BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001B18

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    347   7e-114   Cucumis melo [Oriental melon]
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    347   1e-113   Sesamum indicum [beniseed]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    347   1e-113   Cucumis sativus [cucumbers]
gb|KJB14026.1|  hypothetical protein B456_002G107300                    343   2e-112   Gossypium raimondii
gb|KJB14025.1|  hypothetical protein B456_002G107300                    343   3e-112   Gossypium raimondii
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    343   4e-112   Sesamum indicum [beniseed]
gb|KHG01489.1|  hypothetical protein F383_22605                         342   8e-112   Gossypium arboreum [tree cotton]
gb|KDP25067.1|  hypothetical protein JCGZ_22602                         342   8e-112   Jatropha curcas
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    340   7e-111   Fragaria vesca subsp. vesca
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    340   7e-111   Nicotiana tomentosiformis
ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    339   8e-111   Nicotiana sylvestris
sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    339   8e-111   Nicotiana tabacum [American tobacco]
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    339   8e-111   Malus domestica [apple tree]
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    339   9e-111   Nelumbo nucifera [Indian lotus]
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    339   1e-110   Cicer arietinum [garbanzo]
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    338   2e-110   
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    338   3e-110   
gb|ADR71054.1|  phosphoglycerate kinase                                 337   4e-110   Nicotiana benthamiana
gb|KHN21386.1|  Phosphoglycerate kinase, chloroplastic                  327   4e-110   Glycine soja [wild soybean]
gb|AFK48886.1|  unknown                                                 326   7e-110   Lotus japonicus
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    337   1e-109   Prunus mume [ume]
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  337   1e-109   Ricinus communis
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    337   1e-109   Solanum lycopersicum
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   336   1e-109   Citrus sinensis [apfelsine]
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    336   1e-109   
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        336   1e-109   Solanum tuberosum [potatoes]
gb|AAC26785.1|  phosphoglycerate kinase precursor                       336   1e-109   Solanum tuberosum [potatoes]
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    336   2e-109   Glycine max [soybeans]
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    336   2e-109   Phoenix dactylifera
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             336   2e-109   Citrus clementina [clementine]
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  336   2e-109   Solanum tuberosum [potatoes]
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    335   2e-109   
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    335   3e-109   Eucalyptus grandis [rose gum]
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    335   3e-109   Elaeis guineensis
emb|CBI24182.3|  unnamed protein product                                333   3e-109   Vitis vinifera
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             335   3e-109   Prunus persica
ref|XP_010094703.1|  Phosphoglycerate kinase                            335   3e-109   Morus notabilis
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    335   5e-109   Phoenix dactylifera
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    334   7e-109   Vitis vinifera
ref|XP_003596091.1|  Phosphoglycerate kinase                            334   8e-109   Medicago truncatula
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          334   9e-109   
gb|ACJ85441.1|  unknown                                                 326   9e-109   Medicago truncatula
gb|EMT12348.1|  Phosphoglycerate kinase, chloroplastic                  330   2e-108   
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                333   2e-108   Erythranthe guttata [common monkey flower]
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   332   5e-108   Helianthus annuus
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    332   1e-107   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           332   1e-107   
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    332   1e-107   Elaeis guineensis
emb|CDP13574.1|  unnamed protein product                                328   1e-107   Coffea canephora [robusta coffee]
gb|AAA79705.1|  phosphoglycerate kinase                                 322   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    330   2e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             330   2e-107   Phaseolus vulgaris [French bean]
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          330   3e-107   Sorghum bicolor [broomcorn]
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  329   3e-107   Triticum urartu
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    328   3e-107   Oryza brachyantha
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    330   4e-107   Setaria italica
ref|NP_001055937.1|  Os05g0496200                                       319   6e-107   
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    329   1e-106   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH57185.1|  AT1G79550                                              319   2e-106   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66037.1|  phosphoglycerate kinase, chloroplastic                  328   2e-106   Genlisea aurea
ref|NP_001117503.1|  phosphoglycerate kinase                            325   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    327   7e-106   Populus euphratica
ref|NP_176015.1|  phosphoglycerate kinase                               327   8e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             326   9e-106   
gb|ACN32155.1|  unknown                                                 323   2e-105   Zea mays [maize]
gb|AFW78533.1|  phosphoglycerate kinase                                 325   2e-105   
ref|XP_006858226.1|  hypothetical protein AMTR_s00062p00189550          325   4e-105   Amborella trichopoda
ref|NP_178073.1|  phosphoglycerate kinase                               322   4e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AFW78532.1|  phosphoglycerate kinase                                 325   5e-105   
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg             322   5e-105   
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    324   6e-105   
ref|NP_001147628.1|  phosphoglycerate kinase                            324   8e-105   
gb|AAM61185.1|  phosphoglycerate kinase, putative                       321   8e-105   Arabidopsis thaliana [mouse-ear cress]
gb|ABK96267.1|  unknown                                                 324   1e-104   Populus trichocarpa x Populus deltoides
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    323   1e-104   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    323   1e-104   
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    320   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    323   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             323   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             322   4e-104   Capsella rubella
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             322   5e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic      319   6e-104   Nelumbo nucifera [Indian lotus]
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124             319   7e-104   
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    321   8e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg             318   1e-103   Eutrema salsugineum [saltwater cress]
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic      318   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    325   2e-103   
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    320   2e-103   Camelina sativa [gold-of-pleasure]
gb|AAB60303.1|  phosphoglycerate kinase                                 318   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    317   3e-103   Glycine max [soybeans]
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    320   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic      317   5e-103   Fragaria vesca subsp. vesca
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942             317   6e-103   
emb|CDX87375.1|  BnaA07g34980D                                          317   6e-103   
gb|KEH15368.1|  phosphoglycerate kinase-like protein                    310   7e-103   Medicago truncatula
emb|CDX67989.1|  BnaA07g20290D                                          315   7e-103   
ref|NP_187884.1|  phosphoglycerate kinase 1                             319   8e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73803.1|  BnaA03g32440D                                          319   9e-103   
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             318   1e-102   Eutrema salsugineum [saltwater cress]
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                       316   1e-102   Helianthus annuus
emb|CDY49746.1|  BnaA02g19260D                                          315   1e-102   Brassica napus [oilseed rape]
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic      315   2e-102   
emb|CDY00798.1|  BnaC03g37820D                                          318   2e-102   
emb|CDX88547.1|  BnaC06g39910D                                          314   2e-102   
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic      315   2e-102   Sesamum indicum [beniseed]
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic      315   2e-102   Brassica rapa
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    318   3e-102   Setaria italica
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    318   3e-102   Setaria italica
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    315   3e-102   Brassica rapa
ref|XP_010094705.1|  Phosphoglycerate kinase                            315   4e-102   Morus notabilis
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                  315   4e-102   
ref|XP_010669985.1|  PREDICTED: phosphoglycerate kinase, cytosolic      314   4e-102   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                   314   7e-102   Citrus sinensis [apfelsine]
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             316   1e-101   
gb|KCW71393.1|  hypothetical protein EUGRSUZ_F04463                     311   1e-101   Eucalyptus grandis [rose gum]
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic      313   1e-101   Nicotiana sylvestris
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic      313   1e-101   Nicotiana tomentosiformis
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic      313   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43401.1|  BnaA01g30320D                                          315   2e-101   Brassica napus [oilseed rape]
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic      312   2e-101   Populus euphratica
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic      312   2e-101   Eucalyptus grandis [rose gum]
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic      312   3e-101   Malus domestica [apple tree]
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic      312   3e-101   
emb|CDY70232.1|  BnaC02g46710D                                          312   4e-101   Brassica napus [oilseed rape]
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg             312   4e-101   Citrus clementina [clementine]
