A PEPWM+++TVGELA  KP  V L+ +E+V  +VE L+ T HNGFPV+D    
Sbjct  421  GLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTVVEALRATRHNGFPVLDR---  477

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+  L+K++F+ ERRRTEE E RE F+  +LA++ G ++
Sbjct  478  -PRP----GVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFSSAELADKCGGVD  532

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            ++ ++ +EM MYVDLHPLTNTTPYTVVE++SVAKA++LFR V LRHM+I+PK+Q   +SP
Sbjct  533  ELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISP  592

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            +VGILTRQDL AHNIL  FPHLA+ +
Sbjct  593  IVGILTRQDLIAHNILGAFPHLASKR  618



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A PEPWM+++TVGELA  KP  V L+ +E+V  +VE L+ T HNGFPV+D    
Sbjct  516  GLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTVVEALRATRHNGFPVLDR---  572

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+  L+K++F+ ERRRTEE E RE F+  +LA++ G ++
Sbjct  573  -PRP----GVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFSSAELADKCGGVD  627

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            ++ ++ +EM MYVDLHPLTNTTPYTVVE++SVAKA++LFR V LRHM+I+PK+Q   +SP
Sbjct  628  ELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISP  687

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            +VGILTRQDL AHNIL  FPHLA+ +
Sbjct  688  IVGILTRQDLIAHNILGAFPHLASKR  713



>ref|NP_001066692.1| Os12g0438600 [Oryza sativa Japonica Group]
 dbj|BAF29711.1| Os12g0438600, partial [Oryza sativa Japonica Group]
Length=707

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+A PEPWM+++TVGELA  KP  V L+ +E+V  +VE L+ T HNGFPV+D    
Sbjct  507  GLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTVVEALRATRHNGFPVLDR---  563

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+  L+K++F+ ERRRTEE E RE F+  +LA++ G ++
Sbjct  564  -PRP----GVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFSSAELADKCGGVD  618

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            ++ ++ +EM MYVDLHPLTNTTPYTVVE++SVAKA++LFR V LRHM+I+PK+Q   +SP
Sbjct  619  ELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISP  678

Query  243  VVGILTRQDLRAHNILSVFPHLANSK  166
            +VGILTRQDL AHNIL  FPHLA+ +
Sbjct  679  IVGILTRQDLIAHNILGAFPHLASKR  704



>ref|XP_006848425.1| hypothetical protein AMTR_s00013p00233550 [Amborella trichopoda]
 gb|ERN10006.1| hypothetical protein AMTR_s00013p00233550 [Amborella trichopoda]
Length=634

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EPW+RNI+VG L   K  +V+L G+EKV +++ VL+NTTHNGFPVVD   +
Sbjct  429  GLPFLEAHAEPWLRNISVGNLIRAKEEIVSLSGVEKVSQVLAVLRNTTHNGFPVVD---M  485

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP + +P    ELHG+VLR HLL VL+K++F  ERRR+ E EV E+F+  DLA+R  KIE
Sbjct  486  PPISPVP----ELHGMVLRAHLLEVLEKRWFFRERRRSSEEEVTERFSSWDLAKRGRKIE  541

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
            DV V+++E EMY+DLHP TN TPYTV+ES+SVAKA++LFRQVGLRHM+++PK Q AG SP
Sbjct  542  DVVVSEEEEEMYIDLHPFTNMTPYTVMESMSVAKAVVLFRQVGLRHMLVMPKSQVAGGSP  601

Query  243  VVGILTRQDLRAHNILSVFPHLANSKGSK  157
            VVGILTRQDL A+NI S +PHL     S+
Sbjct  602  VVGILTRQDLIANNIKSAYPHLLRRGKSR  630



>ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=742

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+DA+PEPWMRN+TVGEL DVKP VVTL GIEKV +IV+VLKNTTHNGFPV+D+GVV
Sbjct  579  GLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGIEKVAKIVDVLKNTTHNGFPVMDDGVV  638

Query  603  PPRTALPI-GATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKI  427
             P       GATELHGLVLR HL+  LKKK+F  ERRRTE+ EVR+KFTW++LAER G I
Sbjct  639  VPPVVGQANGATELHGLVLRAHLIQALKKKWFFKERRRTEDWEVRQKFTWVELAEREGSI  698

Query  426  EDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFR  304
            E VAVT +EMEM+VDLHPLTNTTP+TV+ES+SVAKA++LFR
Sbjct  699  EGVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFR  739



>ref|XP_010240516.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Brachypodium distachyon]
Length=662

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 150/213 (70%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G PFL+ H EP+MR ++V ++  V  P+ T  G+EKVGRIV+VLK T HNGFPVVDE   
Sbjct  450  GFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGLEKVGRIVDVLKTTGHNGFPVVDE---  504

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP + +P+    L+GLVLR HLL++L+KK F+S    +     +  F+  D A+R     
Sbjct  505  PPFSDIPL----LYGLVLRAHLLVLLRKKDFISSCTASALDASK-HFSPDDFAKRGSGKH  559

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ +T DEMEM+VDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH+++LPK  ++
Sbjct  560  DRIEDIELTADEMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVLPK--SS  617

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
              +PVVGILTR D    ++L + P+L  S+  K
Sbjct  618  KRAPVVGILTRHDFMPEHVLGLHPYLIKSRWKK  650



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 134/204 (66%), Gaps = 40/204 (20%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PEPWM+++TVGELA  KP  ++L+ +EKV  ++E                  
Sbjct  350  GLPFLEPKPEPWMKDLTVGELAAAKPRTISLQVVEKVSTVLEX-----------------  392

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
                                    VL+K++F  E+RRTEE E RE+F+ ++LA++  KI+
Sbjct  393  -----------------------AVLRKRWFFLEKRRTEEWEARERFSSVELADKNCKID  429

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVSP  244
             + +T +E+EMY+DLHP TNTTPYTVVE++SVAKA++LFR V LRHM+I+PKYQ   +SP
Sbjct  430  GLELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISP  489

Query  243  VVGILTRQDLRAHNILSVFPHLAN  172
            +VGILTRQDLRAHNIL  FPHLA 
Sbjct  490  LVGILTRQDLRAHNILGAFPHLAK  513



>ref|XP_003580671.2| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Brachypodium distachyon]
Length=826

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 150/213 (70%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G PFL+ H EP+MR ++V ++  V  P+ T  G+EKVGRIV+VLK T HNGFPVVDE   
Sbjct  614  GFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGLEKVGRIVDVLKTTGHNGFPVVDE---  668

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP + +P+    L+GLVLR HLL++L+KK F+S    +     +  F+  D A+R     
Sbjct  669  PPFSDIPL----LYGLVLRAHLLVLLRKKDFISSCTASALDASK-HFSPDDFAKRGSGKH  723

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ +T DEMEM+VDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH+++LPK  ++
Sbjct  724  DRIEDIELTADEMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVLPK--SS  781

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
              +PVVGILTR D    ++L + P+L  S+  K
Sbjct  782  KRAPVVGILTRHDFMPEHVLGLHPYLIKSRWKK  814



>ref|XP_009358559.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 148/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L++H EP+MR +TV ++  V  P+   +GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  566  GLPYLESHVEPYMRQLTVADV--VTGPLQLFQGIEKVGNIVHVLRTTGHNGFPVIDE---  620

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L G+VLR HL+ +LKKK F+S    T     +  F+ +D A+R     
Sbjct  621  PPLSETPV----LFGIVLRAHLIELLKKKAFVSNPVLTSTDSFKL-FSSVDFAKRGSGKG  675

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T++EMEM++DLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  676  DKIEDIELTEEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVIPKL--S  733

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +ILS+ P L +S+
Sbjct  734  NRTPVVGILTRHDFMPEHILSLHPMLVSSR  763



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 149/210 (71%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+++  G+   V  P+VT  G+EKV  IV  L++T HNGFPV+DE   
Sbjct  586  GLPYLEAHAEPYMKHLVAGD--AVSGPLVTFSGVEKVESIVHALQSTGHNGFPVIDE---  640

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK KYF +  RR    ++ +KF+  D A+    + 
Sbjct  641  PPFSDTP----ELCGLVLRSHLLVLLKAKYF-TRERRLSGRDILKKFSPFDFAKPGTGKG  695

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+EDV +T++EMEMY+DLHP+TN +PYTV+E++S+AKA +LFRQ+GLRHM ++PK Q  
Sbjct  696  LKLEDVTITEEEMEMYIDLHPITNASPYTVLETMSLAKAKVLFRQIGLRHMCVVPKSQ--  753

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SP+VG+LTR D    +IL ++PH+   K
Sbjct  754  GRSPIVGLLTRHDFMPEHILGLYPHMKQHK  783



>ref|XP_008336976.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=778

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L++H EP+MR +TV ++  V  P+   +G EKVG IV VL+ T HNGFPV+DE   
Sbjct  566  GLPYLESHVEPYMRQLTVADV--VTGPLQLFQGXEKVGNIVHVLRTTGHNGFPVIDE---  620

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L G+VLR HL+ +LKKK F+S          +  F+ +D A+R     
Sbjct  621  PPLSETPV----LFGIVLRAHLIELLKKKAFVSNPVLASXDSFKL-FSSVDFAKRGSGKG  675

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T++EMEM++DLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK    
Sbjct  676  DKIEDIELTEEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVIPKLSXR  735

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +ILS+ P L +S+
Sbjct  736  --TPVVGILTRHDFMPEHILSLHPMLVSSR  763



>ref|XP_004287270.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Fragaria vesca subsp. vesca]
Length=752

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 139/213 (65%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L  H EP+MR +TV ++  V  P+    GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  540  GLPYLKGHAEPYMRQLTVSDV--VTGPLQLFNGIEKVGNIVHVLRTTGHNGFPVIDESP-  596

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP   +  G        LR HL+ +LKKK F+S   RT       +F+  D A+R     
Sbjct  597  PPEPPILFGLV------LRAHLIELLKKKAFVSTPVRTTTDAFE-QFSSEDFAKRGLGNG  649

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T++EMEMY+DLHP TN +PYTVVE++S+AKAL+LFRQVGLRH++++PK  + 
Sbjct  650  DKIEDIELTEEEMEMYIDLHPFTNASPYTVVETMSLAKALILFRQVGLRHLLVIPKMSS-  708

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
             +SP+VGILTR D    +I  + P L +SK  +
Sbjct  709  -MSPIVGILTRHDFMPEHIFGIHPMLVSSKSKR  740



>ref|XP_004287269.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Fragaria vesca subsp. vesca]
Length=780

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 139/213 (65%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L  H EP+MR +TV ++  V  P+    GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  568  GLPYLKGHAEPYMRQLTVSDV--VTGPLQLFNGIEKVGNIVHVLRTTGHNGFPVIDESP-  624

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP   +  G        LR HL+ +LKKK F+S   RT       +F+  D A+R     
Sbjct  625  PPEPPILFGLV------LRAHLIELLKKKAFVSTPVRTTTDAFE-QFSSEDFAKRGLGNG  677

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T++EMEMY+DLHP TN +PYTVVE++S+AKAL+LFRQVGLRH++++PK  + 
Sbjct  678  DKIEDIELTEEEMEMYIDLHPFTNASPYTVVETMSLAKALILFRQVGLRHLLVIPKMSS-  736

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
             +SP+VGILTR D    +I  + P L +SK  +
Sbjct  737  -MSPIVGILTRHDFMPEHIFGIHPMLVSSKSKR  768



>emb|CBI27719.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+M+++   ++  V  P+VT  GIEKVG I+  L+ T HNGFPV+DE   
Sbjct  545  GLPYMEAHAEPYMKHLAARDV--VSGPLVTFSGIEKVGNIMHALRTTGHNGFPVIDE---  599

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F S  +     E+  K+  +D A+    + 
Sbjct  600  PPFTDAP----ELCGLVLRSHLLVLLKGKSF-SRNQVHCGGEILRKYAALDFAKAGSGKG  654

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEMYVDLHP+TN +PYTVVE++S+AKA +LFRQVGLRHM ++PK Q  
Sbjct  655  VKLEDLNIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQVGLRHMCVVPKSQ--  712

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  P+VGILTR D    +IL ++PHL+  K
Sbjct  713  GRPPIVGILTRHDFMPEHILGLYPHLSPHK  742



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 147/209 (70%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF++AH EP+MR++  G++  V  P+++  G+EKVG IV+ L+ T HNGFPVVDE   
Sbjct  597  GLPFMEAHAEPYMRHLVAGDV--VSGPLISFSGVEKVGNIVQALRITGHNGFPVVDE---  651

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+HLL++LK K FM E+ +T  + V ++F   D A+      
Sbjct  652  PPISEAP----ELVGLVLRSHLLVLLKGKTFMKEKVKTSGSFVLQRFGAFDFAKAGSGKG  707

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  708  IKIEDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  765

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR DL   +I  +FP+L  S
Sbjct  766  GRPPIVGILTRHDLMPEHIHGLFPNLRKS  794



>ref|XP_006381102.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP58899.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+AH EP+MR +TVGE+  V+ P+   +GIEKVG+IV VL+ T HNGFPV+DE   
Sbjct  563  GFPYLEAHTEPYMRQLTVGEV--VRGPLQIFQGIEKVGKIVHVLRTTRHNGFPVIDE---  617

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GL+LR HL+ +LKKK F+     T     +  F   D A+R     
Sbjct  618  PPLSESPV----LYGLILRAHLIELLKKKAFVPTPVPTGTDAFKLFFAG-DFAKRGSGNG  672

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T++EMEM++DLHP TN +PYTV E++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  673  DKIEDLQFTEEEMEMFLDLHPFTNASPYTVAETMSLAKALILFREVGLRHLLVIPKI--S  730

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SPVVGILTR D    +IL + P L  S+
Sbjct  731  GRSPVVGILTRHDFMPGHILGLHPMLIRSR  760



>ref|NP_001268085.1| uncharacterized protein LOC100259734 [Vitis vinifera]
 ref|XP_010653021.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653022.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653023.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653024.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653025.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653026.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653027.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 gb|ADK66981.1| chloride channel ClC3 [Vitis vinifera]
Length=780

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+M+++   ++  V  P+VT  GIEKVG I+  L+ T HNGFPV+DE   
Sbjct  583  GLPYMEAHAEPYMKHLAARDV--VSGPLVTFSGIEKVGNIMHALRTTGHNGFPVIDE---  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F S  +     E+  K+  +D A+    + 
Sbjct  638  PPFTDAP----ELCGLVLRSHLLVLLKGKSF-SRNQVHCGGEILRKYAALDFAKAGSGKG  692

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEMYVDLHP+TN +PYTVVE++S+AKA +LFRQVGLRHM ++PK Q  
Sbjct  693  VKLEDLNIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQVGLRHMCVVPKSQ--  750

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  P+VGILTR D    +IL ++PHL+  K
Sbjct  751  GRPPIVGILTRHDFMPEHILGLYPHLSPHK  780



>ref|XP_010057598.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Eucalyptus grandis]
 gb|KCW74787.1| hypothetical protein EUGRSUZ_E03522 [Eucalyptus grandis]
Length=771

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+AH EP+MR +TV ++  VK P+    GIE+VG +V+VL+ TTHNGFPV+DE   
Sbjct  559  GFPYLEAHAEPFMRQLTVSDV--VKGPLQLFHGIERVGNVVQVLRTTTHNGFPVIDE---  613