emb|CDY24247.1|  BnaC01g38270D                                          314   4e-101   Brassica napus [oilseed rape]
gb|AIZ68220.1|  phosphoglycerate kinase                                 311   5e-101   Ornithogalum longebracteatum [sea-onion]
emb|CBL95264.1|  phosphoglycerate kinase 1                              315   5e-101   Pinus pinaster [cluster pine]
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    314   6e-101   Brassica rapa
gb|KDP25066.1|  hypothetical protein JCGZ_22601                         311   6e-101   Jatropha curcas
gb|KJB14020.1|  hypothetical protein B456_002G107200                    310   7e-101   Gossypium raimondii
gb|AIZ74346.1|  phosphoglycerate kinase 1                               315   8e-101   Pinus massoniana [Chinese red pine]
gb|AAF85975.1|AF275639_1  cytosolic phosphoglycerate kinase             311   8e-101   Pisum sativum [garden pea]
emb|CDX79326.1|  BnaC06g19770D                                          309   1e-100   
gb|AAX57302.1|  putative phospho-glycerate kinase                       304   1e-100   Solanum peruvianum [Peruvian tomato]
gb|ABS19535.1|  CT114                                                   304   1e-100   Solanum chilense
ref|XP_003596093.1|  Phosphoglycerate kinase                            311   1e-100   Medicago truncatula
ref|XP_003596092.1|  Phosphoglycerate kinase                            310   2e-100   Medicago truncatula
gb|ABS19537.1|  CT114                                                   304   2e-100   [Lycopersicon] peruvianum var. humifusum
gb|AAX57323.1|  putative phospho-glycerate kinase                       304   2e-100   Solanum habrochaites
gb|KJB14019.1|  hypothetical protein B456_002G107200                    310   2e-100   Gossypium raimondii
gb|ABS19544.1|  CT114                                                   303   2e-100   [Lycopersicon] peruvianum var. humifusum
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic      310   2e-100   Prunus mume [ume]
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg                310   3e-100   Erythranthe guttata [common monkey flower]
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    310   3e-100   Sesamum indicum [beniseed]
emb|CBI24183.3|  unnamed protein product                                308   4e-100   Vitis vinifera
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                    309   4e-100   Populus nigra [black poplar]
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg             311   4e-100   
ref|XP_002513352.1|  phosphoglycerate kinase, putative                  309   5e-100   Ricinus communis
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    311   5e-100   Brassica rapa
gb|ABS19536.1|  CT114                                                   303   5e-100   Solanum chilense
ref|NP_001167912.1|  phosphoglycerate kinase                            308   5e-100   Zea mays [maize]
gb|ABS19556.1|  CT114                                                   303   5e-100   [Lycopersicon] peruvianum var. humifusum
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic      309   5e-100   Elaeis guineensis
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like            309   5e-100   Solanum tuberosum [potatoes]
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    309   6e-100   Nicotiana sylvestris
gb|AAZ85273.1|  putative phosphoglycerate kinase                        302   6e-100   Solanum chmielewskii
gb|ABS19538.1|  CT114                                                   302   7e-100   [Lycopersicon] peruvianum var. humifusum
gb|AFK46712.1|  unknown                                                 308   7e-100   Medicago truncatula
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic      308   8e-100   Vitis vinifera
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    310   8e-100   Spinacia oleracea
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    308   8e-100   Elaeis guineensis
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    308   9e-100   
gb|ABK92531.1|  unknown                                                 308   1e-99    Populus trichocarpa [western balsam poplar]
gb|AAO63774.1|  3-phosphoglycerate kinase                               308   1e-99    Populus tremuloides
gb|ACJ11718.1|  phosphoglycerate kinase                                 308   1e-99    Gossypium hirsutum [American cotton]
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g             308   1e-99    Phaseolus vulgaris [French bean]
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic      307   2e-99    Tarenaya hassleriana [spider flower]
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...    307   2e-99    
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    307   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006858233.1|  hypothetical protein AMTR_s00062p00191350          307   3e-99    Amborella trichopoda
gb|ABS19547.1|  CT114                                                   300   5e-99    [Lycopersicon] peruvianum var. humifusum
emb|CDP13576.1|  unnamed protein product                                306   5e-99    Coffea canephora [robusta coffee]
gb|ABK24564.1|  unknown                                                 310   7e-99    Picea sitchensis
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    306   7e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g             306   7e-99    
gb|EEC71648.1|  hypothetical protein OsI_04088                          308   8e-99    Oryza sativa Indica Group [Indian rice]
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      308   8e-99    Phaseolus vulgaris [French bean]
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    308   1e-98    Brassica rapa
gb|ABB86242.1|  phosphoglycerate kinase-like                            306   1e-98    Solanum tuberosum [potatoes]
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    305   1e-98    Cucumis sativus [cucumbers]
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic      305   2e-98    Cucumis melo [Oriental melon]
gb|EPS64076.1|  phosphoglycerate kinase                                 305   2e-98    Genlisea aurea
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    305   2e-98    Nicotiana tomentosiformis
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    307   3e-98    Populus euphratica
gb|ABF69999.1|  phosphoglycerate kinase, putative                       304   3e-98    Musa acuminata [banana]
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic      304   5e-98    Phoenix dactylifera
gb|AGT16255.1|  phosphoglycerate kinase                                 306   5e-98    Saccharum hybrid cultivar R570
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                    304   6e-98    Populus nigra [black poplar]
ref|XP_004488762.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    303   7e-98    Cicer arietinum [garbanzo]
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    303   1e-97    Populus euphratica
ref|XP_010544342.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    303   2e-97    Tarenaya hassleriana [spider flower]
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic      302   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP16886.1|  unnamed protein product                                302   3e-97    Coffea canephora [robusta coffee]
dbj|BAJ88371.1|  predicted protein                                      301   3e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                     301   4e-97    Helianthus annuus
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...    301   4e-97    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic      302   5e-97    Tarenaya hassleriana [spider flower]
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    300   1e-96    Brassica rapa
emb|CDY52872.1|  BnaCnng23600D                                          311   1e-96    Brassica napus [oilseed rape]
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    299   4e-96    Setaria italica
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic      298   7e-96    Phoenix dactylifera
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic      298   1e-95    Brachypodium distachyon [annual false brome]
ref|NP_001058317.1|  Os06g0668200                                       296   4e-95    
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116             296   7e-95    Selaginella moellendorffii
ref|NP_001142404.1|  uncharacterized protein LOC100274579               295   1e-94    Zea mays [maize]
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742              295   1e-94    Selaginella moellendorffii
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    295   2e-94    Setaria italica
gb|AFW70281.1|  phosphoglycerate kinase                                 298   1e-93    
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                      292   2e-93    
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    292   2e-93    Oryza brachyantha
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    288   7e-92    Oryza brachyantha
ref|WP_015184203.1|  phosphoglycerate kinase                            288   1e-91    Microcoleus sp. PCC 7113
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    288   1e-91    Populus euphratica
dbj|BAJ85222.1|  predicted protein                                      288   1e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_035992253.1|  phosphoglycerate kinase                            287   1e-91    Leptolyngbya sp. KIOST-1
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                      290   2e-91    
ref|WP_017300589.1|  phosphoglycerate kinase                            286   4e-91    Nodosilinea nodulosa
gb|ABR25550.1|  phosphoglycerate kinase                                 278   8e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001046020.1|  Os02g0169300                                       285   1e-90    
gb|ABI74567.1|  phosphoglycerate kinase                                 285   2e-90    Oryza sativa Indica Group [Indian rice]
ref|WP_011377868.1|  MULTISPECIES: phosphoglycerate kinase              284   3e-90    Synechococcus
dbj|BAA21478.1|  phosphoglycerate kinase                                276   1e-89    Robinia pseudoacacia [black locust]
ref|WP_041032823.1|  phosphoglycerate kinase                            282   1e-89    Tolypothrix campylonemoides
ref|WP_011242745.1|  phosphoglycerate kinase                            282   2e-89    Synechococcus elongatus
ref|WP_039728851.1|  MULTISPECIES: phosphoglycerate kinase              282   2e-89    Lyngbya confervoides
ref|WP_016865730.1|  phosphoglycerate kinase                            282   2e-89    Fischerella muscicola
gb|ABI74568.1|  phosphoglycerate kinase                                 282   2e-89    Oryza sativa Indica Group [Indian rice]
ref|WP_029637902.1|  phosphoglycerate kinase [                          281   2e-89    [Scytonema hofmanni] UTEX B 1581
ref|WP_011936642.1|  phosphoglycerate kinase                            281   3e-89    Synechococcus sp. RCC307
ref|WP_015166011.1|  phosphoglycerate kinase                            281   3e-89    Pseudanabaena sp. PCC 7367
ref|WP_026734580.1|  phosphoglycerate kinase                            280   7e-89    Fischerella sp. PCC 9605
ref|WP_016924803.1|  phosphoglycerate kinase                            280   1e-88    Prochlorothrix hollandica
ref|WP_026097925.1|  phosphoglycerate kinase                            280   1e-88    Geitlerinema sp. PCC 7105
ref|WP_035831895.1|  phosphoglycerate kinase                            280   2e-88    
ref|WP_006105635.1|  phosphoglycerate kinase                            280   2e-88    Coleofasciculus chthonoplastes
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase              279   2e-88    Hapalosiphonaceae
gb|AFH41108.1|  plastid 3-phosphoglycerate kinase                       275   3e-88    Triticum aestivum subsp. yunnanense
gb|AFH41121.1|  plastid 3-phosphoglycerate kinase                       275   3e-88    Triticum spelta [spelt]
gb|ACO40271.1|  3-phosphoglycerate kinase                               275   3e-88    Leymus pseudoracemosus
gb|ACO40274.1|  3-phosphoglycerate kinase                               275   3e-88    Leymus duthiei
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase              279   3e-88    Fischerella thermalis
gb|AID16262.1|  phosphoglycerate kinase                                 275   3e-88    Triticum petropavlovskyi
ref|WP_007099195.1|  phosphoglycerate kinase                            279   3e-88    Synechococcus sp. RS9916
gb|AFH41102.1|  plastid 3-phosphoglycerate kinase                       275   3e-88    Triticum aestivum [Canadian hard winter wheat]
gb|AFH41091.1|  plastid 3-phosphoglycerate kinase                       275   3e-88    Triticum compactum
gb|AID16252.1|  phosphoglycerate kinase                                 275   3e-88    Triticum aestivum subsp. yunnanense
gb|AAM51702.1|AF343476_1  3-phosphoglycerate kinase                     275   3e-88    Triticum dicoccoides [wild emmer wheat]
gb|AAM51700.1|AF343474_1  3-phosphoglycerate kinase                     275   3e-88    Triticum urartu
gb|AFH41101.1|  plastid 3-phosphoglycerate kinase                       275   3e-88    Triticum aestivum [Canadian hard winter wheat]
gb|AFH41131.1|  plastid 3-phosphoglycerate kinase                       275   3e-88    Triticum turgidum subsp. turanicum
ref|WP_013321558.1|  phosphoglycerate kinase                            279   3e-88    Cyanothece sp. PCC 7822
ref|WP_016861411.1|  phosphoglycerate kinase                            279   4e-88    Fischerella muscicola
gb|AID16255.1|  phosphoglycerate kinase                                 275   4e-88    Triticum petropavlovskyi
gb|ACO40272.1|  3-phosphoglycerate kinase                               275   4e-88    Leymus secalinus
gb|ACO40247.1|  3-phosphoglycerate kinase                               275   4e-88    Psathyrostachys fragilis
ref|WP_026135280.1|  phosphoglycerate kinase                            278   4e-88    Scytonema hofmannii
ref|WP_039739530.1|  phosphoglycerate kinase                            278   4e-88    
gb|AFH41130.1|  plastid 3-phosphoglycerate kinase                       275   4e-88    Triticum petropavlovskyi
ref|WP_017289328.1|  phosphoglycerate kinase                            278   4e-88    Leptolyngbya boryana
gb|AFH41149.1|  plastid 3-phosphoglycerate kinase                       275   5e-88    Triticum timopheevii [Sanduri wheat]
gb|AFH41081.1|  plastid 3-phosphoglycerate kinase                       275   5e-88    Aegilops tauschii subsp. tauschii x Triticum turgidum subsp. polonicum
gb|AEQ59379.1|  3-phosphoglycerate kinase                               275   5e-88    Kengyilia hirsuta
gb|AGL91125.1|  3-phosphoglycerate kinase                               275   5e-88    Elymus kamoji
gb|AEQ59398.1|  3-phosphoglycerate kinase                               275   6e-88    Kengyilia alatavica
gb|AEQ59380.1|  3-phosphoglycerate kinase                               275   6e-88    Kengyilia hirsuta
gb|AEQ59377.1|  3-phosphoglycerate kinase                               275   6e-88    Kengyilia kokonorica
gb|ACO40277.1|  3-phosphoglycerate kinase                               275   6e-88    Leymus arenarius
gb|ACO40261.1|  3-phosphoglycerate kinase                               275   6e-88    Heteranthelium piliferum
gb|AEQ59408.1|  3-phosphoglycerate kinase                               275   6e-88    Kengyilia rigidula
gb|ACO40268.1|  3-phosphoglycerate kinase                               275   6e-88    Peridictyon sanctum
gb|ACO40256.1|  3-phosphoglycerate kinase                               275   6e-88    Australopyrum retrofractum
ref|WP_027842190.1|  phosphoglycerate kinase                            278   7e-88    Mastigocoleus testarum
ref|WP_026719925.1|  phosphoglycerate kinase                            278   7e-88    Fischerella sp. PCC 9431
ref|WP_028953033.1|  phosphoglycerate kinase                            278   8e-88    Synechococcus sp. CC9616
gb|AFH41088.1|  plastid 3-phosphoglycerate kinase                       274   8e-88    Triticum carthlicum [Persian black wheat]
dbj|BAA18521.1|  phosphoglycerate kinase                                277   8e-88    Synechocystis sp. PCC 6803
ref|WP_011827369.1|  phosphoglycerate kinase                            278   9e-88    
gb|AFH41155.1|  plastid 3-phosphoglycerate kinase                       274   9e-88    Triticum aestivum subsp. yunnanense
ref|WP_026098466.1|  phosphoglycerate kinase                            278   9e-88    
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase            278   1e-87    
gb|ACO40262.1|  3-phosphoglycerate kinase                               274   1e-87    
ref|WP_010873144.1|  phosphoglycerate kinase                            277   1e-87    
ref|WP_038552523.1|  phosphoglycerate kinase                            277   1e-87    
ref|WP_016873269.1|  phosphoglycerate kinase                            277   1e-87    
gb|AFH41074.1|  plastid 3-phosphoglycerate kinase                       274   1e-87    
ref|WP_028089947.1|  phosphoglycerate kinase                            277   1e-87    
gb|AEQ59407.1|  3-phosphoglycerate kinase                               274   1e-87    
gb|AEQ59375.1|  3-phosphoglycerate kinase                               274   1e-87    
gb|AFH41104.1|  plastid 3-phosphoglycerate kinase                       273   2e-87    
gb|AFH41099.1|  plastid 3-phosphoglycerate kinase                       273   2e-87    
gb|AEQ59415.1|  3-phosphoglycerate kinase                               273   2e-87    
gb|AFH41144.1|  plastid 3-phosphoglycerate kinase                       273   2e-87    
gb|ACO40269.1|  3-phosphoglycerate kinase                               273   2e-87    
ref|WP_011129182.1|  phosphoglycerate kinase                            277   2e-87    
ref|WP_011058101.1|  phosphoglycerate kinase                            276   2e-87    
ref|WP_011620601.1|  phosphoglycerate kinase                            277   2e-87    
gb|KIE11439.1|  phosphoglycerate kinase                                 276   2e-87    
ref|WP_040940054.1|  phosphoglycerate kinase                            276   2e-87    
gb|AEQ59383.1|  3-phosphoglycerate kinase                               273   2e-87    
gb|AGL91113.1|  3-phosphoglycerate kinase                               273   2e-87    
gb|AGL91045.1|  3-phosphoglycerate kinase                               273   2e-87    
ref|WP_006528046.1|  phosphoglycerate kinase                            276   2e-87    
gb|ACO40276.1|  3-phosphoglycerate kinase                               273   2e-87    
gb|ACO40270.1|  3-phosphoglycerate kinase                               273   2e-87    
ref|WP_015149149.1|  phosphoglycerate kinase                            276   2e-87    
ref|WP_015119342.1|  phosphoglycerate kinase                            276   2e-87    
gb|AFH41095.1|  plastid 3-phosphoglycerate kinase                       273   3e-87    
gb|AGL91123.1|  3-phosphoglycerate kinase                               273   3e-87    
gb|AEQ59378.1|  3-phosphoglycerate kinase                               273   3e-87    
gb|ACO40241.1|  3-phosphoglycerate kinase                               273   3e-87    
gb|ACO40243.1|  3-phosphoglycerate kinase                               273   3e-87    
gb|ACO40239.1|  3-phosphoglycerate kinase                               273   3e-87    
ref|WP_036911068.1|  MULTISPECIES: phosphoglycerate kinase              276   3e-87    
gb|AGL91127.1|  3-phosphoglycerate kinase                               273   3e-87    
gb|AFH41073.1|  plastid 3-phosphoglycerate kinase                       273   3e-87    
gb|ABR16231.1|  unknown                                                 278   3e-87    
gb|ACO40264.1|  3-phosphoglycerate kinase                               273   3e-87    
gb|AID16253.1|  phosphoglycerate kinase                                 273   4e-87    
gb|AFH41140.1|  plastid 3-phosphoglycerate kinase                       273   4e-87    
ref|WP_017294263.1|  phosphoglycerate kinase                            276   4e-87    
ref|WP_015190859.1|  phosphoglycerate kinase                            276   4e-87    
gb|AEQ59384.1|  3-phosphoglycerate kinase                               272   4e-87    
gb|ACO40255.1|  3-phosphoglycerate kinase                               272   4e-87    
gb|AHF64875.1|  Phosphoglycerate kinase                                 276   4e-87    
gb|AEQ59427.1|  3-phosphoglycerate kinase                               272   4e-87    
gb|AEQ59435.1|  3-phosphoglycerate kinase                               272   5e-87    
gb|ACO40259.1|  3-phosphoglycerate kinase                               272   5e-87    
ref|WP_011131470.1|  phosphoglycerate kinase                            276   5e-87    
gb|ACO40254.1|  3-phosphoglycerate kinase                               272   5e-87    
gb|AID16249.1|  phosphoglycerate kinase                                 272   5e-87    
gb|AEQ59432.1|  3-phosphoglycerate kinase                               272   5e-87    
gb|AGL91121.1|  3-phosphoglycerate kinase                               272   5e-87    
gb|AGL91112.1|  3-phosphoglycerate kinase                               272   5e-87    
gb|AGL91108.1|  3-phosphoglycerate kinase                               272   5e-87    
gb|AEQ59418.1|  3-phosphoglycerate kinase                               272   5e-87    
gb|AEQ59386.1|  3-phosphoglycerate kinase                               272   5e-87    
ref|WP_028085373.1|  phosphoglycerate kinase                            276   5e-87    
gb|AEQ59417.1|  3-phosphoglycerate kinase                               272   6e-87    
gb|ACO40273.1|  3-phosphoglycerate kinase                               272   6e-87    
gb|AEQ59412.1|  3-phosphoglycerate kinase                               272   6e-87    
gb|AEQ59436.1|  3-phosphoglycerate kinase                               272   6e-87    
gb|AID16261.1|  phosphoglycerate kinase                                 272   6e-87    
gb|AEQ59413.1|  3-phosphoglycerate kinase                               272   6e-87    
gb|AAM51708.1|AF343482_1  3-phosphoglycerate kinase                     272   6e-87    
gb|AEQ59382.1|  3-phosphoglycerate kinase                               272   6e-87    
gb|ACO40267.1|  3-phosphoglycerate kinase                               272   7e-87    
gb|ACO40260.1|  3-phosphoglycerate kinase                               272   7e-87    
ref|WP_012194769.1|  phosphoglycerate kinase                            275   7e-87    
ref|WP_009628155.1|  phosphoglycerate kinase                            275   7e-87    
ref|WP_043693415.1|  phosphoglycerate kinase                            275   7e-87    
gb|AEQ59402.1|  3-phosphoglycerate kinase                               272   7e-87    
gb|AGL91103.1|  3-phosphoglycerate kinase                               272   7e-87    
ref|WP_015218887.1|  phosphoglycerate kinase                            275   7e-87    
gb|AAM51720.1|AF343494_1  3-phosphoglycerate kinase                     272   7e-87    
ref|WP_011365387.1|  phosphoglycerate kinase                            275   7e-87    
gb|AEQ59422.1|  3-phosphoglycerate kinase                               272   7e-87    
gb|ACO40251.1|  3-phosphoglycerate kinase                               272   7e-87    
gb|AFH41139.1|  plastid 3-phosphoglycerate kinase                       272   8e-87    
ref|WP_040931032.1|  phosphoglycerate kinase                            275   8e-87    
ref|WP_024125258.1|  phosphoglycerate kinase                            275   8e-87    
gb|AEQ59403.1|  3-phosphoglycerate kinase                               272   8e-87    