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
             P +  P+    L+GL+LR HL+ +LKKK F+S    T       +F+ +D A++     
Sbjct  614  SPLSESPV----LYGLILRAHLIELLKKKAFLSSTEPTGIDVSE-QFSVVDFAKKGSGNA  668

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIEDV VT +E  M++DLHP TNT+PYTVVE++S+AKAL+L RQVGLRH++++PK    
Sbjct  669  DKIEDVDVTNEEENMFLDLHPFTNTSPYTVVETMSLAKALILLRQVGLRHLLVIPKIY--  726

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SPVVGILTR D    +ILS  P L  S+
Sbjct  727  GRSPVVGILTRHDFMPEDILSSHPALTRSR  756



>ref|XP_010057599.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Eucalyptus grandis]
Length=700

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+AH EP+MR +TV ++  VK P+    GIE+VG +V+VL+ TTHNGFPV+DE   
Sbjct  488  GFPYLEAHAEPFMRQLTVSDV--VKGPLQLFHGIERVGNVVQVLRTTTHNGFPVIDE---  542

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
             P +  P+    L+GL+LR HL+ +LKKK F+S    T       +F+ +D A++     
Sbjct  543  SPLSESPV----LYGLILRAHLIELLKKKAFLSSTEPTGIDVSE-QFSVVDFAKKGSGNA  597

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIEDV VT +E  M++DLHP TNT+PYTVVE++S+AKAL+L RQVGLRH++++PK    
Sbjct  598  DKIEDVDVTNEEENMFLDLHPFTNTSPYTVVETMSLAKALILLRQVGLRHLLVIPKIY--  655

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SPVVGILTR D    +ILS  P L  S+
Sbjct  656  GRSPVVGILTRHDFMPEDILSSHPALTRSR  685



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 147/209 (70%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF++AH EP+M+++  G++  V  P+++  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  605  GLPFMEAHAEPYMKHLVAGDV--VSGPLISFSGVEKVGNIVHALRITGHNGFPVVDE---  659

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K FM E+ +T  + V  +F   D A+    + 
Sbjct  660  PPVSEAP----ELVGLVLRSHLLVLLKGKTFMKEQAKTSGSFVLRRFGAFDFAKPGSGKG  715

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +E+EMYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  716  LKIEDLDFTDEELEMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  773

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +IL +FP+L+ S
Sbjct  774  GRPPIVGILTRHDFMPEHILGLFPNLSKS  802



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 145/206 (70%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IVE L+ T HNGFPV+DE   
Sbjct  582  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVEALRLTGHNGFPVIDE---  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+HLL++LK K F  ER +T   E+  +F   D A+      
Sbjct  637  PPFSDAP----ELVGLVLRSHLLVLLKGKRFTRERVKTGVKEILRRFGAFDFAKAGSGKG  692

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED+ + +DEM+M+VDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH+ ++PK    
Sbjct  693  LKFEDLNILEDEMDMFVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TP  750

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D  + +IL +FPH+
Sbjct  751  GRPPIVGILTRHDFTSEHILGLFPHI  776



>ref|XP_010905340.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Elaeis guineensis]
Length=645

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 146/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +TV ++  V  P+ T  G+EKVG IV VLK T H+GFPV+DE   
Sbjct  429  GLPYLEAHAEPYMRQLTVSDV--VTGPLQTFHGVEKVGNIVHVLKTTGHHGFPVIDE---  483

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +  P+    L GL+LR HLL++LKKK F+     +     +  F+  D A+R  GK 
Sbjct  484  PPFSDSPV----LFGLILRAHLLVLLKKKEFLHTCALSSFDASK-PFSADDFAKRGSGKH  538

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I+D+ +T +EMEMY+DLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  ++
Sbjct  539  DSIDDIELTVEEMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SS  596

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P L  S+
Sbjct  597  SRAPVVGILTRHDFMPEHILGLHPFLLKSR  626



>ref|XP_011017857.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Populus euphratica]
 ref|XP_011017859.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Populus euphratica]
Length=775

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L++H EP+MR  TVG++  V  P+   +GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  563  GFPYLESHAEPYMRQFTVGDV--VTGPLQVFQGIEKVGNIVHVLRTTRHNGFPVIDE---  617

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GL+LR HL+ +LKKK FMS    T    ++  F+  D AER     
Sbjct  618  PPLSESPV----LYGLILRAHLIELLKKKAFMSAPVPTSIDALKL-FSAGDFAERRSGNG  672

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIE++  T++EMEM++DLHP TN +PY+VVE++S+AKAL+LFR+VGLRH+++ PK   +
Sbjct  673  DKIEELRFTEEEMEMFLDLHPFTNASPYSVVETMSLAKALILFREVGLRHLLVTPKI--S  730

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SPVVGILTR D    +IL + P L  S+
Sbjct  731  GRSPVVGILTRHDFMPEHILGLHPLLIRSR  760



>ref|XP_011084085.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Sesamum indicum]
Length=787

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 144/208 (69%), Gaps = 18/208 (9%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL AH EP+MR +TVG++  V+ P+    G EKVG +V VLK T HNGFPVV+    
Sbjct  563  GLPFLKAHAEPYMRQLTVGDV--VRGPLQIFHGFEKVGNVVNVLKTTQHNGFPVVEN---  617

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +A P+    L GL+LR HLL++LK K F+          +R +F+  D A +WG   
Sbjct  618  PPFSASPV----LFGLILRAHLLILLKSKTFLRTPAPAGRYAIR-RFSDDDFA-KWGFGH  671

Query  432  --KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQA  259
               IED+ ++++EM+MYVDLHP TNT+PYTVVE++S+AKAL LFR+VGLRH++++PK+  
Sbjct  672  DDNIEDIELSEEEMDMYVDLHPFTNTSPYTVVETMSLAKALKLFREVGLRHLLVIPKF--  729

Query  258  AGVSPVVGILTRQDLRAHNILSVFPHLA  175
            +G  PVVGILTR D    +IL++ P LA
Sbjct  730  SGRIPVVGILTRHDFMPEDILNLHPRLA  757



>gb|EEE60792.1| hypothetical protein OsJ_14377 [Oryza sativa Japonica Group]
Length=773

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 146/209 (70%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF++AH EP+MRN+  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  575  GLPFMEAHAEPFMRNLVAGDV--VSGPLITFSGVEKVGNIVHALRITGHNGFPVVDE---  629

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK + FM E+ +T  + V  +F   D A+    + 
Sbjct  630  PPVSEAP----ELVGLVLRSHLLVLLKGRSFMKEKVKTSGSFVLRRFGAFDFAKPGSGKG  685

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T +E++MYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  686  LKIEDLDLTDEELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  743

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP+L  S
Sbjct  744  GRPPIVGILTRHDFMHEHIHGLFPNLGKS  772



>ref|XP_011084086.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Sesamum indicum]
Length=651

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 144/208 (69%), Gaps = 18/208 (9%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL AH EP+MR +TVG++  V+ P+    G EKVG +V VLK T HNGFPVV+    
Sbjct  427  GLPFLKAHAEPYMRQLTVGDV--VRGPLQIFHGFEKVGNVVNVLKTTQHNGFPVVEN---  481

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +A P+    L GL+LR HLL++LK K F+          +R +F+  D A +WG   
Sbjct  482  PPFSASPV----LFGLILRAHLLILLKSKTFLRTPAPAGRYAIR-RFSDDDFA-KWGFGH  535

Query  432  --KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQA  259
               IED+ ++++EM+MYVDLHP TNT+PYTVVE++S+AKAL LFR+VGLRH++++PK+  
Sbjct  536  DDNIEDIELSEEEMDMYVDLHPFTNTSPYTVVETMSLAKALKLFREVGLRHLLVIPKF--  593

Query  258  AGVSPVVGILTRQDLRAHNILSVFPHLA  175
            +G  PVVGILTR D    +IL++ P LA
Sbjct  594  SGRIPVVGILTRHDFMPEDILNLHPRLA  621



>ref|NP_001275140.1| chloride channel protein CLC-c-like [Solanum tuberosum]
 emb|CAA71369.1| chloride channel Stclc1 [Solanum tuberosum]
Length=764

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 144/206 (70%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP+MRN+  G++     P+++  G+EKVG IV  LK T HNGFPV+DE   
Sbjct  567  GLPFLEAHAEPFMRNLVAGDVCS--GPLLSFSGVEKVGNIVHALKYTRHNGFPVIDE---  621

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++L  K F +++R    + +  +F   D A+    + 
Sbjct  622  PPFSETP----ELCGLVLRSHLLVLLNGKKF-TKQRVLSASNILSRFHAFDFAKPGSGKG  676

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED+ +T++EMEMY+DLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  677  LKFEDLVITEEEMEMYIDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KT  734

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G +P+VGILTR D    +I +++PHL
Sbjct  735  GRAPIVGILTRHDFMHEHISNLYPHL  760



>ref|XP_008354360.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=773

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L++H EP+MR +TV ++  V  P+   +GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  561  GLPYLESHVEPYMRQLTVADV--VIGPLQLFQGIEKVGNIVHVLRTTGHNGFPVIDE---  615

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GLVLR HL+ +LKKK F+S   RT     +  F+ +D A+R     
Sbjct  616  PPLSETPV----LYGLVLRAHLIELLKKKAFVSTPVRTSTNSFKL-FSSVDFAKRGSGNG  670

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T++E EM++DLHP TN +PYTVVE++S+AKAL LFR+VGLRH++++PK   +
Sbjct  671  DKIEDIELTEEEKEMFIDLHPFTNASPYTVVETMSLAKALTLFREVGLRHLLVIPKL--S  728

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +ILS+ P L  S+
Sbjct  729  NRSPVVGILTRHDFXPEHILSLHPMLVRSR  758



>gb|EAY94258.1| hypothetical protein OsI_16029 [Oryza sativa Indica Group]
Length=803

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 146/209 (70%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF++AH EP+MRN+  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  605  GLPFMEAHAEPFMRNLVAGDV--VSGPLITFSGVEKVGNIVHALRITGHNGFPVVDE---  659

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK + FM E+ +T  + V  +F   D A+    + 
Sbjct  660  PPVSEAP----ELVGLVLRSHLLVLLKGRSFMKEKVKTSGSFVLRRFGAFDFAKPGSGKG  715

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T +E++MYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  716  LKIEDLDLTDEELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  773

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP+L  S
Sbjct  774  GRPPIVGILTRHDFMHEHIHGLFPNLGKS  802



>dbj|BAB97267.1| chloride channel [Oryza sativa Japonica Group]
Length=801

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 146/209 (70%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF++AH EP+MRN+  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  603  GLPFMEAHAEPFMRNLVAGDV--VSGPLITFSGVEKVGNIVHALRITGHNGFPVVDE---  657

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK + FM E+ +T  + V  +F   D A+    + 
Sbjct  658  PPVSEAP----ELVGLVLRSHLLVLLKGRSFMKEKVKTSGSFVLRRFGAFDFAKPGSGKG  713

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T +E++MYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  714  LKIEDLDLTDEELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  771

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP+L  S
Sbjct  772  GRPPIVGILTRHDFMHEHIHGLFPNLGKS  800



>ref|XP_009392132.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=806

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR +TV ++  V  P+ T  G+EKVG I+ +LK T H+ FPV+DE   
Sbjct  585  GLPYLEDHAEPYMRQLTVSDV--VAGPLRTFNGVEKVGNIIHILKTTGHHAFPVIDE---  639

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP ++ P+    L+GL+LR HLL +LKKK F+     +     + +F   D A+R     
Sbjct  640  PPFSSSPV----LYGLILRAHLLSLLKKKCFLPTCTLSSFDASK-QFVADDFAKRGSGKH  694

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ VT +EMEMY+DLHP TNT+PYTVVE++S+AKAL LFRQVGLRH++I+PK  ++
Sbjct  695  DRIEDIEVTAEEMEMYIDLHPFTNTSPYTVVETMSLAKALTLFRQVGLRHLLIVPK--SS  752

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P L  S+
Sbjct  753  CRAPVVGILTRHDFMPEHILGLHPFLVKSR  782



>ref|XP_008368156.1| PREDICTED: chloride channel protein CLC-c-like [Malus domestica]
Length=778

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +   ++A    P+VT  GIEKVGRI++ L+ T HNGFPV+DE   
Sbjct  580  GLPYLEAHAEPYMRQLVTADVA--TGPLVTFSGIEKVGRILDALRTTGHNGFPVIDE---  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+HLL++LK K F S  R   E E+  +F   + A+      
Sbjct  635  PPFSDAP----ELCGLVLRSHLLILLKGKVF-SRERVVCEEEILGRFAAFNFAKAGSGKG  689

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EM+MYVDLHP+TN +PYTVVE++S+AKA +LFRQ+GLRH+ ++PK Q  
Sbjct  690  IKVEDLDIEEEEMDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--  747

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  P+VGILTR D    +IL ++PH+   K
Sbjct  748  GRPPIVGILTRHDFMPEHILGLYPHIKAHK  777



>ref|XP_010905336.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905338.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905339.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
Length=779

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 146/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +TV ++  V  P+ T  G+EKVG IV VLK T H+GFPV+DE   
Sbjct  563  GLPYLEAHAEPYMRQLTVSDV--VTGPLQTFHGVEKVGNIVHVLKTTGHHGFPVIDE---  617

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +  P+    L GL+LR HLL++LKKK F+     +     +  F+  D A+R  GK 
Sbjct  618  PPFSDSPV----LFGLILRAHLLVLLKKKEFLHTCALSSFDASK-PFSADDFAKRGSGKH  672

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I+D+ +T +EMEMY+DLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  ++
Sbjct  673  DSIDDIELTVEEMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SS  730

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P L  S+
Sbjct  731  SRAPVVGILTRHDFMPEHILGLHPFLLKSR  760



>ref|XP_009363967.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L++H EP+MR +TV ++  V  P+   +GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  566  GLPYLESHVEPYMRQLTVADV--VIGPLQLFQGIEKVGNIVHVLRTTGHNGFPVIDE---  620

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GLVLRTHL+ +LKKK F+S   RT     +  F+ +D A+R     
Sbjct  621  PPLSETPV----LYGLVLRTHLIELLKKKAFVSTPVRTSTNSFKL-FSSVDFAKRGSGNG  675

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T++E EM++DLHP TN +PYTVVE++S+AKAL LFR+VGLRH++++PK   +
Sbjct  676  DKIEDIELTEEEKEMFIDLHPFTNASPYTVVETMSLAKALTLFREVGLRHLLVIPKL--S  733

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +ILS+ P L  S+
Sbjct  734  NRSPVVGILTRHDFMPEHILSLHPMLVRSR  763



>ref|XP_004975700.1| PREDICTED: chloride channel protein CLC-c-like isoform X3 [Setaria 
italica]
Length=844

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 145/209 (69%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G+PFL+AH EP+MR +  G++  V  P+++  G+E+VG IV+ L+ T HNGFPVVDE   
Sbjct  646  GMPFLEAHAEPYMRQLVAGDV--VSGPLISFSGVERVGNIVQALRITGHNGFPVVDE---  700

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+HLL++LK K FM E+ +T  + V +KF   D A+      
Sbjct  701  PPLSEAP----ELVGLVLRSHLLVLLKGKGFMKEKVKTSGSFVLKKFGAFDFAKAGSGKG  756

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  757  LKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  814

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP+L  S
Sbjct  815  GRPPIVGILTRHDFMPEHIHGLFPNLHKS  843