gb|AGL91128.1|  3-phosphoglycerate kinase                               272   8e-87    
gb|KGG29033.1|  Phosphoglycerate kinase                                 276   8e-87    
gb|AGL91104.1|  3-phosphoglycerate kinase                               271   9e-87    
ref|WP_008189591.1|  phosphoglycerate kinase                            275   1e-86    
gb|AID16246.1|  phosphoglycerate kinase                                 271   1e-86    
ref|WP_041765481.1|  phosphoglycerate kinase                            275   1e-86    
gb|ACO40266.1|  3-phosphoglycerate kinase                               271   1e-86    
gb|ACO40249.1|  3-phosphoglycerate kinase                               271   1e-86    
gb|ACO40263.1|  3-phosphoglycerate kinase                               271   1e-86    
gb|AFH41084.1|  plastid 3-phosphoglycerate kinase                       271   1e-86    
gb|ACO40257.1|  3-phosphoglycerate kinase                               271   1e-86    
gb|AFH41124.1|  plastid 3-phosphoglycerate kinase                       271   2e-86    
gb|AEQ59399.1|  3-phosphoglycerate kinase                               271   2e-86    
gb|AEQ59396.1|  3-phosphoglycerate kinase                               271   2e-86    
gb|AFY38465.1|  phosphoglycerate kinase                                 275   2e-86    
ref|WP_006042911.1|  phosphoglycerate kinase                            274   2e-86    
gb|AEQ59411.1|  3-phosphoglycerate kinase                               271   2e-86    
gb|AGL91129.1|  3-phosphoglycerate kinase                               271   2e-86    
ref|WP_011360883.1|  phosphoglycerate kinase                            274   2e-86    
gb|AGL91124.1|  3-phosphoglycerate kinase                               270   3e-86    
ref|WP_009788740.1|  phosphoglycerate kinase                            274   3e-86    
gb|AFH41106.1|  plastid 3-phosphoglycerate kinase                       270   3e-86    
gb|AEQ59420.1|  3-phosphoglycerate kinase                               270   3e-86    
ref|WP_015204810.1|  phosphoglycerate kinase                            274   3e-86    
gb|AEQ59414.1|  3-phosphoglycerate kinase                               270   3e-86    
gb|AEQ59434.1|  3-phosphoglycerate kinase                               270   3e-86    
gb|AEQ59421.1|  3-phosphoglycerate kinase                               270   3e-86    
ref|WP_015167138.1|  phosphoglycerate kinase                            273   3e-86    
ref|WP_015145174.1|  phosphoglycerate kinase                            273   4e-86    
gb|AEQ59393.1|  3-phosphoglycerate kinase                               270   5e-86    
gb|AAM51719.1|AF343493_1  3-phosphoglycerate kinase                     270   5e-86    
gb|AFH41137.1|  plastid 3-phosphoglycerate kinase                       270   5e-86    
gb|AEQ59392.1|  3-phosphoglycerate kinase                               270   6e-86    
gb|KIZ02489.1|  phosphoglycerate kinase                                 265   6e-86    
ref|WP_019502041.1|  phosphoglycerate kinase                            273   7e-86    
ref|WP_019495207.1|  phosphoglycerate kinase                            273   7e-86    
ref|WP_015198799.1|  phosphoglycerate kinase                            273   7e-86    
ref|WP_017323648.1|  phosphoglycerate kinase                            273   7e-86    
gb|AEQ59430.1|  3-phosphoglycerate kinase                               269   8e-86    
ref|WP_011934238.1|  phosphoglycerate kinase                            273   8e-86    
gb|AEQ59387.1|  3-phosphoglycerate kinase                               269   8e-86    
ref|WP_017303631.1|  phosphoglycerate kinase                            273   8e-86    
gb|AGL91126.1|  3-phosphoglycerate kinase                               269   1e-85    
gb|AEQ59391.1|  3-phosphoglycerate kinase                               269   1e-85    
ref|WP_006854064.1|  phosphoglycerate kinase                            272   1e-85    
gb|AEQ59409.1|  3-phosphoglycerate kinase                               268   1e-85    
ref|WP_036901530.1|  phosphoglycerate kinase                            272   2e-85    
gb|ACO40279.1|  3-phosphoglycerate kinase                               268   2e-85    
ref|WP_006173249.1|  phosphoglycerate kinase                            271   2e-85    
ref|WP_015153171.1|  phosphoglycerate kinase                            271   2e-85    
ref|WP_023076270.1|  phosphoglycerate kinase                            271   2e-85    
gb|ACO40242.1|  3-phosphoglycerate kinase                               268   2e-85    
gb|AEQ59423.1|  3-phosphoglycerate kinase                               268   2e-85    
ref|WP_015785332.1|  MULTISPECIES: phosphoglycerate kinase              271   3e-85    
gb|ACO40258.1|  3-phosphoglycerate kinase                               268   3e-85    
gb|AGH55660.1|  phosphoglycerate kinase                                 270   3e-85    
ref|WP_008234716.1|  phosphoglycerate kinase                            271   4e-85    
ref|WP_006507734.1|  phosphoglycerate kinase                            270   6e-85    
ref|WP_038547249.1|  phosphoglycerate kinase                            270   6e-85    
ref|YP_002049002.1|  Phosphoglycerate kinase                            270   6e-85    
ref|WP_028947361.1|  phosphoglycerate kinase                            270   7e-85    
gb|ACO40245.1|  3-phosphoglycerate kinase                               267   7e-85    
ref|WP_012598967.1|  phosphoglycerate kinase                            270   8e-85    
gb|AEQ59431.1|  3-phosphoglycerate kinase                               266   9e-85    
ref|WP_039715776.1|  phosphoglycerate kinase                            270   1e-84    
ref|WP_022604954.1|  phosphoglycerate kinase                            270   1e-84    
ref|WP_017317549.1|  phosphoglycerate kinase                            269   1e-84    
ref|WP_035157181.1|  phosphoglycerate kinase                            269   1e-84    
ref|WP_009631644.1|  phosphoglycerate kinase                            269   2e-84    
ref|XP_001699523.1|  phosphoglycerate kinase                            271   2e-84    
ref|WP_006911676.1|  phosphoglycerate kinase                            269   3e-84    
gb|KGG11463.1|  Phosphoglycerate kinase                                 268   3e-84    
ref|WP_011124376.1|  MULTISPECIES: phosphoglycerate kinase              268   4e-84    
gb|AGL76992.1|  phosphoglycerate kinase                                 266   7e-84    
ref|WP_015193656.1|  phosphoglycerate kinase                            268   7e-84    
ref|XP_005646469.1|  phosphoglycerate kinase precursor                  269   8e-84    
ref|WP_036916478.1|  MULTISPECIES: phosphoglycerate kinase              267   1e-83    
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase              266   2e-83    
gb|AAC32142.1|  phosphoglycerate kinase                                 258   3e-83    
gb|KCW71391.1|  hypothetical protein EUGRSUZ_F04463                     265   6e-83    
ref|WP_019507461.1|  phosphoglycerate kinase                            265   6e-83    
ref|WP_036904641.1|  phosphoglycerate kinase                            265   1e-82    
ref|WP_036484843.1|  phosphoglycerate kinase                            264   1e-82    
ref|XP_002951648.1|  phosphoglycerate kinase                            266   1e-82    
ref|WP_030007016.1|  phosphoglycerate kinase                            264   2e-82    
ref|WP_011823052.1|  phosphoglycerate kinase                            264   2e-82    
ref|WP_011429225.1|  phosphoglycerate kinase                            264   2e-82    
ref|WP_026101118.1|  phosphoglycerate kinase                            264   2e-82    
ref|WP_012307199.1|  phosphoglycerate kinase                            264   2e-82    
ref|WP_006515662.1|  phosphoglycerate kinase                            264   3e-82    
ref|WP_006278490.1|  phosphoglycerate kinase                            263   5e-82    
ref|WP_009343450.1|  phosphoglycerate kinase                            263   5e-82    
ref|WP_011294195.1|  phosphoglycerate kinase                            263   6e-82    
ref|WP_038650981.1|  phosphoglycerate kinase                            262   8e-82    
ref|WP_027404640.1|  phosphoglycerate kinase                            262   8e-82    
ref|WP_039205250.1|  phosphoglycerate kinase                            262   1e-81    
ref|WP_015110302.1|  phosphoglycerate kinase                            262   1e-81    
ref|WP_008311068.1|  phosphoglycerate kinase                            262   1e-81    
ref|WP_034417079.1|  phosphoglycerate kinase                            261   2e-81    
ref|WP_042152714.1|  phosphoglycerate kinase                            261   2e-81    
ref|WP_024545807.1|  phosphoglycerate kinase                            261   2e-81    
ref|XP_005851590.1|  hypothetical protein CHLNCDRAFT_29609              261   2e-81    
ref|WP_011317630.1|  phosphoglycerate kinase                            261   3e-81    
ref|WP_037220338.1|  phosphoglycerate kinase                            260   6e-81    
ref|WP_010998270.1|  phosphoglycerate kinase                            259   1e-80    
ref|WP_025980179.1|  phosphoglycerate kinase                            253   1e-80    
ref|WP_025980856.1|  phosphoglycerate kinase                            253   1e-80    
ref|WP_010305334.1|  phosphoglycerate kinase                            259   1e-80    
ref|WP_015080710.1|  phosphoglycerate kinase                            259   2e-80    
gb|KIJ83619.1|  phosphoglycerate kinase                                 259   2e-80    
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...    261   2e-80    
ref|WP_011433296.1|  phosphoglycerate kinase                            259   2e-80    
ref|WP_015162225.1|  phosphoglycerate kinase                            259   2e-80    
ref|WP_025942147.1|  phosphoglycerate kinase                            256   2e-80    
ref|WP_012412172.1|  phosphoglycerate kinase                            258   3e-80    
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                      259   4e-80    
ref|WP_007101320.1|  phosphoglycerate kinase                            258   4e-80    
ref|WP_015173530.1|  phosphoglycerate kinase                            258   5e-80    
ref|WP_010313479.1|  phosphoglycerate kinase                            258   5e-80    
ref|WP_025943278.1|  phosphoglycerate kinase                            257   9e-80    
ref|WP_025924106.1|  phosphoglycerate kinase                            257   9e-80    
ref|WP_025934740.1|  phosphoglycerate kinase                            257   1e-79    
ref|WP_015224558.1|  phosphoglycerate kinase                            257   1e-79    
ref|WP_025962791.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_011817688.1|  MULTISPECIES: phosphoglycerate kinase              256   1e-79    
ref|WP_025968960.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_025934229.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_025963501.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_025943564.1|  MULTISPECIES: phosphoglycerate kinase              256   1e-79    
ref|WP_025925003.1|  MULTISPECIES: phosphoglycerate kinase              256   1e-79    
ref|WP_032517310.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_025922800.1|  phosphoglycerate kinase                            256   2e-79    
ref|WP_025906011.1|  MULTISPECIES: phosphoglycerate kinase              256   2e-79    
ref|WP_025913196.1|  MULTISPECIES: phosphoglycerate kinase              256   2e-79    
ref|XP_001777571.1|  predicted protein                                  256   2e-79    
ref|WP_042849696.1|  phosphoglycerate kinase                            256   2e-79    
ref|WP_002806351.1|  phosphoglycerate kinase                            256   3e-79    
ref|WP_012007002.1|  phosphoglycerate kinase                            256   4e-79    