>gb|EMT23162.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=1241

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 149/213 (70%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G PFL+ H EP+MR ++V ++  V  P+ T  GIEKVGRIV++LK T HNGFPVVDE   
Sbjct  603  GFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGIEKVGRIVDILKATGHNGFPVVDE---  657

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GLVLR+HLL++L+KK F+S    +     +  F+  D A+R     
Sbjct  658  PPFSDTPL----LYGLVLRSHLLVLLRKKEFISSSTASASDASK-HFSPEDFAKRGSGKH  712

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ +T +E+EM+VDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH+++LPK   +
Sbjct  713  DRIEDIELTAEELEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVLPK--TS  770

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
              +PVVGILTR D    ++L + P+L  S+  K
Sbjct  771  KRAPVVGILTRHDFMPEHVLGLHPYLFKSRWKK  803



>ref|XP_004975698.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Setaria 
italica]
Length=875

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 145/209 (69%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G+PFL+AH EP+MR +  G++  V  P+++  G+E+VG IV+ L+ T HNGFPVVDE   
Sbjct  677  GMPFLEAHAEPYMRQLVAGDV--VSGPLISFSGVERVGNIVQALRITGHNGFPVVDE---  731

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+HLL++LK K FM E+ +T  + V +KF   D A+      
Sbjct  732  PPLSEAP----ELVGLVLRSHLLVLLKGKGFMKEKVKTSGSFVLKKFGAFDFAKAGSGKG  787

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  788  LKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  845

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP+L  S
Sbjct  846  GRPPIVGILTRHDFMPEHIHGLFPNLHKS  874



>ref|XP_009768532.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
Length=775

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 144/206 (70%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP+MR++  G++     P+++  G+EKVG IV  LK T HNGFPV+DE   
Sbjct  578  GLPFLEAHAEPFMRHLVAGDVCS--GPLLSFSGVEKVGNIVHALKYTRHNGFPVIDE---  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++L  K FM +R  +  + +R +F   D A+    + 
Sbjct  633  PPFSEAP----ELCGLVLRSHLLVLLNGKKFMKQRVLSGSSILR-RFHAFDFAKPGSGKG  687

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED+ +T++EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  688  LKFEDLVITQEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KT  745

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G +P+ GILTR D    +I +++PHL
Sbjct  746  GRAPIAGILTRHDFMHEHISNLYPHL  771



>ref|XP_003609433.1| hypothetical protein MTR_4g115640 [Medicago truncatula]
 gb|AES91630.1| ClC chloride channel family protein [Medicago truncatula]
Length=776

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 141/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR +TVG++  V  P+    GIEKV  IV +L+ T HNGFPV+DE   
Sbjct  561  GLPYLETHAEPYMRQLTVGDV--VTGPLQMFNGIEKVRNIVFILRTTAHNGFPVIDE---  615

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  PI    L G++LR HL  +LKKK F+          VR KF+  D A+++    
Sbjct  616  PPGSEAPI----LFGIILRHHLTTLLKKKAFLPSPVANSYDVVR-KFSSDDFAKKYSVER  670

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T++EM M+VDLHP TN +PYTVVE++S+AKAL+LFR+VGLRH++++PK    
Sbjct  671  VKIEDIQLTEEEMGMFVDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVIPKIP--  728

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SPVVGILTR D    +IL + P L  S+
Sbjct  729  GRSPVVGILTRHDFTPEHILGMHPFLVKSR  758



>ref|XP_004248849.1| PREDICTED: chloride channel protein CLC-c-like [Solanum lycopersicum]
Length=778

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 144/206 (70%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP+MRN+  G++     P+++  G+EKVG IV  LK + HNGFPV+DE   
Sbjct  581  GLPFLEAHAEPFMRNLVAGDVCS--GPLLSFSGVEKVGNIVHALKYSRHNGFPVIDE---  635

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++L  K F +++R    + +  +F   D A+    + 
Sbjct  636  PPFSETP----ELCGLVLRSHLLVLLNGKKF-TKQRVLSASNILSRFHAFDFAKPGSGKG  690

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED+ +T++EMEMY+DLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  691  LKFEDLVITEEEMEMYIDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KT  748

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G +P+VGILTR D    +I +++PHL
Sbjct  749  GRAPIVGILTRHDFMHEHISNLYPHL  774



>ref|XP_009599120.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=775

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 144/206 (70%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP+MR++  G++     P+++  G+EKVG IV  LK T HNGFPV+DE   
Sbjct  578  GLPFLEAHAEPFMRHLVAGDVCS--GPLLSFSGVEKVGNIVHALKYTRHNGFPVIDE---  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++L  K FM +R  +  + +R +F   D A+    + 
Sbjct  633  PPFSEAP----ELCGLVLRSHLLVLLNGKKFMKQRVLSGSSILR-RFHAFDFAKPGSGKG  687

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED+ +T++EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  688  LKFEDLVITQEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KT  745

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G +P+ GILTR D    +I +++PHL
Sbjct  746  GRAPIAGILTRHDFMHEHISNLYPHL  771



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 145/212 (68%), Gaps = 17/212 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR ++VG++  V  P+ T  G+EKV  IV +L+ T HNGFPV+DE   
Sbjct  561  GLPYLETHAEPYMRQLSVGDV--VTGPLQTFNGVEKVCNIVFILRTTGHNGFPVIDE---  615

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L G++LR HLL +LKKK FMS    T    +  +F+  D A++     
Sbjct  616  PPISQAPV----LFGIILRDHLLTLLKKKAFMSSPMATSGDVIN-EFSADDFAKKGSSKG  670

Query  432  --KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQA  259
              KIED+ ++++EM+M++DLHP TN +PYTVVE++S+ KAL LFR++GLRH++++PK+  
Sbjct  671  RLKIEDIQLSEEEMDMFIDLHPFTNASPYTVVETMSLGKALTLFRELGLRHLLVVPKF--  728

Query  258  AGVSPVVGILTRQDLRAHNILSVFPHLANSKG  163
            +G SPVVGILTR D  + +IL + P L  + G
Sbjct  729  SGRSPVVGILTRHDFMSEHILGLHPFLVRNTG  760



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 145/212 (68%), Gaps = 17/212 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR ++VG++  V  P+ T  G+EKV  IV +L+ T HNGFPV+DE   
Sbjct  561  GLPYLETHAEPYMRQLSVGDV--VTGPLQTFNGVEKVCNIVFILRTTGHNGFPVIDE---  615

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L G++LR HLL +LKKK FMS    T    +  +F+  D A++     
Sbjct  616  PPISQAPV----LFGIILRDHLLTLLKKKAFMSSPMATSGDVIN-EFSADDFAKKGSSKG  670

Query  432  --KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQA  259
              KIED+ ++++EM+M++DLHP TN +PYTVVE++S+ KAL LFR++GLRH++++PK+  
Sbjct  671  RLKIEDIQLSEEEMDMFIDLHPFTNASPYTVVETMSLGKALTLFRELGLRHLLVVPKF--  728

Query  258  AGVSPVVGILTRQDLRAHNILSVFPHLANSKG  163
            +G SPVVGILTR D  + +IL + P L  + G
Sbjct  729  SGRSPVVGILTRHDFMSEHILGLHPFLVRNTG  760



>ref|XP_006389435.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP48349.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L++H EP+MR +TVG++  V  P+   +GIEKVG IV VL+ T HNGFPVVDE   
Sbjct  563  GFPYLESHAEPYMRQLTVGDV--VTGPLQVFQGIEKVGNIVHVLRTTRHNGFPVVDE---  617

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GL+LR HL+ +LKKK FMS    T    ++  F+  D AER     
Sbjct  618  PPLSEPPV----LYGLILRAHLIELLKKKAFMSAPVPTSIDALKL-FSAGDSAERGSGNG  672

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIE++  T++EMEM++DLHP TN +PYTVVE++S+AKAL+LFR+VGLRH++++ +   +
Sbjct  673  DKIEELRFTEEEMEMFLDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVMSRI--S  730

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SPVVGILTR D    +IL + P L  S+
Sbjct  731  GRSPVVGILTRHDFMPEHILGLHPLLIRSR  760



>gb|EMS56130.1| Putative chloride channel-like protein CLC-g [Triticum urartu]
Length=866

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 149/214 (70%), Gaps = 16/214 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G PFL+ H EP+MR ++V ++  V  P+ T  GIEKVGRIV+ LK T HNGFPVVDE   
Sbjct  660  GFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGIEKVGRIVDTLKATGHNGFPVVDE---  714

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GLVLR+HLL++L+KK F+S    +     +  F+  D A+R     
Sbjct  715  PPFSDTPL----LYGLVLRSHLLVLLRKKEFISSSTASASDASK-HFSPEDFAKRGSGKH  769

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ +T +E+EM+VDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH+++LPK   +
Sbjct  770  DRIEDIELTAEELEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVLPK--TS  827

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSKK  154
              +PVVGILTR D    ++L + P+L  S+  K+
Sbjct  828  KRAPVVGILTRHDFMPEHVLGLHPYLFKSRWKKE  861



>ref|XP_008801913.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801914.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=778

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 146/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +TV ++  V  P+    G+EKVG IV VLK T H+GFPV+DE   
Sbjct  562  GLPYLEAHAEPYMRQLTVSDV--VTGPLQIFHGVEKVGNIVHVLKTTGHHGFPVIDE---  616

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +  P+    L GLVLR HLL++LKK+ F+     +     + +F+  D A+R  GK 
Sbjct  617  PPFSDSPV----LFGLVLRAHLLVLLKKREFLHTCALSGVDASK-QFSADDFAKRGSGKR  671

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I+D+ +T +EMEMY+DLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  ++
Sbjct  672  DSIDDIELTTEEMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SS  729

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P L  S+
Sbjct  730  SRAPVVGILTRHDFMPEHILGLHPCLLKSR  759



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 139/210 (66%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +  G++     P++T  G+EKVG I+  LK T HNGFPV+D    
Sbjct  584  GLPYLEAHAEPYMRQLVAGDVC--SGPLITFSGVEKVGNIIHALKFTRHNGFPVID---A  638

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    E  GL LR+HLL++LK K F ++      + +   F   D A+    + 
Sbjct  639  PPFSDAP----EFCGLALRSHLLVLLKGKKF-TKLSVLSGSSILRSFHAFDFAKPGSGKG  693

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED++ T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK +  
Sbjct  694  PKLEDLSFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK-KTT  752

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  P+VGILTR D    +I  ++PHL + K
Sbjct  753  GRDPIVGILTRHDFMPEHIKGLYPHLVHHK  782



>ref|XP_009418228.1| PREDICTED: putative chloride channel-like protein CLC-g [Musa 
acuminata subsp. malaccensis]
Length=801

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 146/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+LD H EP+MR++TVG++  V  P+ T  G+EKVG +V +LK T H+ FPV+DE   
Sbjct  580  GLPYLDDHAEPYMRHLTVGDV--VAGPLRTFNGVEKVGNVVHILKTTGHHAFPVIDE---  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP ++ P+    L+GLVLR HLL +LKKK F+  R          +F   +L +R     
Sbjct  635  PPFSSSPV----LYGLVLRAHLLSLLKKKRFLPTRSVAGLDAAG-QFGADELGKRGSGKH  689

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             ++EDV V+ +EMEM+VDLHP TN++PYTVVE++S+AKAL+LFR++GLRH++I+PK  ++
Sbjct  690  DRVEDVEVSAEEMEMFVDLHPFTNSSPYTVVETMSLAKALILFREMGLRHLLIVPK--SS  747

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D  A +IL + P L  S+
Sbjct  748  SRAPVVGILTRHDFMAEHILGLHPFLRKSR  777



>ref|XP_008786445.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=778

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 144/206 (70%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPV+DE   
Sbjct  580  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVHALRLTGHNGFPVIDE---  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K F  ER RT   E+ ++F   D A+    + 
Sbjct  635  PPFSDAP----ELCGLVLRSHLLVLLKGKRFTKERVRTGVTELLQRFGAFDFAKPGSGKG  690

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED+ + ++EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  691  LKFEDLDIQEEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHLCVVPK--TP  748

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    +IL +FPH 
Sbjct  749  GRPPIVGILTRHDFVPEHILGLFPHF  774



>ref|XP_006453099.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453100.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453101.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006474404.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474405.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X2 [Citrus sinensis]
 gb|ESR66339.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66340.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66341.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
Length=794

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 141/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP+MR +TVG++  V  P+    GIEK G +V VL+ T HNGFPV+DE   
Sbjct  582  GFPYLETHVEPYMRQLTVGDV--VTAPLQLFHGIEKAGNVVHVLRTTRHNGFPVIDEN--  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
             P +  PI    L+GL+LR HL+ +LKKK F+     T       +F+ +D A+R     
Sbjct  638  -PLSETPI----LYGLILRAHLITLLKKKAFLPTPNPTVNDAFS-QFSAVDFAKRGSGNG  691

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ ++++EMEMYVDLHP  N +PYTVVE++S+AKAL+LFR+VGLRH++++PK    
Sbjct  692  DKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFREVGLRHLLVIPKISNG  751

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL++ P LA S+
Sbjct  752  --SPVVGILTRHDFMPEHILALNPLLARSR  779



>ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
 gb|EMJ05467.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
Length=777

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +TV ++  V  P+    GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  565  GLPYLEAHVEPYMRQLTVADV--VTGPLQLFYGIEKVGNIVHVLRTTGHNGFPVIDE---  619

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
             P +  P+    L G+VLR HL+ +LKKK F+S    T     + +F+  D A+R     
Sbjct  620  LPLSESPV----LFGIVLRAHLIELLKKKAFVSTPVPTSTDSFK-RFSSEDFAKRGSGNG  674

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ + ++E+EM++DLHP TN +PYTVVE++S+AKAL+LFR+VGLRH++++PK    
Sbjct  675  DKIEDIKLNEEELEMFIDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVIPKISTR  734

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +ILS+ P L NS+
Sbjct  735  --SPVVGILTRHDFMPEHILSLNPMLVNSR  762



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 139/210 (66%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +  G++     P++T  G+EKVG I+  LK T HNGFPV+D    
Sbjct  582  GLPYLEAHAEPYMRQLVAGDVC--SGPLITFSGVEKVGNIIHALKFTRHNGFPVID---A  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    E  GL LR+HLL++LK K F ++      + +   F   D A+    + 
Sbjct  637  PPFSDAP----EFCGLALRSHLLVLLKAKKF-TKLSVLSGSSILRSFHAFDFAKPGSGKG  691

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED++ T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK +  
Sbjct  692  PKLEDLSFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK-KTT  750

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  P+VGILTR D    +I  ++PHL + K
Sbjct  751  GRDPIVGILTRHDFMPEHIKGLYPHLVHHK  780



>ref|XP_002454002.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
 gb|EES06978.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
Length=817

 Score =   166 bits (419),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 143/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  611  GLPFMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVHALRLTGHNGFPVVDE---  665

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLV R+HLL++L  K FM ER +T  + V  +F   D A+    + 
Sbjct  666  PPITEAP----ELVGLVTRSHLLVLLNSKNFMKERFKTSGSFVLRRFGAFDFAKPGSGKG  721

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH++++PK    
Sbjct  722  LKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLLVVPK--TP  779

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I S+FP+L
Sbjct  780  DRPPIVGILTRHDFMPEHIHSLFPNL  805



>ref|XP_010928311.1| PREDICTED: putative chloride channel-like protein CLC-g [Elaeis 
guineensis]
Length=790

 Score =   165 bits (418),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 147/210 (70%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR +TV ++  V  P+ T  G+E+VG IV VLK T H+GFPV+DE   
Sbjct  569  GLPYLEGHAEPYMRQLTVSDV--VTGPLQTFNGVERVGNIVHVLKTTGHHGFPVIDE---  623

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP ++ P+    L GL+LR HLL++LKKK F+  R R+     +  F   D A+R     
Sbjct  624  PPFSSTPV----LFGLILRAHLLVLLKKKDFLPTRSRSNVDASKM-FVANDFAKRSSGKH  678

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ +T +EMEM++DLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  ++
Sbjct  679  DRIEDIELTAEEMEMFLDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SS  736

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P+L  S+
Sbjct  737  PRAPVVGILTRHDFMPEHILGLHPYLMRSR  766



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF+++H EP+MR++  G++  V  P++T  G+EKVG I+  LK T HNGFPV+DE   
Sbjct  576  GLPFMESHAEPYMRHLVAGDV--VSGPLITFNGVEKVGNILHALKTTGHNGFPVIDE---  630

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K F S  R     EV ++F   D A+    + 
Sbjct  631  PPISEAP----ELCGLVLRSHLLVLLKGKKF-SSERVLTGDEVLQRFDAFDFAKAGSGKG  685

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + +DEME+YVDLHP+TN +PYTVVE++S+AKA LLFR++GLRH+ ++PK    
Sbjct  686  VKLEDLHIEEDEMELYVDLHPITNASPYTVVETMSLAKAALLFRELGLRHLCVVPK--TP  743

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  P+VGILTR D    +IL ++P+L   K
Sbjct  744  GRPPIVGILTRHDFTPEHILGIYPNLKAQK  773



>ref|XP_006852872.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
 gb|ERN14339.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
Length=785

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+T G++  V  P+    G+E+V  IV +L+ T HNGFPVVDE   
Sbjct  568  GLPYLEAHAEPYMKNLTAGDV--VVGPLHIFNGVERVCNIVHLLRATKHNGFPVVDE---  622

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L GLVLR HLL++LKK+ F S        +  + F++ D A+R     
Sbjct  623  PPNSESPV----LFGLVLRAHLLMLLKKREF-SHTPALVGVDAFKHFSFDDFAKRGSGKG  677

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ ++ +EMEM+VDLHP  NT+PYTVVE++S+AKAL+LFRQVGLRH++++PK    
Sbjct  678  DQIEDIELSDEEMEMFVDLHPFANTSPYTVVETMSLAKALILFRQVGLRHLLVVPKTH--  735

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G +PVVGILTR D    ++L + P+L  S+
Sbjct  736  GRAPVVGILTRHDFMPEHVLGLHPYLKGSQ  765



>ref|XP_004962544.1| PREDICTED: chloride channel protein CLC-a-like isoform X1 [Setaria 
italica]
Length=876

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 137/179 (77%), Gaps = 8/179 (4%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PE WM+++TVGELA  KP  VTL+ +EKV  IV VL+ T HNGFPV+D    
Sbjct  594  GLPFLEPKPETWMKDLTVGELAAAKPRAVTLQVVEKVSTIVAVLRATPHNGFPVLDR---  650

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR HL+ VL+K++F+ E+RRTEE E RE+F+  +LAE+ G I+
Sbjct  651  -PRP----GVSELHGLVLRQHLMAVLRKRWFLQEKRRTEEWEARERFSSTELAEKAGSID  705

Query  423  DVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGVS  247
            DV ++ +E++MY+DLHP TNTTPYTVVE++SVAKA++LFR   LRHM+I+PK+Q   VS
Sbjct  706  DVQLSPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQGLEVS  764



>ref|XP_003573678.1| PREDICTED: putative chloride channel-like protein CLC-g [Brachypodium 
distachyon]
Length=806

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 136/210 (65%), Gaps = 14/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP LD H EP+MR +TVG++  V  P+ +  G+EKV  +V VL+ T H+ FPVVDE   
Sbjct  581  GLPHLDGHAEPYMRQLTVGDV--VAGPLRSFGGVEKVAHVVHVLRTTGHHAFPVVDE---  635

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP    P+       ++    L+L+ KK++FM+   R  +  +  +F   D  +R  GK 
Sbjct  636  PPFAQSPV---LYGLVLRAHLLVLLKKKEFFMATPVRCAKESIAGRFEAQDFDKRGSGKQ  692

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              +EDV ++ +EMEMYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  A 
Sbjct  693  DAVEDVEISAEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--AC  750

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P L   +
Sbjct  751  DRSPVVGILTRHDFMPEHILGLHPVLLGGR  780



>gb|KDO73468.1| hypothetical protein CISIN_1g003801mg [Citrus sinensis]
Length=794

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 141/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP+MR +TVG++  V  P+    GIEK G +V VL+ T HNGFPV+DE   
Sbjct  582  GFPYLETHVEPYMRQLTVGDV--VTAPLQLFHGIEKAGNVVHVLRTTRHNGFPVIDEN--  637

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
             P +  PI    L+GL+LR HL+ +LKKK F+     T       +F+ +D A+R     
Sbjct  638  -PLSETPI----LYGLILRAHLITLLKKKAFLPTPNPTVNDAFS-QFSAVDFAKRGSGNG  691

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ ++++EMEMYVDLHP  N +PYTVVE++S+AKAL+LFR+VGLRH++++PK    
Sbjct  692  DKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFREVGLRHLLVIPKISNG  751

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPV+GILTR D    +IL++ P LA S+
Sbjct  752  --SPVMGILTRHDFMPEHILALNPLLARSR  779



>ref|XP_011020210.1| PREDICTED: putative chloride channel-like protein CLC-g [Populus 
euphratica]
Length=806

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+AH EP+MR +TVG++  V  P+   RGIE+VG+IV VL+ T HNGFPV+DE   
Sbjct  594  GFPYLEAHTEPYMRQLTVGDV--VCGPLQIFRGIEQVGKIVHVLRTTRHNGFPVIDE---  648

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L+GL+LR HLL +LKKK F+     T     +  F+  D A+R     
Sbjct  649  PPLSESPV----LYGLILRAHLLELLKKKAFVPTPVPTGTDAFKL-FSADDFAKRGSGNG  703

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T++EMEM++DLHP TN +PYTV E++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  704  DKIEDLQFTEEEMEMFLDLHPFTNASPYTVAETMSLAKALILFREVGLRHLLVIPKI--S  761

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  PVVGILTR D    +IL + P L  S+
Sbjct  762  GRPPVVGILTRHDFMPGHILGLHPMLIRSR  791



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 144/206 (70%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPV+DE   
Sbjct  580  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFAGVEKVGNIVHALRLTGHNGFPVIDE---  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K F  ER RT   E+ ++F   D A+    + 
Sbjct  635  PPFSDAP----ELCGLVLRSHLLVLLKGKRFTKERVRTGVGELLQRFGAFDFAKPGSGKG  690

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED+ + ++EM+MY+DLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  691  MKFEDLDIQEEEMDMYLDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHLCVVPK--TP  748

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    +IL +FPH 
Sbjct  749  GRPPIVGILTRHDFVPEHILGLFPHF  774



>ref|XP_008242835.1| PREDICTED: putative chloride channel-like protein CLC-g [Prunus 
mume]
Length=775

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 140/210 (67%), Gaps = 18/210 (9%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +TV ++  V  P+    GIEKVG IV VL+ T HNGFPV+DE   
Sbjct  565  GLPYLEAHVEPYMRQLTVADV--VTGPLQLFYGIEKVGNIVHVLRTTGHNGFPVIDELSE  622

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
             P          L G+VLR HL+ +LKKK F+S    T     + +F+  D A+R     
Sbjct  623  SP---------VLFGIVLRAHLIELLKKKAFVSTPVPTSTDSFK-QFSSEDFAKRGSGNG  672

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ + ++EMEM++DLHP TN +PYTVVE++S+AKAL+LFR+VGLRH++++PK    
Sbjct  673  DKIEDIKLNEEEMEMFIDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVIPKISTR  732

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +ILS+ P L NS+
Sbjct  733  --SPVVGILTRHDFMPEHILSLNPTLVNSR  760



>ref|XP_009401373.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=786

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +TVG++  V  P+    G+EKV  IV +LK T H+GFPVVDE   
Sbjct  570  GLPYLEAHAEPYMRQLTVGDV--VGGPLQIFNGVEKVSNIVHLLKTTGHHGFPVVDE---  624

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP ++ P+    L GL+LR HLL++LKKK F+  R        + +F+  D A+R  GK 
Sbjct  625  PPFSSSPV----LFGLILRAHLLVLLKKKTFLHARTLVSIDVSK-QFSAEDFAKRGSGKH  679

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              IE + +T +EM+MYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  ++
Sbjct  680  ENIEGIDLTAEEMDMYVDLHPYTNTSPYTVVETMSLAKALILFREVGLRHLLVIPK--SS  737

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL   P L  S+
Sbjct  738  SRAPVVGILTRHDFMPEHILGTHPFLLQSR  767



>ref|NP_001183936.1| chloride channel protein [Zea mays]
 gb|ACV66338.1| chloride channel protein [Zea mays]
Length=792

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 146/193 (76%), Gaps = 14/193 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+  PE WM+++ VGELA  KP VVTL+ IEKV  +VEVL++T HNGFPV+D    
Sbjct  599  GLPFLEPKPETWMKDLAVGELAAAKPRVVTLQVIEKVSTVVEVLRSTPHNGFPVLDW---  655

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
             PR     G +ELHGLVLR+HL+ VLKK++F++++RRTEE E RE+F+  +LAE+ G I+
Sbjct  656  -PRP----GVSELHGLVLRSHLMAVLKKRWFLTDKRRTEEWEARERFSSTELAEKSGSID  710

Query  423  DVAV--TKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAGV  250
            +VAV  T +E++MY+DLHP TNTTPYTVVE++SVAKA++LFR   LRHM+I+PK+Q    
Sbjct  711  EVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQG---  767

Query  249  SPVVGILTRQDLR  211
             P V   + QD R
Sbjct  768  -PEVRATSCQDPR  779



>ref|NP_001105216.1| LOC542114 [Zea mays]
 gb|AAP04392.2| chloride channel [Zea mays]
Length=786

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 142/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPV+DE   
Sbjct  580  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVHALRLTGHNGFPVIDE---  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLV R+HLL++L  K FM  R +T  + V  +F   D A+    + 
Sbjct  635  PPITETP----ELVGLVTRSHLLVLLNSKNFMKGRVKTSGSFVLRRFGAFDFAKPGSGKG  690

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH++++PK    
Sbjct  691  LKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLLVVPK--TP  748

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I S+FP+L
Sbjct  749  DRPPIVGILTRHDFMPEHIHSLFPNL  774



>ref|NP_001047143.2| Os02g0558100 [Oryza sativa Japonica Group]
 dbj|BAF09057.2| Os02g0558100, partial [Oryza sativa Japonica Group]
Length=659

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 142/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  453  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVHALRFTGHNGFPVVDE---  507

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLV R+HLL++L  K FM ++ +T  + V ++F   D A+    + 
Sbjct  508  PPLTEAP----ELVGLVTRSHLLVLLNGKMFMKDQLKTSGSFVLQRFGAFDFAKPGSGKG  563

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KI+D+  T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  564  LKIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALGLRHLLVVPK--TP  621

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I  +FP+L
Sbjct  622  DRPPIVGILTRHDFVEEHIHGLFPNL  647



>gb|ADW93911.1| chloride channel 1 [Hordeum vulgare subsp. vulgare]
Length=799

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 145/209 (69%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPF++AH EP+MR++   ++  V  P+++  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  601  GLPFMEAHAEPYMRHLVASDV--VSGPLISFSGVEKVGNIVHALRITGHNGFPVVDE---  655

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++L  + FM E+ +T  + V  +F   D A+    + 
Sbjct  656  PPVSEAP----ELVGLVLRSHLLVLLNGRNFMKEKVKTSGSFVLRRFGAFDFAKPGSGKG  711

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T++EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  712  MKIEDLDFTEEEMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  769

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR DL   +I  +FP+L  S
Sbjct  770  GRFPIVGILTRHDLMPEHIHGLFPNLRKS  798



>ref|XP_002447895.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
 gb|EES12223.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
Length=798

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 146/209 (70%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP MR++  G++  V  P+++  G+E+VG IV+ L+ T HNGFPVVDE   
Sbjct  600  GLPFLEAHAEPHMRHLVAGDV--VSGPLISFSGVERVGNIVQALRITGHNGFPVVDE---  654

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K FM E+ +T  + V ++F   D A+    + 
Sbjct  655  PPLSEAP----ELVGLVLRSHLLVLLKGKGFMKEKMKTSGSFVLQRFGAFDFAKPGSGKG  710

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  711  LKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TP  768

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP++  S
Sbjct  769  GRPPIVGILTRHDFMPEHIHGLFPNIHKS  797



>ref|XP_007155066.1| hypothetical protein PHAVU_003G170300g [Phaseolus vulgaris]
 gb|ESW27060.1| hypothetical protein PHAVU_003G170300g [Phaseolus vulgaris]
Length=800

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 142/212 (67%), Gaps = 17/212 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR +TVG++  V  P+ TL GIEKV  IV +LK T HNGFPV+DE   
Sbjct  596  GLPYLETHAEPYMRQLTVGDV--VTGPLQTLNGIEKVRNIVFILKTTGHNGFPVIDE---  650

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L G++LR HLL +LK K F+S    T    +  KF+  D A++     
Sbjct  651  PPMSEAPV----LFGIILRDHLLTLLKNKVFISSPSATTGNVLN-KFSADDFAKKGSSKV  705

Query  432  --KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQA  259
              KIED+ + ++EM+M++DLHP TN +PYTVVE++S+ KAL LFR++GLRH++++PK  +
Sbjct  706  RLKIEDIQLLEEEMDMFIDLHPFTNASPYTVVETMSLGKALTLFRELGLRHLLVIPKISS  765

Query  258  AGVSPVVGILTRQDLRAHNILSVFPHLANSKG  163
               SPVVGILTR D    +IL + P LA + G
Sbjct  766  R--SPVVGILTRHDFMPEHILGLHPLLARNTG  795



>gb|KJB46914.1| hypothetical protein B456_008G001200 [Gossypium raimondii]
Length=761

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 144/206 (70%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AHPEP+M+++   ++  V  P++T  G+EKVG I+  LKNT HNGFPV+DE   
Sbjct  564  GLPYMEAHPEPYMKHLIARDV--VTGPLITFSGVEKVGNILHALKNTGHNGFPVIDE---  618

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+ LL++LK K F S+ R     +V  K + +D A+      
Sbjct  619  PPFSDAP----ELCGLVLRSKLLVLLKGKAF-SKDRVLAGNKVLRKISELDFAKAGSGKG  673

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++E +MYVDLHP+ NT+PYTVVE++S+AKA +LFR++GLRHM ++PK Q  
Sbjct  674  LKLEDLDIQEEEWDMYVDLHPIANTSPYTVVETMSLAKAAVLFRELGLRHMCVVPKSQ--  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D +  +IL ++PH+
Sbjct  732  GRPPIVGILTRHDFQPEHILGLYPHI  757



>ref|NP_001169702.1| uncharacterized protein LOC100383583 [Zea mays]
 gb|ACN34587.1| unknown [Zea mays]
Length=341

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 142/210 (68%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP LD H EP+MR + VG++  V  P+ +  G+EKVG +V  L+ T H+ FPVVDE   
Sbjct  117  GLPHLDGHAEPYMRQLAVGDV--VAGPLRSFGGVEKVGNVVHTLRTTGHHAFPVVDE---  171