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   347 bits (891),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDV+IADKFAPDAN
Sbjct  302  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVIIADKFAPDAN  361

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  362  SKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  421

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  422  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAV  481

Query  207  PVA  199
            PVA
Sbjct  482  PVA  484



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDSVKTF+DALETTKTVIWNGPMGVFEFDKFAVGTE++A K
Sbjct  358  SKVVPASAIPDGWMGLDIGPDSVKTFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAT  477

Query  207  PVA  199
            PVA
Sbjct  478  PVA  480



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004154567.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDV+IADKFAPDAN
Sbjct  302  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVIIADKFAPDAN  361

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  362  SKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  421

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  422  LAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVLALDEAV  481

Query  207  PVA  199
            PVA
Sbjct  482  PVA  484



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  305  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAN  364

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  365  SKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  424

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV
Sbjct  425  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAV  484

Query  207  PVA  199
            PVA
Sbjct  485  PVA  487



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  305  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAN  364

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  365  SKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  424

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV
Sbjct  425  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAV  484

Query  207  PVA  199
            PVA
Sbjct  485  PVA  487



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/183 (95%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDA 
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAE  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDSVKTF+DALETTKTVIWNGPMGVFEFDKFAVGTE++A K
Sbjct  358  SKVVPASAIPDGWMGLDIGPDSVKTFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVLALDEAT  477

Query  207  PVA  199
            PVA
Sbjct  478  PVA  480



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   342 bits (878),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  305  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAN  364

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEF+KFAVGTE++AKK
Sbjct  365  SKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFEKFAVGTEAIAKK  424

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV
Sbjct  425  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAV  484

Query  207  PVA  199
            PVA
Sbjct  485  PVA  487



>gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 173/183 (95%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  304  GGGMIFTFYKAQGLSVGSSLVEEDKLNLATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  363

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGP+SVKTF++ALETTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  364  SKVVPASAIPDGWMGLDIGPESVKTFSEALETTKTVIWNGPMGVFEFDKFAVGTEAIAKK  423

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  424  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEAT  483

Query  207  PVA  199
            PVA
Sbjct  484  PVA  486



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG+SVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGISVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  357  SKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAV  476

Query  207  PV  202
            PV
Sbjct  477  PV  478



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 1/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  357  SKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA 
Sbjct  417  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEAD  476

Query  210  VPVA  199
             PVA
Sbjct  477  APVA  480



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   339 bits (870),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 1/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  357  SKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA 
Sbjct  417  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEAD  476

Query  210  VPVA  199
             PVA
Sbjct  477  APVA  480



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   339 bits (870),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 1/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  357  SKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA 
Sbjct  417  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEAD  476

Query  210  VPVA  199
             PVA
Sbjct  477  APVA  480



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   339 bits (870),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KA AKGVSLLLPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLMAKANAKGVSLLLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKK
Sbjct  357  SKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAT  476

Query  207  PV  202
            PV
Sbjct  477  PV  478



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   339 bits (870),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 181/183 (99%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLP+DVV+ADKFAPDAN
Sbjct  303  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPSDVVVADKFAPDAN  362

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  363  SKIVPASAIPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAVAKK  422

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  423  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAV  482

Query  207  PVA  199
             VA
Sbjct  483  AVA  485



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  296  GGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKAKGVSLLLPSDVVIADKFAPDAN  355

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPASAIPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  356  SQVVPASAIPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKK  415

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  416  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAT  475

Query  207  PVA  199
            PVA
Sbjct  476  PVA  478



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKK
Sbjct  357  SKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAI  476

Query  207  PV  202
             V
Sbjct  477  LV  478



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKK
Sbjct  357  SKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAI  476

Query  207  PV  202
             V
Sbjct  477  LV  478



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  357  SKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  417  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVVALDEA  475



>gb|KHN21386.1| Phosphoglycerate kinase, chloroplastic [Glycine soja]
Length=181

 Score =   327 bits (837),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -1

Query  738  MIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV  559
            MIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKV
Sbjct  1    MIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKV  60