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +  P+    L+GLVLR HLL++LKK+ F+    R  +  V E+F   D  +R  GK 
Sbjct  172  PPFSPAPV----LYGLVLRAHLLVLLKKREFLVAPERCPKEYVAERFQAEDFDKRGSGKQ  227

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I DV ++ +EMEMYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  A 
Sbjct  228  DTIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--AC  285

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P L  S+
Sbjct  286  DRSPVVGILTRHDFMPEHILELHPVLLRSR  315



>gb|KHG08138.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=708

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 144/206 (70%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AHPEP+M+++   ++  V  P++T  G+EKVG I+  LKNT HNGFPV+DE   
Sbjct  511  GLPYMEAHPEPYMKHLIARDV--VTGPLITFSGVEKVGNILLALKNTGHNGFPVIDE---  565

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+ LL++LK K F S+ R     +V  K + +D A+      
Sbjct  566  PPFSDAP----ELCGLVLRSQLLVLLKGKAF-SKDRVLAGNKVLRKISELDFAKAGSGKG  620

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++E +MYVDLHP+ NT+PYTVVE++S+AKA +LFR++GLRHM ++PK Q  
Sbjct  621  LKLEDLDIQEEEWDMYVDLHPIANTSPYTVVETMSLAKAAVLFRELGLRHMCVVPKSQ--  678

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D +  +IL ++PH+
Sbjct  679  GRPPIVGILTRHDFQPEHILGLYPHV  704



>ref|NP_001170245.1| uncharacterized protein LOC100384199 [Zea mays]
 gb|ACN36355.1| unknown [Zea mays]
Length=455

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 145/209 (69%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP+M ++   ++  V  P+++  G+E+VG IV+ L+ T HNGFPVVDE   
Sbjct  257  GLPFLEAHAEPYMTHLVASDV--VSGPLISFSGVERVGNIVQALRITGHNGFPVVDE---  311

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K FM E+ +T  + V E+F   D A+    + 
Sbjct  312  PPLSEAP----ELVGLVLRSHLLVLLKGKGFMKEKMKTSGSFVLERFGAFDFAKPGSGKG  367

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM++YVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRHM+++PK    
Sbjct  368  LKIEDLDFTDEEMDLYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHMLVVPK--TP  425

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP++  S
Sbjct  426  GRPPIVGILTRHDFIPEHIHGLFPNIHKS  454



>ref|XP_006836849.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
 gb|ERM99702.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
Length=772

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 137/206 (67%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+ H EP+MR +   ++  V  P++   GIEKVG +V  L+ T HNGFPVVDE   
Sbjct  574  GLPFLEDHAEPYMRQLAASDV--VSGPLMGFSGIEKVGNVVHTLRATGHNGFPVVDE---  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP + +P    +L GLVLR HL+++LK K F    R     E   +F   D A+    + 
Sbjct  629  PPLSEVP----KLCGLVLRAHLVVLLKGKMFTEGSRSVGMEEFGRRFGASDFAKAGLGKG  684

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IEDV ++  EMEMYVDLHP+TN++PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  685  LRIEDVELSDKEMEMYVDLHPITNSSPYTVVETMSLAKAAMLFRQLGLRHLCVMPK--TP  742

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G +P+VGILTR D    +I+ ++PHL
Sbjct  743  GGAPIVGILTRHDFMPEHIIGLYPHL  768



>ref|XP_004486231.1| PREDICTED: chloride channel protein CLC-c-like [Cicer arietinum]
Length=766

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 136/206 (66%), Gaps = 14/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MRN+  G++  V  P+ T  G+EKVG IV  LK T+H+GFPV+DE   
Sbjct  568  GLPYMEAHAEPYMRNLVAGDV--VSGPLFTFCGVEKVGNIVHALKVTSHHGFPVIDE---  622

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P        ++    L+L+LK K   +  +    + V  KF   D A+    R 
Sbjct  623  PPLTYAP---QLCGLVLRSHLLVLLLKHKTLFTREKVMTTSTVTNKFKANDFAKPGLGRG  679

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +++D+ ++K+EMEM+VDLHP+TNT+PYTVVE++S+AKA LLFR+VGLRH++++PK    
Sbjct  680  IRVDDLDISKEEMEMFVDLHPITNTSPYTVVETMSLAKAALLFREVGLRHLLVVPK--TP  737

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D     IL +FPHL
Sbjct  738  GRPPIVGILTRHDFMPEYILGLFPHL  763



>ref|XP_008644266.1| PREDICTED: LOC542114 isoform X1 [Zea mays]
 gb|AFW71856.1| chloride channel [Zea mays]
Length=813

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 142/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPV+DE   
Sbjct  607  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVHALRLTGHNGFPVLDE---  661

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLV R+HLL++L  K FM  R +T  + V  +F   D A+    + 
Sbjct  662  PPITETP----ELVGLVTRSHLLVLLNSKNFMKGRVKTSGSFVLRRFGAFDFAKPGSGKG  717

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH++++PK    
Sbjct  718  LKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLLVVPK--TP  775

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I S+FP+L
Sbjct  776  DRPPIVGILTRHDFMPEHIHSLFPNL  801



>dbj|BAB97268.1| chloride channel [Oryza sativa Japonica Group]
Length=756

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 142/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  550  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVHALRFTGHNGFPVVDE---  604

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLV R+HLL++L  K FM ++ +T  + V ++F   D A+    + 
Sbjct  605  PPLTEAP----ELVGLVTRSHLLVLLNGKMFMKDQLKTSGSFVLQRFGAFDFAKPGSGKG  660

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KI+D+  T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  661  LKIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALGLRHLLVVPK--TP  718

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I  +FP+L
Sbjct  719  DRPPIVGILTRHDFVEEHIHGLFPNL  744



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 140/206 (68%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MRN+  G++  V  P+ +  GIEKVG I+  LK T H+GFPVVDE   
Sbjct  563  GLPYMEAHAEPYMRNLVAGDV--VSGPLFSFCGIEKVGNILHALKVTEHHGFPVVDE---  617

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HL ++LK K   +  R    + +  K    D A+    R 
Sbjct  618  PPLTDAP----ELCGLVLRSHLWVLLKHKTLFTRERVMTGSTIVNKVKARDFAKPGLGRG  673

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             ++ED+ ++++EMEMYVDLHP+TNT+PYTVVE++S+AKA LLFR++GLRH++++PK    
Sbjct  674  IRVEDLDISQEEMEMYVDLHPITNTSPYTVVETMSLAKAALLFRELGLRHLLVVPK--KP  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D     IL +FP+L
Sbjct  732  GRPPIVGILTRHDFMHDYILGLFPNL  757



>ref|XP_010250239.1| PREDICTED: putative chloride channel-like protein CLC-g [Nelumbo 
nucifera]
Length=776

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 142/213 (67%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+AH EP+MR +TVG++  V  P+    GIEKV  IV VLK T H+GFPV+DE   
Sbjct  564  GFPYLEAHAEPYMRQLTVGDV--VTGPLQCFNGIEKVRNIVHVLKTTRHHGFPVIDE---  618

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P+    L GLVLR HL+++LKKK F+     T     + +F+  D A+R     
Sbjct  619  PPFSDCPV----LSGLVLRAHLIVLLKKKVFLPTPVLTGTDITK-RFSANDFAKRGSGNN  673

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              IED+ VT++EM+MY+DLHP TN +PYTVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  674  DHIEDIEVTEEEMDMYIDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVVPK--TS  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
              S VVG+LTR D    +IL + P L  S+  K
Sbjct  732  NRSSVVGVLTRHDFMPEHILGLHPFLIRSRWKK  764



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 142/210 (68%), Gaps = 17/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP+MR +TV ++  V  P+    GIEKVG IV VLK T HNGFPV+DE   
Sbjct  564  GFPYLETHAEPYMRQLTVSDV--VMGPLQLFHGIEKVGNIVHVLKTTRHNGFPVIDE---  618

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP  + P+    L+GL+LR HL+ +LK K F S        +  ++F+  D A+R     
Sbjct  619  PPLES-PV----LYGLILRAHLIELLKNKVF-SYTPVPISNDAFKQFSPGDFAKRGSGNG  672

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIEDV +T++EMEM++DLHP TN +PYTVVE++S+AKA +LFR+VGLRH++++PK  + 
Sbjct  673  DKIEDVEITEEEMEMFLDLHPFTNASPYTVVETMSLAKACVLFREVGLRHLLVIPKISSR  732

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P LA+S+
Sbjct  733  --SPVVGILTRHDFMPEHILGLHPFLASSR  760



>dbj|BAD16425.1| chloride channel [Oryza sativa Japonica Group]
 gb|EEE57198.1| hypothetical protein OsJ_07147 [Oryza sativa Japonica Group]
Length=804

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 142/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  598  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIVHALRFTGHNGFPVVDE---  652

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLV R+HLL++L  K FM ++ +T  + V ++F   D A+    + 
Sbjct  653  PPLTEAP----ELVGLVTRSHLLVLLNGKMFMKDQLKTSGSFVLQRFGAFDFAKPGSGKG  708

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KI+D+  T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  709  LKIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALGLRHLLVVPK--TP  766

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I  +FP+L
Sbjct  767  DRPPIVGILTRHDFVEEHIHGLFPNL  792



>ref|XP_004952777.1| PREDICTED: chloride channel protein CLC-c-like [Setaria italica]
Length=950

 Score =   164 bits (414),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 143/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKV +IV  L+ T HNGFPVVDE   
Sbjct  744  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVEKIVHALRITGHNGFPVVDE---  798

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLV R+HLL++L  K FM  + +T  + V  +F   D A+    + 
Sbjct  799  PPITETP----ELVGLVTRSHLLVLLNSKNFMKGQVKTSGSFVLRRFGAFDFAKPGSGKG  854

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH++++PK  A 
Sbjct  855  LKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLLVVPK--AP  912

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I S+FP+L
Sbjct  913  DRPPIVGILTRHDFMPEHIHSLFPNL  938



>gb|EPS68170.1| hypothetical protein M569_06601 [Genlisea aurea]
Length=782

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 144/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR+++ G++     P++T  G+EKVG I+  L+ T HNGFPVVDE   
Sbjct  585  GLPYLEAHAEPYMRHLSAGDVC--SGPLITFSGVEKVGNILHALQMTRHNGFPVVDE---  639

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLV R+HLL++LK   F ++ R    +EV   F   D A+      
Sbjct  640  PPFSDAP----ELCGLVSRSHLLVLLKANKF-TKNRTISGSEVLRTFHAYDFAKAGSGKG  694

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ V ++EMEM+VDLHP+TNT+PYTVVE++S+AKA LLFR++GLRH+ ++PK   +
Sbjct  695  LKVEDLDVKEEEMEMFVDLHPITNTSPYTVVETMSLAKAALLFRELGLRHLCVVPK--TS  752

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SP+VGILTR D    ++L ++P L + K
Sbjct  753  GRSPIVGILTRHDFMPEHVLGLYPQLQHQK  782



>ref|XP_009393492.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393493.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
Length=780

 Score =   162 bits (410),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 144/206 (70%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G PF++AH EP+MRN+   ++  V  P+VTL G+E+VG IV  ++ T HNGFPVVDE   
Sbjct  582  GFPFMEAHAEPYMRNLVASDV--VSGPLVTLSGVERVGNIVHAIRLTGHNGFPVVDE---  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP + +P    EL GLVLRTHLL++LK K F  ER  T  A+V ++F   D A+    + 
Sbjct  637  PPFSVVP----ELCGLVLRTHLLVLLKGKRFTKERVSTGAADVLQRFGAYDFAKAGSGKG  692

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+E++ + ++EMEMYVDLHP+TN +PYTV E++S+AKA +LFR++GLRH+ ++PK    
Sbjct  693  VKLEEIDINEEEMEMYVDLHPITNRSPYTVAETMSLAKAAILFRELGLRHLCVVPK--TP  750

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D  + +IL +FP +
Sbjct  751  GRPPIVGILTRHDFMSEHILGLFPRI  776



>gb|KHG07842.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=700

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 141/206 (68%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+M+++   ++  V  P++T  G+EKVG I+  LK T HNGFPV+DE   
Sbjct  503  GLPYMEAHAEPYMKHLVARDV--VSGPLITFSGVEKVGNILHALKTTGHNGFPVIDE---  557

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP    P    EL GLVLR+HLL++LK K F S  R     EV  + +  D A+    + 
Sbjct  558  PPFADAP----ELCGLVLRSHLLVLLKGKIF-SRDRALSGDEVVRRISKFDFAKAGSGKG  612

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ +  +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRHM ++PK Q  
Sbjct  613  VKLEDLDIKDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHMCVVPKSQ--  670

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    +IL ++PH+
Sbjct  671  GRPPIVGILTRHDFLPEHILGLYPHI  696



>ref|XP_008788814.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=790

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR +TV ++  V  P+ T  G+EKVG IV  L+ T H+GFPV+D+   
Sbjct  569  GLPYLEGHAEPYMRQLTVSDV--VTGPLQTFNGVEKVGNIVHALRTTGHHGFPVIDD---  623

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP ++ P+    L GL+LR HLL++LKKK F+    R+     +  F   D A+R     
Sbjct  624  PPFSSSPV----LFGLILRAHLLVLLKKKDFLPTCSRSGADASKM-FMANDFAKRSSGKH  678

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             ++ED+ +T +EMEM++DLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  ++
Sbjct  679  DRVEDIELTAEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SS  736

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P+L  S+
Sbjct  737  PRAPVVGILTRHDFMPEHILGLHPYLMRSR  766



>gb|AAQ56538.1| putative chloride channel [Oryza sativa Japonica Group]
 gb|AAQ56565.1| putative chloride channel protein [Oryza sativa Japonica Group]
 dbj|BAC92420.1| putative chloride channel protein [Oryza sativa Japonica Group]
 gb|EAZ06475.1| hypothetical protein OsI_28712 [Oryza sativa Indica Group]
 gb|EAZ42255.1| hypothetical protein OsJ_26819 [Oryza sativa Japonica Group]
 dbj|BAG89940.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39689.1| putative chloride channel [Oryza sativa Indica Group]
Length=796

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 143/210 (68%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP LD H EP+MR +TVG++  V  P+ +  G+EKVG IV  L+ T H+ FPVVDE   
Sbjct  571  GLPHLDGHAEPYMRQLTVGDV--VAGPLRSFNGVEKVGHIVHTLRTTGHHAFPVVDE---  625

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +  P+    L+GLVLR HLL++LKK+ F++   R  +  +  +F   D  +R  GK 
Sbjct  626  PPFSPAPV----LYGLVLRAHLLVLLKKREFLTAPVRCPKDYMAGRFEAQDFDKRGSGKQ  681

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I DV ++ +EMEMYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  + 
Sbjct  682  DTIADVELSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--SC  739

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P L  S+
Sbjct  740  DRSPVVGILTRHDFMPEHILGLHPVLVGSR  769



>ref|XP_004230422.1| PREDICTED: chloride channel protein CLC-c [Solanum lycopersicum]
Length=776

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 141/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +  G++     P+VT  G+EKVG IV  LK T HNGFPVVD   +
Sbjct  579  GLPYLEAHAEPYMRQLAAGDVCS--GPLVTFSGVEKVGNIVHALKFTRHNGFPVVD---L  633

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    E  GLVLR+HL+++LK K F +++     +   +KF   D A+    + 
Sbjct  634  PPFSDAP----EFCGLVLRSHLVVLLKGKTF-TKQNVLSGSNTLKKFHAFDFAKPGSGKG  688

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED++ + +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH+ ++PK    
Sbjct  689  LKFEDLSFSPEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLCVVPKTTKR  748

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +P+VGILTR D    +I  ++PHL + K
Sbjct  749  --NPIVGILTRHDFMPEHIKGLYPHLVHHK  776



>gb|KDO42565.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=642

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 145/208 (70%), Gaps = 16/208 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+   ++  V  P++T  G+EKVG I+  L+ T HNGFPV+DE   
Sbjct  444  GLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNIMHALRLTRHNGFPVIDE---  498

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F ++++    +++  +F   D A+    + 
Sbjct  499  PPLTPAP----ELCGLVLRSHLLVLLKGKKF-TKQKTMTGSDIMRRFKAHDFAKAGSGKG  553

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEM+VDLHP+TNT+PYTVVE++S+AKA +LFRQ+ LRH+ ++PK    
Sbjct  554  VKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TP  611

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLAN  172
            G  P+VGILTR D    ++L ++PH+ N
Sbjct  612  GRPPIVGILTRHDFMPEHVLGLYPHIVN  639



>ref|XP_006431488.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 ref|XP_006431489.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44728.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44729.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=642

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 145/208 (70%), Gaps = 16/208 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+   ++  V  P++T  G+EKVG I+  L+ T HNGFPV+DE   
Sbjct  444  GLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNIMHALRLTRHNGFPVIDE---  498

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F ++++    +++  +F   D A+    + 
Sbjct  499  PPLTPAP----ELCGLVLRSHLLVLLKGKKF-TKQKTMTGSDIMRRFKAHDFAKAGSGKG  553

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEM+VDLHP+TNT+PYTVVE++S+AKA +LFRQ+ LRH+ ++PK    
Sbjct  554  VKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TP  611

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLAN  172
            G  P+VGILTR D    ++L ++PH+ N
Sbjct  612  GRPPIVGILTRHDFMPEHVLGLYPHIVN  639



>ref|XP_004508447.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Cicer arietinum]
Length=777

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 139/210 (66%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+ H EP+MR +TVG++  V  P+    GIEKV  I+ VL+ TTHNGFPV+DE   
Sbjct  561  GLPYLETHAEPYMRQLTVGDV--VTGPLQMFNGIEKVRNIMFVLRTTTHNGFPVIDE---  615

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            P  +  P+    L G++LR HLL +LKKK F+         +V  +F+  D A++     
Sbjct  616  PRHSEAPV----LFGIILRDHLLTLLKKKAFLPAPVVENSYDVLREFSADDFAKKGSGER  671

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T +EM M++DLHP TN +PYTVVE++S+AKAL+LFR+VGLRH++++PK    
Sbjct  672  IKIEDIQLTDEEMGMFIDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVIPKIP--  729

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  PVVGILTR D    +IL + P L  S+
Sbjct  730  GRWPVVGILTRHDFMPEHILGMHPFLVRSR  759



>ref|XP_010241600.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nelumbo nucifera]
Length=765

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 144/213 (68%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+AH EP+MR +TVG++  V  P+    GIEKV  IV VLK T H+GFPV+DE   
Sbjct  564  GFPYLEAHAEPYMRQLTVGDV--VTGPLQCFNGIEKVRNIVHVLKTTGHHGFPVIDE---  618

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAER----W  436
            PP +  P+    L GLVLR HL+++LKKK F+S    T     + +F+  D A+R    +
Sbjct  619  PPVSYDPV----LSGLVLRDHLIVLLKKKAFLSTPILTRSDVTK-QFSANDFAKRGSTKY  673

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I+++ VT++EM+M++DLHP TN +PYTV+E++S+AKAL+LFR+VGLRH++++PK    
Sbjct  674  ETIDNIEVTEEEMDMFIDLHPFTNASPYTVLETMSLAKALILFRKVGLRHLLVVPKTSTR  733

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
              SPVVGILTR D    ++L + P L  S+  K
Sbjct  734  --SPVVGILTRHDFMPEHVLGLHPFLLESRQKK  764



>ref|XP_004242745.2| PREDICTED: putative chloride channel-like protein CLC-g [Solanum 
lycopersicum]
Length=788

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 140/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP++R + V ++  V  P+    GIEKVG IV VLK T HNGFPVVDE   
Sbjct  576  GFPYLERHAEPYLRQLAVSDV--VTGPLQLFNGIEKVGNIVHVLKTTGHNGFPVVDE---  630

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLA----ERW  436
            PP +A P+    L+GLVLR HL+ +LKKK F+       +     +F+  D A    E  
Sbjct  631  PPHSAAPV----LYGLVLRAHLITLLKKKAFLQNPAPAGDDAFE-QFSADDFAKKGLEHV  685

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             ++ED+ +  +EM+M++DLHP  NT+P+TVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  686  DRVEDIQLKDEEMDMFIDLHPFCNTSPFTVVETMSLAKALMLFREVGLRHLLVIPK--VS  743

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  PVVGI+TR D    ++LS+ P LA SK
Sbjct  744  GRIPVVGIITRHDFMPEHVLSLHPSLAKSK  773



>ref|XP_010241599.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g [Nelumbo nucifera]
Length=781

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 146/213 (69%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +TVG++  V  P+    GIEKV  IV VLK T H+GFPV+D+   
Sbjct  564  GLPYLEAHAEPYMRQLTVGDV--VTGPLQCFNGIEKVRNIVNVLKATGHHGFPVIDQ---  618

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GKI  427
            PP +  P+    L GLVLR HL+++LKKK F+S    T    ++ +F+  D A+R  G  
Sbjct  619  PPVSDSPV----LSGLVLRAHLIVLLKKKAFLSTPMLTSSDFMK-QFSANDFAKRGSGNN  673

Query  426  EDV---AVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
            ED+    VT++EM+M++DLHP TN +PYTVVE++S+AK+L+LFR VGLRH++++PK   +
Sbjct  674  EDIYNIEVTEEEMDMFIDLHPFTNASPYTVVETMSLAKSLILFRGVGLRHLLVVPK--TS  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
              SPVVGILTR D    +IL ++P L  S+  K
Sbjct  732  NWSPVVGILTRHDFMPEHILGLYPXLQKSRWKK  764



>ref|XP_007152471.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
 gb|ESW24465.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
Length=807

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 142/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+  G++  V  P++T  GIEKVG I   L  T HNGFPV+DE   
Sbjct  590  GLPYLEAHAEPYMKNLVAGDV--VSGPLITFSGIEKVGIIWHALSATGHNGFPVIDE---  644

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP T  P    EL GLVLR+HLL++LK+K F S  +   +    ++ + +D  +      
Sbjct  645  PPFTDAP----ELCGLVLRSHLLVLLKEKIF-SNDKNFIDQSSFQRISALDFGKAGSGKG  699

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + +++M+MYVDLHP+TN +PYTVVE++ +AKA ++FRQ GLRHM ++PK Q  
Sbjct  700  IKLEDLDIDEEDMDMYVDLHPITNASPYTVVETMPLAKAAIIFRQHGLRHMCVVPKSQ--  757

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGS  160
            G  PVVGILTR D    ++L ++PH+ + K S
Sbjct  758  GRPPVVGILTRHDFMPEHVLGLYPHIKSQKQS  789



>gb|KJB40519.1| hypothetical protein B456_007G067500 [Gossypium raimondii]
Length=767

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 141/206 (68%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+M+++   ++  V  P++T  G+EKVG I+  LK T HNGFPV+DE   
Sbjct  570  GLPYMEAHAEPYMKHLVARDV--VSGPLITFSGVEKVGNILHALKTTGHNGFPVIDE---  624

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP    P    EL GLVLR+HLL++LK K F S  R     EV  + +  D A+    + 
Sbjct  625  PPFADAP----ELCGLVLRSHLLVLLKGKIF-SRDRVLSGDEVVHRISKFDFAKAGSGKG  679

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ +  +EM+MYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRHM ++PK Q  
Sbjct  680  VKLEDLDIKDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHMCVVPKSQ--  737

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    +IL ++PH+
Sbjct  738  GRPPIVGILTRHDFLPEHILGLYPHI  763



>ref|XP_006647383.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=804

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 142/206 (69%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKV  IV  LK T HNGFPVVDE   
Sbjct  598  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVANIVHALKITGHNGFPVVDE---  652

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE-RWGK-  430
            PP T  P    EL GLV R+HLL++LK K FM ++ +T  + V ++F   D A+   GK 
Sbjct  653  PPLTEAP----ELVGLVTRSHLLVLLKSKMFMKDQVKTSGSFVLQRFGAFDFAKPGSGKG  708

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I+D+  T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  709  LTIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALGLRHLLVVPK--TP  766

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I  +FP+L
Sbjct  767  DRPPIVGILTRHDFVEEHIHGLFPNL  792



>gb|ACF78606.1| unknown [Zea mays]
Length=496

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 135/213 (63%), Gaps = 16/213 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P L+ + EP+MR ++V ++  V  P+ T  GIEKVG IV VLK T HNGFPVVDE   
Sbjct  284  GFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHIVHVLKTTGHNGFPVVDE---  338

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P   T    ++    L+L+ KK +  S    T  A     F+  + A+R     
Sbjct  339  PPFSDTP---TLYGLILRDHLLVLLRKKDFIRSCTASTLNALN--HFSHAEFAKRGSGKH  393

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ +  +E+EM+VDLHP TNT+PYTV+E++S+AKAL+LFR+VGLRH+++LPK  ++
Sbjct  394  DRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPK--SS  451

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSKGSK  157
              +PVVGILTR D    +IL + P L  S+  K
Sbjct  452  KRAPVVGILTRHDFMPEHILGLHPFLFKSRWKK  484



>ref|XP_009411882.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 140/208 (67%), Gaps = 15/208 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G PF++AH EP+MRN+  G++  V  P++TL G+EKVG IV  LK T HNGFPVV+E   
Sbjct  581  GFPFMEAHAEPYMRNLKAGDV--VSGPLITLAGVEKVGNIVHALKWTRHNGFPVVNE---  635

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +     A EL GL L++HLL++LK K F  ER  T  A+V  +F   D A+    + 
Sbjct  636  PPFSD----ARELCGLALKSHLLVLLKGKGFTKERVSTGAADVLRRFDPFDFAKAGSGKG  691

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+E++ +   EMEMYVDLHP+ N +PYTV E++S+AKA +LFR++GLRH+ ++PK  + 
Sbjct  692  VKLEELDIDDAEMEMYVDLHPIVNRSPYTVKETMSLAKAAVLFRELGLRHLCVVPK--SP  749

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLAN  172
            G SPV GILTR D    +IL  FPHL N
Sbjct  750  GGSPVAGILTRHDFMPEHILGRFPHLKN  777



>ref|XP_006349289.1| PREDICTED: chloride channel protein CLC-c-like [Solanum tuberosum]
Length=776

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 141/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +  G++     P+VT  G+EKVG IV  LK T HNGFPVVD   +
Sbjct  579  GLPYLEAHAEPYMRQLAAGDVCS--GPLVTFSGVEKVGNIVHALKFTRHNGFPVVD---L  633

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    E  GLVLR+HL+++LK K F ++      + + ++F   D A+    + 
Sbjct  634  PPFSDAP----EFCGLVLRSHLVVLLKGKTF-TKLSVLSGSNILKRFHAFDFAKPGSGKG  688

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K ED++ + +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH+ ++PK    
Sbjct  689  LKFEDLSFSPEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLCVVPKTTKR  748

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +P+VGILTR D    +I  ++PHL + K
Sbjct  749  --NPIVGILTRHDFMPEHIKGLYPHLVHHK  776



>ref|XP_008806106.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
 ref|XP_008806107.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=765

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 141/206 (68%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MRN+  G++  V  P++T  G+EKVG IV  L+ T HNGFPVVDE   
Sbjct  567  GLPYMEAHAEPYMRNLVAGDV--VSGPLITFSGVEKVGNIVHALRLTGHNGFPVVDE---  621

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK + F  +R  T  AEV  +F   D A+    + 
Sbjct  622  PPFSDAP----ELCGLVLRSHLLVLLKGRRFTKDRVLTGPAEVFRRFGAFDFAKAGSGKG  677

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K++D+ +  +EMEMYVD+HP+TN +PYTVVE++S+AKA +LFR++GLRH+ ++PK    
Sbjct  678  VKLQDLDINGEEMEMYVDIHPITNRSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TP  735

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    +IL +FP  
Sbjct  736  GRPPIVGILTRHDFMPEHILGLFPQF  761



>ref|XP_011078419.1| PREDICTED: putative chloride channel-like protein CLC-g [Sesamum 
indicum]
Length=834

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 141/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L  H EP+MR +TVG++  V  P+    GIEKVG IV VL+ T HNGFPVVDE   
Sbjct  628  GLPYLKPHAEPYMRQLTVGDV--VTGPLQIFHGIEKVGNIVHVLRTTGHNGFPVVDE---  682

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSe----rrrteeaevrEKFTWIDLAERW  436
            PP +  P+    L+GL+LR+HL+ +L+KK F                 + FT  DL    
Sbjct  683  PPLSLSPL----LYGLILRSHLVTLLRKKLFFKTPTPVGLDAFLQFSADDFTTKDLGH-C  737

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +I+D+ ++++EMEM+VDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  738  DQIDDIELSEEEMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVIPK--VS  795

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  PVVGILTR D    ++ ++ P L+ ++
Sbjct  796  GRLPVVGILTRHDFMLEHVQNLHPRLSRNR  825



>ref|XP_003575152.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=808

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 141/206 (68%), Gaps = 15/206 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  G+EKVG I+  L+ T HNGFPVVDE   
Sbjct  602  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNIITALRITGHNGFPVVDE---  656

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP    P    EL GLV+R+HLL++LK K FM ER +T  + + E+F   D A+    + 
Sbjct  657  PPLAEAP----ELVGLVIRSHLLVLLKGKMFMKERVKTSGSFILERFGAFDFAKPGSGKG  712

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EMEMYVDLHP+ NT+PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  713  LKIEDLNFTDEEMEMYVDLHPIANTSPYTVVETMSLAKAAILFRALGLRHLLVVPK--TP  770

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
               P+VGILTR D    +I  +FP L
Sbjct  771  DRPPIVGILTRHDFVPEHIHGLFPSL  796



>ref|XP_004979167.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Setaria italica]
Length=793

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 135/210 (64%), Gaps = 14/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP LD H EP+MR +TVG++  V  P+ +  G+EKVG IV +L+ T HN FPVVDE   
Sbjct  568  GLPHLDGHAEPYMRQLTVGDV--VAGPLRSFNGVEKVGNIVHILRTTGHNAFPVVDE---  622

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKIE  424
            PP +  P+       ++    L+L+ K+++  ++  R  +  V  +F   D  +R    +
Sbjct  623  PPFSPAPV---LYGLVLRAHLLVLLKKREFLRAQELRYPKEYVAGRFQAEDFDKRGSGKQ  679

Query  423  D----VAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
            D    V ++ +EMEMYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  A 
Sbjct  680  DTIGAVQLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--AC  737

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P L  S+
Sbjct  738  DRSPVVGILTRHDFMPEHILGLHPVLLGSR  767



>ref|XP_008361634.1| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-c-like 
[Malus domestica]
Length=778