Query  558  VPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAE  379
            VPASAIPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+
Sbjct  61   VPASAIPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAD  120

Query  378  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  199
            LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  121  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  180



>gb|AFK48886.1| unknown [Lotus japonicus]
Length=181

 Score =   326 bits (836),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -1

Query  738  MIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV  559
            MIFTFYKAQGLSVGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANSK+
Sbjct  1    MIFTFYKAQGLSVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSKI  60

Query  558  VPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAE  379
            VP+SAIPDGWMGLDIGPDS+K+F+DAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+
Sbjct  61   VPSSAIPDGWMGLDIGPDSIKSFSDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAD  120

Query  378  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  199
            LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  121  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  180



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA GTESVAKK
Sbjct  357  SKIVPASSIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAEGTESVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK+LPGV+ALDEA 
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKQLPGVLALDEAT  476

Query  207  PV  202
            PV
Sbjct  477  PV  478



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLPTDVVIADKFAPDAN
Sbjct  296  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKLKGVSLLLPTDVVIADKFAPDAN  355

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV ASAIPDGWMGLD+GP+SVKTFN+ALETTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  356  SKVVAASAIPDGWMGLDVGPESVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAIAKK  415

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  416  LAELSGKGVTTIIGGGDSVAAVEKVGVAEVMSHISTGGGASLELLEGKELPGVLALDEAT  475

Query  207  PVA  199
            PVA
Sbjct  476  PVA  478



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 179/184 (97%), Gaps = 1/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  358  SKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA 
Sbjct  418  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEAD  477

Query  210  VPVA  199
             PVA
Sbjct  478  APVA  481



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG+SVGSSLVEEDKL LAT+LL KAKAKGV+LLLP+DVVIADKFAPDAN
Sbjct  291  GGGMIFTFYKAQGISVGSSLVEEDKLDLATTLLAKAKAKGVNLLLPSDVVIADKFAPDAN  350

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA+AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  351  SKVVPATAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKK  410

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  411  LADLSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELPGVVALDEAT  470

Query  207  PVA  199
            PVA
Sbjct  471  PVA  473



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDAN
Sbjct  300  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDAN  359

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  360  SKVVPASAIPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  419

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  420  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAV  479

Query  207  PVA  199
            PVA
Sbjct  480  PVA  482



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 179/184 (97%), Gaps = 1/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  358  SKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA 
Sbjct  418  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEAD  477

Query  210  VPVA  199
             PVA
Sbjct  478  APVA  481



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 179/184 (97%), Gaps = 1/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  358  SKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA 
Sbjct  418  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEAD  477

Query  210  VPVA  199
             PVA
Sbjct  478  APVA  481



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDAN
Sbjct  302  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDAN  361

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  362  SKVVPASAIPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  421

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  422  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAV  481

Query  207  PVA  199
            PVA
Sbjct  482  PVA  484



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK++GVSL+LPTDVV+ADKFAPDAN
Sbjct  308  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLVKAKSRGVSLMLPTDVVVADKFAPDAN  367

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            +KVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  368  TKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIAKK  427

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  428  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAV  487

Query  207  PVA  199
            PVA
Sbjct  488  PVA  490



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG+SVGSSLVEEDKL LAT+LL KAKAKGV+LLLP+DVVIADKFAPDAN
Sbjct  291  GGGMIFTFYKAQGISVGSSLVEEDKLDLATTLLAKAKAKGVNLLLPSDVVIADKFAPDAN  350

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA+AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  351  SKVVPATAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKK  410

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  411  LADLSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELPGVVALDEAT  470

Query  207  PVA  199
            PVA
Sbjct  471  PVA  473



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 179/184 (97%), Gaps = 1/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  358  SKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-  211
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA 
Sbjct  418  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEAD  477

Query  210  VPVA  199
             PVA
Sbjct  478  APVA  481



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQ LSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQXLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKK
Sbjct  357  SKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAI  476

Query  207  PV  202
             V
Sbjct  477  LV  478



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL+KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  301  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLKKAKAKGVSLLLPTDVVIADKFAPDAN  360

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTFNDAL TTKTVIWNGPMGVFEFDKFA GTE+VAKK
Sbjct  361  SKIVPASAIPDGWMGLDIGPDSIKTFNDALGTTKTVIWNGPMGVFEFDKFAAGTEAVAKK  420

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS  GVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  421  LAELSAAGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAT  480

Query  207  PV  202
            PV
Sbjct  481  PV  482



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL+KAK+KGVSL+LPTDVVIADKFA DAN
Sbjct  307  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLKKAKSKGVSLMLPTDVVIADKFAADAN  366

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEF+KFAVGTE++AKK
Sbjct  367  SKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFEKFAVGTEAIAKK  426

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTT+IGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  427  LAELSGKGVTTVIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAV  486

Query  207  PVA  199
            PVA
Sbjct  487  PVA  489



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  222  GGGMIFTFYKAQGLSVGSSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+K FN+ALETTKTVIWNGPMGVFEFDKFA GT +VAKK
Sbjct  282  SKIVPASAIPDGWMGLDIGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKK  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGK VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  342  LAELSGKDVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAT  401

Query  207  PV  202
            PV
Sbjct  402  PV  403



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA GTESVAKK
Sbjct  357  SKIVPASSIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAEGTESVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGK+LPGV+ALDEA 
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKQLPGVLALDEAT  476

Query  207  PV  202
            PV
Sbjct  477  PV  478



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  295  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKAKGVSLLLPSDVVIADKFAPDAN  354

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VP+SAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  355  SKIVPSSAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKK  414

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  415  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAT  474

Query  207  PVA  199
            PVA
Sbjct  475  PVA  477



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL+KAK+KGVSL+LP DVVIADKFA DAN
Sbjct  305  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLKKAKSKGVSLMLPADVVIADKFAADAN  364

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  365  SKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIAKK  424

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  425  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAV  484

Query  207  PVA  199
            PVA
Sbjct  485  PVA  487



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   334 bits (857),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  295  GGGMIFTFYKAQGLSVGSSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  354

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+K FN+ALETTKTVIWNGPMGVFEFDKFA GT +VAKK
Sbjct  355  SKIVPASAIPDGWMGLDIGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKK  414

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGK VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  415  LAELSGKDVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAT  474

Query  207  PV  202
            PV
Sbjct  475  PV  476



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   334 bits (857),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  296  GGGMIFTFYKAQGLAVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDAN  355

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  356  SQIVPASAIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  415

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  416  LADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEAT  475

Query  207  PVA  199
            PVA
Sbjct  476  PVA  478



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   334 bits (857),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  305  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATLLLAKAKAKGVSLLLPTDVVIADKFAPDAN  364

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPASAIPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  365  SQVVPASAIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFATGTEAIAKK  424

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  425  LADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVVALDEAT  484

Query  207  PV  202
            PV
Sbjct  485  PV  486



>gb|ACJ85441.1| unknown [Medicago truncatula]
Length=260

 Score =   326 bits (836),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  77   GGGMIFTFYKAQGLAVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDAN  136

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTE +AKK
Sbjct  137  SQIVPASAIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEFIAKK  196

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGD VAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  197  LADLSGKGVTTIIGGGDFVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEAT  256

Query  207  PVA  199
            PVA
Sbjct  257  PVA  259



>gb|EMT12348.1| Phosphoglycerate kinase, chloroplastic [Aegilops tauschii]
Length=376

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  190  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  249

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  250  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  309

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE V
Sbjct  310  LAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGV  369



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIA+KFAPDA 
Sbjct  301  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVIANKFAPDAE  360

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+ IPDGWMGLDIGPDS+KTFN AL+TTKTVIWNGPMGVFEF+KFA GTE++A K
Sbjct  361  SKIVPATEIPDGWMGLDIGPDSIKTFNAALDTTKTVIWNGPMGVFEFEKFAAGTEAIANK  420

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+
Sbjct  421  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAI  480

Query  207  PVA  199
            PVA
Sbjct  481  PVA  483



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKAKGVSLLLPTDVVVADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA+AIPDGWMGLDIGPDSVKTFN+ALETTKTVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  357  SKVVPAAAIPDGWMGLDIGPDSVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV ALDEAV
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKVLPGVDALDEAV  476



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  294  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  353

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  354  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  413

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE V
Sbjct  414  LAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGV  473



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  358  SKIVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE  
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEVE  477

Query  207  PVA  199
             VA
Sbjct  478  RVA  480



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLL KA +KGVSL+LP+DVV+ADKFAPDAN
Sbjct  309  GGGMIFTFYKAQGCSVGSSLVEEDKLELATSLLAKAVSKGVSLMLPSDVVVADKFAPDAN  368

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  369  SKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIAKK  428

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE+V
Sbjct  429  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDESV  488

Query  207  PVA  199
            PVA
Sbjct  489  PVA  491



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  222  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVIIADKFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPASAIPDGWMGLDIGPDS+KTF++ LET KTVIWNGPMGVFEFDKFAVGTE+ AKK
Sbjct  282  SQVVPASAIPDGWMGLDIGPDSIKTFSEVLETAKTVIWNGPMGVFEFDKFAVGTEATAKK  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGVIALDEA 
Sbjct  342  LADLSRKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQLPGVIALDEAT  401

Query  207  PV  202
            PV
Sbjct  402  PV  403



>gb|AAA79705.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=231

 Score =   322 bits (825),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDAN
Sbjct  48   GGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDAN  107

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+V  K
Sbjct  108  SKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVRNK  167

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA 
Sbjct  168  LAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAT  227

Query  207  PV  202
            PV
Sbjct  228  PV  229



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG  VGSSLVE+DKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDA 
Sbjct  296  GGGMIFTFYKAQGFPVGSSLVEDDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAQ  355

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLD+GPDSVKTFNDAL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  356  SKVVPASEIPDGWMGLDVGPDSVKTFNDALDTTKTIIWNGPMGVFEFDKFATGTEAIAKK  415

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  416  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAV  475

Query  207  PVA  199
             VA
Sbjct  476  VVA  478



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAK KGVSLLLP+DVVIADKFAPDAN
Sbjct  294  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKEKGVSLLLPSDVVIADKFAPDAN  353

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDSVK+FN+AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  354  SKVVPASAIPDGWMGLDIGPDSVKSFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKK  413

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LS KGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEA 
Sbjct  414  LADLSEKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVVALDEAT  473

Query  207  PV  202
            PV
Sbjct  474  PV  475



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSLLLPTDVVIADKFAPDAN
Sbjct  300  GGGMIFTFYKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAPDAN  359

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPD+V +FN AL+T +TVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  360  SQIVPASAIPDGWMGLDIGPDAVTSFNAALDTCQTVIWNGPMGVFEFDKFAVGTEAVAKK  419

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA+
Sbjct  420  LAELSAKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAI  479

Query  207  PVA  199
            PVA
Sbjct  480  PVA  482



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  222  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  282  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE V
Sbjct  342  LAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGV  401



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGV+LLLP+DVVIADKFAPDAN
Sbjct  222  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVALLLPSDVVIADKFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDSV +F+  LETTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  282  SKVVPASAIPDGWMGLDIGPDSVASFSSTLETTKTVIWNGPMGVFEFDKFAVGTEAIAKK  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV
Sbjct  342  LADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAV  401

Query  207  PVA  199
             VA
Sbjct  402  TVA  404



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   330 bits (845),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDSV +FN AL+TT+TVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  358  SQIVPASAIPDGWMGLDIGPDSVASFNAALDTTQTVIWNGPMGVFEFDKFAVGTEAVAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAV  477



>ref|NP_001055937.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|AAU44053.1| putative phosphoglycerate kinase [Oryza sativa Japonica Group]
 dbj|BAF17851.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|EEE64225.1| hypothetical protein OsJ_19058 [Oryza sativa Japonica Group]
Length=181

 Score =   319 bits (817),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  738  MIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV  559
            MIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DV+IADKFAPDANS+V
Sbjct  1    MIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVSLLLPSDVIIADKFAPDANSQV  60

Query  558  VPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAE  379
            VPASAIPDGWMGLDIGPDSV +F+  LETT+TVIWNGPMGVFEFDKFAVGTE++AKKLA+
Sbjct  61   VPASAIPDGWMGLDIGPDSVASFSSTLETTQTVIWNGPMGVFEFDKFAVGTEAIAKKLAD  120

Query  378  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  199
            LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV VA
Sbjct  121  LSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAVTVA  180



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVE+DKL LA+SLL KAKAKGVSLLLPTDV+IADKFA DA 
Sbjct  297  GGGMIFTFYKAQGFSVGSSLVEDDKLELASSLLAKAKAKGVSLLLPTDVIIADKFAADAE  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDSVKTF+DAL+TTKT+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  357  SKVVPASEIPDGWMGLDIGPDSVKTFSDALDTTKTIIWNGPMGVFEFDKFAVGTESIAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAV  476

Query  207  PVA  199
             VA
Sbjct  477  AVA  479



>dbj|BAH57185.1| AT1G79550 [Arabidopsis thaliana]
Length=226

 Score =   319 bits (818),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  48   GGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  107

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  108  SKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  167

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  168  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  226



>gb|EPS66037.1| phosphoglycerate kinase, chloroplastic [Genlisea aurea]
Length=487

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVE DKL LATSLLEKAKAKGV LLLPTDVVIADKFAPDA 
Sbjct  304  GGGMIFTFYKAQGLSVGSSLVEADKLDLATSLLEKAKAKGVELLLPTDVVIADKFAPDAT  363

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTFN AL+ TKTVIWNGPMGVFEFDKFA+GTE+VAKK
Sbjct  364  SKIVPASAIPDGWMGLDIGPDSIKTFNAALDKTKTVIWNGPMGVFEFDKFALGTEAVAKK  423

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGK+LPGV+ALDEA 
Sbjct  424  LAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKDLPGVLALDEAT  483

Query  207  PVA  199
             VA
Sbjct  484  LVA  486



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDAN
Sbjct  222  GGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+VA K
Sbjct  282  SKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANK  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA 
Sbjct  342  LAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAT  401

Query  207  PV  202
            PV
Sbjct  402  PV  403



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFA+GTE++AKK
Sbjct  358  SKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFAIGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDE  
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKALPGVLALDEVE  477

Query  207  PVA  199
             VA
Sbjct  478  RVA  480



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   327 bits (837),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDAN
Sbjct  295  GGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDAN  354

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+VA K
Sbjct  355  SKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANK  414

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA 
Sbjct  415  LAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAT  474

Query  207  PV  202
            PV
Sbjct  475  PV  476



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   326 bits (836),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKA+GVSLLLPTDVVIADKFAPDAN
Sbjct  295  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKARGVSLLLPTDVVIADKFAPDAN  354

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+VA K
Sbjct  355  SKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAQGTEAVANK  414

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ LDEA 
Sbjct  415  LAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVVLDEAT  474

Query  207  PV  202
            PV
Sbjct  475  PV  476



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDAN
Sbjct  225  GGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDAN  284

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  285  SQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKK  344

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA 
Sbjct  345  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAA  404

Query  207  PV  202
             V
Sbjct  405  TV  406



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  357  SQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA 
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAA  476

Query  207  PV  202
             V
Sbjct  477  TV  478



>ref|XP_006858226.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVE+DK+ LATSLLEKAKAKGVSLLLPTDVVIADKFAPDA 
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEDDKIDLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAE  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPD WMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  358  SKIVPASGIPDRWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFDKFAVGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+LS KGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+ALDE V
Sbjct  418  LADLSAKGVTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKALPGVLALDEVV  477

Query  207  PVAA  196
            PVAA
Sbjct  478  PVAA  481



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  283  SKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  357  SQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA 
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAA  476

Query  207  PV  202
             V
Sbjct  477  TV  478



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  283  SKIVPASAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   324 bits (831),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDAN
Sbjct  296  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVSLLLPSDVVIADKFAPDAN  355

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V ASAIPDGWMGLDIGPDSV TFN ALETT+T+IWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  356  SQTVAASAIPDGWMGLDIGPDSVATFNAALETTQTIIWNGPMGVFEFDKFAVGTEAVAKK  415

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGV+ALDEAV
Sbjct  416  LAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKQLPGVVALDEAV  475

Query  207  PV  202
             V
Sbjct  476  TV  477



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   324 bits (830),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  357  SQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA 
Sbjct  417  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAA  476

Query  207  PV  202
             V
Sbjct  477  TV  478



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score =   321 bits (823),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  283  SKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLEL+EGK LPGV+ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELIEGKPLPGVLALDEA  401



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEF+KFA GTE++AKK
Sbjct  358  SKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE  
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEVE  477

Query  207  PVA  199
             VA
Sbjct  478  RVA  480



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LLEKAKAKGVSLLLP DVVIADKFA DAN
Sbjct  299  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLEKAKAKGVSLLLPPDVVIADKFAADAN  358

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPDS+K F+DAL+TT+TVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  359  SKIVPASEIPDGWMGLDIGPDSIKMFSDALDTTQTVIWNGPMGVFEFDKFAVGTEAIAKK  418

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            L E+S KGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPGV+ALDEAV
Sbjct  419  LEEISKKGVTTIIGGGDSVAAVEKVGVAESMSHISTGGGASLELLEGKELPGVLALDEAV  478

Query  207  PV  202
            PV
Sbjct  479  PV  480



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDAN
Sbjct  294  GGGMIFTFYKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLMLPTDVVIADKFAPDAN  353

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDS+  FN ALETT+TVIWNGPMGVFE+DKFA+GTE+VAKK
Sbjct  354  SQIVPASAIPDGWMGLDIGPDSIAAFNAALETTQTVIWNGPMGVFEYDKFAIGTEAVAKK  413