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 142/209 (68%), Gaps = 14/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH E +MR +   ++A    P+VT  GIEKVGRI++ L+ T HNGFPV+DE   
Sbjct  580  GLPYLEAHAEXYMRQLVTADVA--TGPLVTFSGIEKVGRILDALRXTGHNGFPVIDE---  634

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrE--KFTWIDLAERWG-  433
            PP +  P    EL GLVLR+HLL++LK K F  ER   EE  + +   F +       G 
Sbjct  635  PPFSDAP----ELCGLVLRSHLLILLKGKVFSRERVVCEEEILGDLPAFNFAKAGSGKGI  690

Query  432  KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAAG  253
            K+ED+ + ++EM+MYVDLHP+TN +PYTVVE++S+AKA +LFRQ+GLRH+ ++PK Q  G
Sbjct  691  KVEDLDIEEEEMDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--G  748

Query  252  VSPVVGILTRQDLRAHNILSVFPHLANSK  166
              P+VGILTR D    +IL ++PH+   K
Sbjct  749  RPPIVGILTRHDFMPEHILGLYPHIKAHK  777



>ref|XP_004288642.1| PREDICTED: chloride channel protein CLC-c [Fragaria vesca subsp. 
vesca]
Length=782

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 141/206 (68%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+++   ++  V  P+VT  G+EKVG I+  L+ T HNGFPV+DE   
Sbjct  584  GLPYLEAHAEPYMKDLVTSDV--VSGPLVTFSGVEKVGYIMHALRTTGHNGFPVIDE---  638

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+HLL +L  K F S+ R     E+  +F   D A+      
Sbjct  639  PPFSDTP----ELCGLVLRSHLLTLLNGKVF-SKERILHGEEILRRFGPFDFAKAGSGKG  693

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEMYVDLHP+TN +PYTVVE++S+AKA +LFRQ+GLRH+ ++PK Q  
Sbjct  694  LKVEDLDIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--  751

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G SP+VGILTR D    +IL ++P++
Sbjct  752  GRSPIVGILTRHDFMPEHILGLYPNI  777



>ref|XP_006359489.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Solanum tuberosum]
Length=767

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 139/210 (66%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP++R ++V ++  V  P+    GIEKVG IV VLK T HNGFPVVDE   
Sbjct  555  GFPYLERHAEPYLRQLSVSDV--VTGPLQFFNGIEKVGNIVHVLKTTGHNGFPVVDE---  609

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP +  P+    L GLVLR HL+ +LKKK F+             +F+  D A++     
Sbjct  610  PPHSVAPV----LFGLVLRAHLVTLLKKKAFLQNPVPAGVDTFA-QFSADDFAKKGLDHG  664

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             ++ED+ +  +EM+M++DLHP  NT+P+TVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  665  DRVEDIQLADEEMDMFIDLHPFCNTSPFTVVETMSLAKALMLFREVGLRHLLVIPK--VS  722

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  PVVGI+TR D    ++LS+ P LA SK
Sbjct  723  GRIPVVGIITRHDFMPEHVLSLHPSLAKSK  752



>ref|XP_006431490.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44730.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=789

 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 145/208 (70%), Gaps = 16/208 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+   ++  V  P++T  G+EKVG I+  L+ T HNGFPV+DE   
Sbjct  591  GLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNIMHALRLTRHNGFPVIDE---  645

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F ++++    +++  +F   D A+    + 
Sbjct  646  PPLTPAP----ELCGLVLRSHLLVLLKGKKF-TKQKTMTGSDIMRRFKAHDFAKAGSGKG  700

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEM+VDLHP+TNT+PYTVVE++S+AKA +LFRQ+ LRH+ ++PK    
Sbjct  701  VKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TP  758

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLAN  172
            G  P+VGILTR D    ++L ++PH+ N
Sbjct  759  GRPPIVGILTRHDFMPEHVLGLYPHIVN  786



>ref|XP_006470993.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Citrus 
sinensis]
Length=642

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 144/208 (69%), Gaps = 16/208 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+   ++  V  P++T  G+EKVG I+  L  T HNGFPV+DE   
Sbjct  444  GLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNIMHALHLTRHNGFPVIDE---  498

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F ++++    +++  +F   D A+    + 
Sbjct  499  PPLTPAP----ELCGLVLRSHLLVLLKGKKF-TKQKTMAGSDIMRRFKAHDFAKAGSGKG  553

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEM+VDLHP+TNT+PYTVVE++S+AKA +LFRQ+ LRH+ ++PK    
Sbjct  554  VKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TP  611

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLAN  172
            G  P+VGILTR D    ++L ++PH+ N
Sbjct  612  GRPPIVGILTRHDFMPEHVLGLYPHVVN  639



>gb|KDO42564.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=789

 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 145/208 (70%), Gaps = 16/208 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+   ++  V  P++T  G+EKVG I+  L+ T HNGFPV+DE   
Sbjct  591  GLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNIMHALRLTRHNGFPVIDE---  645

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F ++++    +++  +F   D A+    + 
Sbjct  646  PPLTPAP----ELCGLVLRSHLLVLLKGKKF-TKQKTMTGSDIMRRFKAHDFAKAGSGKG  700

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEM+VDLHP+TNT+PYTVVE++S+AKA +LFRQ+ LRH+ ++PK    
Sbjct  701  VKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TP  758

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLAN  172
            G  P+VGILTR D    ++L ++PH+ N
Sbjct  759  GRPPIVGILTRHDFMPEHVLGLYPHIVN  786



>ref|XP_007048601.1| Chloride channel C [Theobroma cacao]
 gb|EOX92758.1| Chloride channel C [Theobroma cacao]
Length=771

 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 139/206 (67%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+M+++   ++  V  P++T  GIEKVG I+  L+ T HNGFPV+DE   
Sbjct  574  GLPYMEAHAEPYMKHLVARDV--VSGPLITFSGIEKVGNILHALRTTGHNGFPVIDE---  628

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P     L GLVLR+HLL++LK K F S        E+  +F   D A+      
Sbjct  629  PPFSDAP----ALCGLVLRSHLLVLLKGKIF-SRDMVPAGDEILHRFAAFDFAKAGSGKG  683

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EM+MYVDLHP+TN +PYTVVE++S+AKA +LFRQ+GLRHM ++PK Q  
Sbjct  684  IKVEDLDIEQEEMDMYVDLHPITNASPYTVVETMSLAKAAVLFRQLGLRHMCVVPKSQ--  741

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    ++L ++PH+
Sbjct  742  GRPPIVGILTRHDFMPEHVLGLYPHI  767



>ref|XP_007013577.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31196.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
Length=773

 Score =   159 bits (403),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 139/210 (66%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP+MR +TVG++  V  P+    GIEKVG IV +LK T H+GFPVVDE   
Sbjct  561  GFPYLETHAEPYMRQLTVGDV--VSGPLQLFHGIEKVGNIVHILKTTRHHGFPVVDE---  615

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP +  PI    L+GL+LR HL+ +LKK+ F+         +    F+  D A++     
Sbjct  616  PPHSESPI----LYGLILRAHLIALLKKRVFLC-TPVQIGVDAFRHFSAEDFAKKGLGNV  670

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ ++ +E EM++DLHP TN +PYTVVE++S+AKAL+LFRQVGLRH++++PK   +
Sbjct  671  DKIEDIELSDEEKEMFLDLHPFTNASPYTVVETMSLAKALVLFRQVGLRHLLVIPKI--S  728

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P L  S+
Sbjct  729  NRAPVVGILTRHDFMPEHILGLHPLLIGSR  758



>gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58338.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58339.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
Length=795

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 145/209 (69%), Gaps = 15/209 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP+M ++   ++  V  P+++  G+E+VG IV+ L+ T HNGFPVVDE   
Sbjct  597  GLPFLEAHAEPYMTHLVASDV--VSGPLISFSGVERVGNIVQALRITGHNGFPVVDE---  651

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K FM E+ +T  + V E+F   D A+    + 
Sbjct  652  PPLSEAP----ELVGLVLRSHLLVLLKGKGFMKEKMKTSGSFVLERFGAFDFAKPGSGKG  707

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+  T +EM++YVDLHP+TNT+PYTVVE++S+AKA +LFR +GLRHM+++PK    
Sbjct  708  LKIEDLDFTDEEMDLYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHMLVVPK--TP  765

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    +I  +FP++  S
Sbjct  766  GRPPIVGILTRHDFIPEHIHGLFPNIHKS  794



>ref|XP_010050093.1| PREDICTED: putative chloride channel-like protein CLC-g [Eucalyptus 
grandis]
 gb|KCW82982.1| hypothetical protein EUGRSUZ_C04372 [Eucalyptus grandis]
Length=770

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP+MR +TVG++  V  P+    GIEKV  +V VL+ T H+GFPV+DE   
Sbjct  558  GFPYLETHAEPYMRQLTVGDV--VSGPLQLFHGIEKVANVVHVLRTTRHHGFPVIDE---  612

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAER----W  436
            PP +  P     L+GL+LR HL+ +LKKK F+S+   T+      + +  D  +R    +
Sbjct  613  PPHSESPF----LYGLILRAHLMELLKKKAFLSDPVPTDIDAFE-QISAEDFMKRGSGHY  667

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              IED+ +T++EMEM++DLHP TN +PYTVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  668  NMIEDIDLTEEEMEMFLDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVIPK--IS  725

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G SPVVGILTR D    ++L++ P L  S+
Sbjct  726  GRSPVVGILTRHDFMPEHVLALHPTLIRSR  755



>ref|XP_010529978.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529986.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529994.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
Length=779

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 142/204 (70%), Gaps = 16/204 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLPFL+AH EP+MRN+   ++  V  P+V+   +EKVG I + LK TTHNGFPV+DE   
Sbjct  582  GLPFLEAHAEPYMRNLVAQDV--VSGPLVSFPRVEKVGVIWQALKMTTHNGFPVIDE---  636

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL G+VLR+HLL++L+ K F S++R    + +   F   D A+    R 
Sbjct  637  PPFTEAP----ELCGIVLRSHLLVLLQGKKF-SKQRTVCSSRILTIFKARDFAKPGLGRG  691

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ ++++EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFRQ+GLRH+ ++PK    
Sbjct  692  LKIEDLEISEEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--TP  749

Query  255  GVSPVVGILTRQDLRAHNILSVFP  184
            G  P+VGILTR D    ++L ++P
Sbjct  750  GRPPIVGILTRHDFMPEHVLGLYP  773



>ref|XP_010099780.1| Chloride channel protein CLC-c [Morus notabilis]
 gb|EXB80398.1| Chloride channel protein CLC-c [Morus notabilis]
Length=763

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 142/206 (69%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MRN+   ++  V  P+VT  GIEKVG I+  LK T HNGFPV+DE   
Sbjct  564  GLPYMEAHAEPYMRNLIASDV--VSGPLVTFSGIEKVGNILLALKITRHNGFPVIDE---  618

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +  P    EL GLVLR+HLL++LK K F SE+R    +++  K    D A+      
Sbjct  619  PPLSDAP----ELCGLVLRSHLLVLLKGKKF-SEQRVMTGSQIMRKIKAHDFAKAGSGKG  673

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ +T+ EMEMYVDLHP+TN +PYTVVE++S+AKA +LFR +GLRH++++PK    
Sbjct  674  IKLEDLDITEAEMEMYVDLHPITNASPYTVVETMSLAKAAVLFRDLGLRHLLVVPK--TP  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    ++L ++PH+
Sbjct  732  GRPPIVGILTRHDFMPEHVLGLYPHI  757



>gb|AFW70592.1| hypothetical protein ZEAMMB73_317914 [Zea mays]
Length=648

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 142/210 (68%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP LD H EP+MR + VG++  V  P+ +  G+EKVG +V  L+ T H+ FPVVDE   
Sbjct  424  GLPHLDGHAEPYMRQLAVGDV--VAGPLRSFGGVEKVGNVVHTLRTTGHHAFPVVDE---  478

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +  P+    L+GLVLR HLL++LKK+ F+    R  +  V E+F   D  +R  GK 
Sbjct  479  PPFSPAPV----LYGLVLRAHLLVLLKKREFLVAPERCPKEYVAERFQAEDFDKRGSGKQ  534

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I DV ++ +EMEMYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  A 
Sbjct  535  DTIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--AC  592

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P L  S+
Sbjct  593  DRSPVVGILTRHDFMPEHILELHPVLLRSR  622



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 143/206 (69%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++ H EP+MRN+   ++  V  P+++   +EKVG I + LK T+HNGFPV+DE   
Sbjct  578  GLPYMEDHAEPYMRNLVAKDV--VSGPLLSFSSVEKVGVIWQALKMTSHNGFPVIDE---  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T     A+EL G+ LR+HLL +L+ K F S++R    +++       D A+    + 
Sbjct  633  PPFTE----ASELCGIALRSHLLTLLQGKRF-SKQRTAFGSQILRSCKARDFAKAGLGKG  687

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ ++++EMEMYVDLHP+TNT+PYTV+ESLS+AKA +LFRQ+GLRH+ ++PK   A
Sbjct  688  LKIEDLDISEEEMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLGLRHLCVIPK--TA  745

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    ++L ++PH+
Sbjct  746  GRPPIVGILTRHDFMPEHVLGLYPHI  771



>ref|XP_002527858.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF34561.1| chloride channel clc, putative [Ricinus communis]
Length=754

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 141/206 (68%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR +   ++  V  P+V+  G+EKVG I+  LK T HNGFPV+DE   
Sbjct  557  GLPYMEAHAEPYMRQLVASDV--VSGPLVSFSGVEKVGNILHALKTTGHNGFPVIDE---  611

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWG---  433
            PP +     A+EL GLVLR+HLL++LK K F ++ R    + +   F   D A+      
Sbjct  612  PPFSD----ASELCGLVLRSHLLVLLKGKKF-TKLRIMSGSGILTIFKAHDFAKAGSGKG  666

Query  432  -KIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ +T +EM+MYVDLHP+TNT+PYTVVES+S+AKA +LFR++GLRH+ ++PK    
Sbjct  667  IKLEDLDITAEEMDMYVDLHPITNTSPYTVVESMSLAKAAVLFRELGLRHLCVVPK--TP  724

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    +IL ++PH+
Sbjct  725  GRPPIVGILTRHDFVPEHILGLYPHI  750



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 143/206 (69%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++ H EP+MRN+   ++  V  P+++   +EKVG I + LK T+HNGFPV+DE   
Sbjct  578  GLPYMEDHAEPYMRNLVAKDV--VSGPLLSFSSVEKVGVIWQALKMTSHNGFPVIDE---  632

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T     A+EL G+ LR+HLL +L+ K F S++R    +++       D A+    + 
Sbjct  633  PPFTE----ASELCGIALRSHLLTLLQGKRF-SKQRTAFGSQILRSCKARDFAKAGLGKG  687

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ ++++EMEMYVDLHP+TNT+PYTV+ESLS+AKA +LFRQ+GLRH+ ++PK   A
Sbjct  688  LKIEDLDISEEEMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLGLRHLCVIPK--TA  745

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    ++L ++PH+
Sbjct  746  GRPPIVGILTRHDFMPEHVLGLYPHI  771



>ref|XP_002453459.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
 gb|EES06435.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
Length=793

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 142/210 (68%), Gaps = 14/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP LD H EP+MR +TVG++  V  P+ +  G+EKVG +V  L+ T H+ FPVVDE   
Sbjct  568  GLPHLDGHAEPYMRQLTVGDV--VAGPLRSFGGVEKVGSVVHTLRTTGHHAFPVVDE---  622

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +    G   L+GLVLR HLL++LKK+ F++   R  +  V  +F   D  +R  GK 
Sbjct  623  PPFSP---GPPVLYGLVLRAHLLVLLKKREFLAAPERCRKEYVAGRFQAEDFDKRGSGKQ  679

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I DV ++ +EMEMYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  A 
Sbjct  680  DAIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--AC  737

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P L  S+
Sbjct  738  DRSPVVGILTRHDFMPEHILGLHPVLLKSR  767



>emb|CDO97645.1| unnamed protein product [Coffea canephora]
Length=816

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 140/209 (67%), Gaps = 16/209 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+MR +  G++     P++T  G+EKVG I+  L+ T HNGFPV+DE   
Sbjct  616  GLPYLEAHAEPYMRQLVAGDVCS--GPLITFSGVEKVGNILHALRLTRHNGFPVIDE---  670

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +  P    EL GLVLR+HLL++LK K F+     T    ++ +F   D A+    + 
Sbjct  671  PPLSDAP----ELCGLVLRSHLLVLLKGKNFLKHPVSTGLEILK-RFHAFDFAKPGLGKG  725

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ +T +E EMYVDL P+TNT+PYTVVE++S+AKA LLFR++GLRH+ ++PK    
Sbjct  726  LKVEDLEITAEETEMYVDLRPITNTSPYTVVETMSLAKAALLFRELGLRHLCVVPK--KP  783

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANS  169
            G  P+VGILTR D    ++L ++PHL  +
Sbjct  784  GRPPIVGILTRHDFMPEHVLGLYPHLTRA  812



>ref|XP_010025693.1| PREDICTED: chloride channel protein CLC-c-like [Eucalyptus grandis]
 gb|KCW62414.1| hypothetical protein EUGRSUZ_H05062 [Eucalyptus grandis]
Length=783

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 140/206 (68%), Gaps = 16/206 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR +   ++  V  P+V   GIEKVG I+  L+ T HNGFPV+DE   
Sbjct  584  GLPYMEAHAEPYMRQLVARDV--VTGPIVMFSGIEKVGTILHALRTTGHNGFPVIDE---  638

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP +     + EL G+VLR+HLL++LK K F S  R     E+ +K+   D A+    + 
Sbjct  639  PPFSE----SAELCGIVLRSHLLVLLKGKNF-SRERVISGEEILQKYAAFDFAKPGSGKG  693

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ +  +EM++Y+DLHP+TN +PYTVVE++S+AKA +LFRQ+GLRHM ++PK Q  
Sbjct  694  IKLEDLDIDDEEMDLYIDLHPVTNASPYTVVETMSLAKAAILFRQLGLRHMCVVPKSQ--  751

Query  255  GVSPVVGILTRQDLRAHNILSVFPHL  178
            G  P+VGILTR D    +IL ++PH+
Sbjct  752  GRPPIVGILTRHDFMPEHILGLYPHI  777



>ref|XP_010927804.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=761

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 141/210 (67%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MRN+   ++  V  P++T   +EKVG IV  L+ T HNGFPVVDE   
Sbjct  563  GLPYMEAHAEPYMRNLVASDV--VSGPLITFSAVEKVGNIVHALRLTGHNGFPVVDE---  617

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP    P    EL GLVLR+HLL++LK K F  +R  T  AEV  +F   D A+    + 
Sbjct  618  PPFADAP----ELCGLVLRSHLLVLLKGKRFTQDRVLTGPAEVFRRFGAFDFAKAGSGKG  673

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEMYVD+HP+TN +PYTVVE++S+AKA +LFR++GLRH+ ++PK    
Sbjct  674  VKLEDLDINEEEMEMYVDIHPITNRSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TP  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  P+VGILTR D    ++L +FP   + K
Sbjct  732  GRPPIVGILTRHDFMPEHVLGLFPQFKHHK  761



>ref|XP_006470992.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Citrus 
sinensis]
Length=789

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 144/208 (69%), Gaps = 16/208 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+L+AH EP+M+N+   ++  V  P++T  G+EKVG I+  L  T HNGFPV+DE   
Sbjct  591  GLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNIMHALHLTRHNGFPVIDE---  645

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVLR+HLL++LK K F ++++    +++  +F   D A+    + 
Sbjct  646  PPLTPAP----ELCGLVLRSHLLVLLKGKKF-TKQKTMAGSDIMRRFKAHDFAKAGSGKG  700

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ + ++EMEM+VDLHP+TNT+PYTVVE++S+AKA +LFRQ+ LRH+ ++PK    
Sbjct  701  VKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TP  758

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLAN  172
            G  P+VGILTR D    ++L ++PH+ N
Sbjct  759  GRPPIVGILTRHDFMPEHVLGLYPHVVN  786



>ref|XP_010657886.1| PREDICTED: uncharacterized protein LOC100245380 isoform X2 [Vitis 
vinifera]
Length=630

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+++AH EP+MR++   ++  V  P++T   IEKVG I+  LK T H+GFPV+DE   
Sbjct  433  GFPYMEAHAEPYMRHLVAKDV--VSGPLITFSSIEKVGNILHALKTTGHHGFPVIDE---  487

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T  P    EL GLVL++HLL++LK K F S+ R    +E+ + F   D A+    + 
Sbjct  488  PPFTDAP----ELCGLVLKSHLLVLLKGKKF-SKTRMLVGSEILKTFEANDFAKAGSGKG  542

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             K+ED+ +T +EMEMYVDLHP+TNT+PYTVVE++S+AKA +LFR++GLRH+ ++PK  A 
Sbjct  543  VKLEDLDITAEEMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPKTHAR  602

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
               P+VGILTR D    +I  ++PH  +SK
Sbjct  603  --PPIVGILTRHDFMPGHIRGLYPHFNSSK  630



>ref|XP_008644088.1| PREDICTED: uncharacterized protein LOC100383583 isoform X1 [Zea 
mays]
Length=793

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 142/210 (68%), Gaps = 15/210 (7%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP LD H EP+MR + VG++  V  P+ +  G+EKVG +V  L+ T H+ FPVVDE   
Sbjct  569  GLPHLDGHAEPYMRQLAVGDV--VAGPLRSFGGVEKVGNVVHTLRTTGHHAFPVVDE---  623

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW-GK-  430
            PP +  P+    L+GLVLR HLL++LKK+ F+    R  +  V E+F   D  +R  GK 
Sbjct  624  PPFSPAPV----LYGLVLRAHLLVLLKKREFLVAPERCPKEYVAERFQAEDFDKRGSGKQ  679

Query  429  --IEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
              I DV ++ +EMEMYVDLHP TNT+PYTVVE++S+AKAL+LFR+VGLRH++++PK  A 
Sbjct  680  DTIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--AC  737

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              SPVVGILTR D    +IL + P L  S+
Sbjct  738  DRSPVVGILTRHDFMPEHILELHPVLLRSR  767



>gb|EYU34964.1| hypothetical protein MIMGU_mgv1a001646mg [Erythranthe guttata]
Length=779

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 140/204 (69%), Gaps = 17/204 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L++H EP+MR +TVG++  +  P+ T +GIEKVG IV VLK T HNGFPVVDE   
Sbjct  571  GFPYLESHAEPYMRQLTVGDV--ITGPLKTFQGIEKVGNIVHVLKTTGHNGFPVVDE---  625

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP  + P+    L GL+LR+HL+ +LKKK F+             + T  D A++     
Sbjct  626  PPICSSPV----LFGLILRSHLVTLLKKKLFLRNPAPLGLDAFL-QLTADDFAKKGLGHD  680

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IEDV ++++EMEM+VDLHP TN +PYTV+E++S+AKAL+LFR+VGLRH++++P    +
Sbjct  681  DRIEDVELSEEEMEMFVDLHPFTNKSPYTVLETMSLAKALILFREVGLRHLLVIP--MVS  738

Query  255  GVSPVVGILTRQDLRAHNILSVFP  184
            GV PV+GILTR D    +IL + P
Sbjct  739  GV-PVLGILTRHDFIPEHILKLHP  761



>ref|XP_009586705.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana tomentosiformis]
Length=732

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 139/210 (66%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP++R + V ++  V  P+    GIEKVG IV VLK T HNGFPVVDE   
Sbjct  520  GFPYLECHAEPYLRQLAVCDV--VTGPLQLFSGIEKVGNIVHVLKTTGHNGFPVVDE---  574

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP +  P+    L GL+LR HL+ +LKKK F+ +            F+  D A++     
Sbjct  575  PPLSHSPV----LFGLILRAHLVELLKKKAFIRDPVPAGSDAFN-HFSADDFAKKGLDHG  629

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             ++E++ +T +EM+M++DLHP  NT+PYTVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  630  DRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVGLRHLLVIPK--VS  687

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  PVVGI+TR D    ++LS+ P LA SK
Sbjct  688  GRVPVVGIITRHDFMPEHVLSLHPSLAKSK  717



>ref|XP_010541946.1| PREDICTED: putative chloride channel-like protein CLC-g [Tarenaya 
hassleriana]
Length=775

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 140/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L  H EP+MR +TV ++  V  P+    GIEK+  IV VL+ T HNGFPVVDE   
Sbjct  560  GFPYLQTHAEPYMRQLTVSDV--VSGPLRVFNGIEKIENIVHVLRTTNHNGFPVVDE---  614

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERWGKI-  427
            PP +A P+    L+GLVLR+H+L +LKK+ F+S    +    +  KFT  D A++   I 
Sbjct  615  PPFSAAPV----LYGLVLRSHILTLLKKRVFLSHPIPSGPDVLA-KFTADDFAKKGSGIG  669

Query  426  ---EDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
               ED+ +T++EM MY+DLHP +N +PYTVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  670  DGIEDINLTEEEMNMYLDLHPFSNASPYTVVETMSLAKALVLFREVGLRHLLVIPK--VS  727

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
               PVVGILTR D    +IL + P L  S+
Sbjct  728  NRPPVVGILTRHDFMPEHILGLHPSLFGSR  757



>gb|KJB64678.1| hypothetical protein B456_010G060300 [Gossypium raimondii]
Length=774

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 139/210 (66%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+ H EP+MR +TV ++  V  P+    GIEKVG IV +LK T H+GFPV+DE   
Sbjct  562  GFPYLETHAEPYMRQLTVADV--VSGPLQLCHGIEKVGNIVHILKTTMHHGFPVIDE---  616

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
             P +  P+    L+GL+LR HL+ +LKKK F+    +      R  F+  D A++     
Sbjct  617  SPHSESPV----LYGLILRAHLIALLKKKAFLCTPVQLGADAFR-HFSSDDFAKKGLGNV  671

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             KIED+ +T +EMEM++DLHP TN +PYTVV+++S+AKAL+LFR+VGLRH++++PK  + 
Sbjct  672  DKIEDIELTDEEMEMFLDLHPFTNASPYTVVDTMSLAKALILFREVGLRHLLVIPKISSR  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
              +PVVGILTR D    +IL + P L  S+
Sbjct  732  --APVVGILTRHDFMPEHILGLHPSLVRSR  759



>emb|CDP10469.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 136/204 (67%), Gaps = 16/204 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L+AH EP+MR +TVG++  V  P+   +GIEKV  IV VLK T HNGFPVVD   V
Sbjct  572  GFPYLEAHAEPYMRQLTVGDV--VTGPLQLFQGIEKVANIVHVLKTTGHNGFPVVD---V  626

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP +  P+    L GL+LR HL+ +LKKK F+           + +F   D A++     
Sbjct  627  PPFSEAPV----LVGLILRAHLITLLKKKAFLHSPMPNFSDAFK-RFMADDFAKKGLGNG  681

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             +IED+ ++ +EM M+VDLHP  NT+PY+VVE++S+AKAL+LFR+VGLRHM+++PK    
Sbjct  682  DRIEDIDLSDEEMNMFVDLHPFVNTSPYSVVETMSLAKALILFREVGLRHMLVVPKIP--  739

Query  255  GVSPVVGILTRQDLRAHNILSVFP  184
            G  PVVGILTR D    ++L+V P
Sbjct  740  GGVPVVGILTRHDFMPEHVLNVHP  763



>ref|XP_008441632.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=205

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  468  KFTWIDLAERWGKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLR  289
            KFT ++LAER GKIE+  VTK+EMEMYVDLHPLTNTT YTV+ES+SVAKAL+LFRQVG+R
Sbjct  8    KFTLVELAEREGKIEEFVVTKEEMEMYVDLHPLTNTTSYTVMESMSVAKALVLFRQVGIR  67

Query  288  HMIILPKYQAAGVSPVVGILTRQDLRAHNILSVFPHLANSKG  163
            H++I+PKY+AA V  V+GILT QDLR++NILS  P L  +K 
Sbjct  68   HLLIVPKYEAARVLLVIGILTWQDLRSYNILSAIPDLERTKA  109



>dbj|BAJ92873.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=805

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 143/206 (69%), Gaps = 19/206 (9%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            GLP+++AH EP+MR++  G++  V  P++T  GIEKV  IV  L+ T HNGFPVVDE   
Sbjct  599  GLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGIEKVADIVTALRITGHNGFPVVDE---  653

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAE----RW  436
            PP T +P    EL GLV+R+HLL++LK K FM ER +T  + V E+F   D A+    + 
Sbjct  654  PPLTEVP----ELVGLVIRSHLLVLLKGKMFMKERVKTSGSFVMERFGAFDFAKPGSGKG  709

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPK--YQ  262
             KIED+  T +EM+MY+DLH + NT+PYTVVE++S+AKA LLFR++GLRH++++PK  Y+
Sbjct  710  LKIEDLHFTDEEMQMYIDLHTIANTSPYTVVETMSLAKAALLFRELGLRHLLVVPKTPYR  769

Query  261  AAGVSPVVGILTRQDLRAHNILSVFP  184
                 P+VGILTR D    +I  +FP
Sbjct  770  P----PIVGILTRHDFVEEHIHGLFP  791



>ref|XP_009777969.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana sylvestris]
Length=776

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 140/210 (67%), Gaps = 16/210 (8%)
 Frame = -1

Query  783  GLPFLDAHPEPWMRNITVGELADVKPPVVTLRGIEKVGRIVEVLKNTTHNGFPVVDEGVV  604
            G P+L++H EP++R + V ++  V  P+    GIEKVG IV VLK T HNGFPVVDE   
Sbjct  564  GFPYLESHAEPYLRQLAVCDV--VTGPLQLFSGIEKVGNIVHVLKTTGHNGFPVVDE---  618

Query  603  PPRTALPIGATElhglvlrthlllvLKKKYFMSerrrteeaevrEKFTWIDLAERW----  436
            PP +  P+    L GL+LR HL+ +LKKK F+ +            F+  D A++     
Sbjct  619  PPLSHSPV----LFGLILRAHLVELLKKKAFIRDPVPAGSDAFN-HFSADDFAKKGLDHG  673

Query  435  GKIEDVAVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKALLLFRQVGLRHMIILPKYQAA  256
             ++E++ +T +EM+M++DLHP  NT+PYTVVE++S+AKAL+LFR+VGLRH++++PK   +
Sbjct  674  DRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVGLRHLLVIPK--VS  731

Query  255  GVSPVVGILTRQDLRAHNILSVFPHLANSK  166
            G  PVVGI+TR D    ++LS+ P LA SK
Sbjct  732  GRVPVVGIITRHDFMPEHVLSLHPSLAKSK  761



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360