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV ALDEA 
Sbjct  414  LAELSRKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVTALDEAA  473

Query  207  PV  202
             V
Sbjct  474  TV  475



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKF PDAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFCPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  283  SKIVPASAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 174/184 (95%), Gaps = 2/184 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  295  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAN  354

Query  567  SKVVPA--SAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVA  394
            SKV+ A    +PDGWMGLDIGPDSVKTFNDAL++T+T+IWNGPMGVFEFDKFAVGTE+VA
Sbjct  355  SKVLNAVNCRLPDGWMGLDIGPDSVKTFNDALDSTQTIIWNGPMGVFEFDKFAVGTEAVA  414

Query  393  KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDE  214
            KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGVIALDE
Sbjct  415  KKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQLPGVIALDE  474

Query  213  AVPV  202
            A PV
Sbjct  475  AAPV  478



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VGSSLVEEDKL LAT+LLEKAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLAVGSSLVEEDKLDLATTLLEKAKAKGVSLLLPSDVVIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEF+KFA GTE++AKK
Sbjct  358  SKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE  
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEVE  477

Query  207  PVA  199
             VA
Sbjct  478  RVA  480



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  358  SKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA+
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAI  477

Query  207  PV  202
            PV
Sbjct  478  PV  479



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   322 bits (825),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  358  SKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  477

Query  207  PV  202
            PV
Sbjct  478  PV  479



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPAS+IPDGWMGLDIGPDS+KTFN++L+TTKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  283  SQVVPASSIPDGWMGLDIGPDSIKTFNESLDTTKTIIWNGPMGVFEFDKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALNDA  401



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  283  SKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   321 bits (823),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  358  SKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA+
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAI  477

Query  207  PV  202
            PV
Sbjct  478  PV  479



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  283  SKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGYSVGSSLLEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  283  SKIVPASAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDAN
Sbjct  444  GGGMIFTFYKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLMLPTDVVIADKFAPDAN  503

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S++VPASAIPDGWMGLDIGPDS+  FN ALETT+TVIWNGPMGVFE+DKFA+GTE+VAKK
Sbjct  504  SQIVPASAIPDGWMGLDIGPDSIAAFNAALETTQTVIWNGPMGVFEYDKFAIGTEAVAKK  563

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV ALDEA 
Sbjct  564  LAELSRKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVTALDEAA  623

Query  207  PV  202
             V
Sbjct  624  TV  625



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL +AKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAEAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  358  SKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA+
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAI  477

Query  207  PV  202
            PV
Sbjct  478  PV  479



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  216  GGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDAN  275

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A K
Sbjct  276  SKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANK  335

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  336  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  395

Query  207  PV  202
            PV
Sbjct  396  PV  397



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LAT+LLEKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLSLATTLLEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPAS+IPDGWMGLDIGPDS+KTF +AL+TT+T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKTVPASSIPDGWMGLDIGPDSIKTFGEALDTTQTIIWNGPMGVFEFDKFATGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  358  SKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV ALDEA+
Sbjct  418  LAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVTALDEAI  477

Query  207  PV  202
            PV
Sbjct  478  PV  479



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   317 bits (811),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVS+LLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSILLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKVVPASAIPDGWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  401



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score =   317 bits (812),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDK+ LA SL+  AK KGVSLLLPTDVV+ADKFA DAN
Sbjct  228  GGGMIFTFYKAQGLSVGSSLVEEDKIDLAKSLMRTAKDKGVSLLLPTDVVVADKFAADAN  287

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VP++AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  288  SKIVPSTAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKK  347

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV ALDEAV
Sbjct  348  LAELSGKGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVAALDEAV  407



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score =   317 bits (811),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+V A+AIPDGWMGLDIGPDS+KTF+DAL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  283  SKIVAATAIPDGWMGLDIGPDSIKTFSDALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|KEH15368.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=226

 Score =   310 bits (794),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG S+GSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  48   GGGMIFTFYKAQGYSIGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADAN  107

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  108  DKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKK  167

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  168  LAEVSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  226



>emb|CDX67989.1| BnaA07g20290D [Brassica napus]
Length=348

 Score =   315 bits (806),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  170  GGGMIYTFYKAQGHSVGSSLLEEDKLDLARSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  229

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  230  SKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQ  289

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  290  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  348



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   319 bits (817),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A K
Sbjct  358  SKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  418  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  477

Query  207  PV  202
            PV
Sbjct  478  PV  479



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   319 bits (817),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  301  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  360

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  361  SKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  420

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  421  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  480

Query  207  PV  202
             V
Sbjct  481  TV  482



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  358  SKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  418  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  477

Query  207  PV  202
             V
Sbjct  478  TV  479



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VGSSLVEEDKL LAT+LLEKAK+KGVSLLLP+DVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGLAVGSSLVEEDKLDLATTLLEKAKSKGVSLLLPSDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+K+F++AL+TTKTVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  283  SKIVPASSIPDGWMGLDIGPDSIKSFSEALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVPALDEA  401



>emb|CDY49746.1| BnaA02g19260D [Brassica napus]
Length=388

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  210  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  269

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  270  SKIVPATAIPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAVAKQ  329

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  330  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  388



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LAT+LLEKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLSLATTLLEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPAS+IPDGWMGLDIGPDS+KTF +AL+ T+TVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKTVPASSIPDGWMGLDIGPDSIKTFGEALDKTQTVIWNGPMGVFEFDKFATGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  299  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  358

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  359  SKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  418

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  419  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  478

Query  207  PV  202
             V
Sbjct  479  TV  480



>emb|CDX88547.1| BnaC06g39910D [Brassica napus]
Length=352

 Score =   314 bits (804),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  174  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  233

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+V A+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  234  SKIVAATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  293

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  294  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  352



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKLGLATSL+EKAK KGVSLLLP+DVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHAVGSSLVEEDKLGLATSLMEKAKTKGVSLLLPSDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+K+F +ALETTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPASQIPDGWMGLDIGPDSIKSFGEALETTKTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+V A+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+
Sbjct  283  SKIVAATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVE DKL LATSLL KAK KGVSL+LPTDVV+ADKFAPDA 
Sbjct  307  GGGMIFTFYKAQGFSVGSSLVEADKLELATSLLSKAKEKGVSLMLPTDVVVADKFAPDAR  366

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPASAIPDGWMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEF KFAVGTE++AKK
Sbjct  367  SQVVPASAIPDGWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFKKFAVGTEAIAKK  426

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALDEA
Sbjct  427  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELPGVVALDEA  485



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVE DKL LATSLL KAK KGVSL+LPTDVV+ADKFAPDA 
Sbjct  306  GGGMIFTFYKAQGFSVGSSLVEADKLELATSLLSKAKEKGVSLMLPTDVVVADKFAPDAR  365

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPASAIPDGWMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEF KFAVGTE++AKK
Sbjct  366  SQVVPASAIPDGWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFKKFAVGTEAIAKK  425

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALDEA
Sbjct  426  LAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELPGVVALDEA  484



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  283  SKIVPATAIPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDK  LAT+LLEKAKAKGVS+LLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKYDLATTLLEKAKAKGVSILLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTF++ L+TT+T+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKIVPASSIPDGWMGLDIGPDSIKTFSETLDTTQTIIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAEISGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS IPDGWMGLDIGPDS+ TF++AL+TTKT+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKVVSASEIPDGWMGLDIGPDSINTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010669985.1| PREDICTED: phosphoglycerate kinase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG+SVGSSLVEEDKL LATSL+EKAKAKGVSL+LPTDVVIADKFA DA 
Sbjct  223  GGGMIFTFYKAQGISVGSSLVEEDKLELATSLIEKAKAKGVSLMLPTDVVIADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPASAIPDGWMGLDIGPDS+KTFN+AL+ T+T+IWNGPMGVFEFDKFA GTE+VA+K
Sbjct  283  SKTVPASAIPDGWMGLDIGPDSIKTFNEALDKTQTIIWNGPMGVFEFDKFAAGTEAVARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAK+KGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA+AIPDGWMGLD+GPD++K+F++AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTF+KAQGLSVGSSLVEEDK+ LA SL++ AK KGVSLLLPTDVV+ADKFA DAN
Sbjct  288  GGGMIFTFFKAQGLSVGSSLVEEDKIDLAKSLMKTAKDKGVSLLLPTDVVVADKFAADAN  347

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VP++AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  348  SKIVPSTAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKK  407

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV ALDEAV
Sbjct  408  LAELSGKGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVAALDEAV  467



>gb|KCW71393.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=345

 Score =   311 bits (797),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+
Sbjct  167  GGGMMFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADAD  226

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GTE+VAKK
Sbjct  227  SKIVPASAIPDGWMGLDIGPDSIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAVAKK  286

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  287  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  345



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPD++K+F  AL+TTKTVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPD++K+F  AL+TTKTVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKLGLATSLLEKAK+KGVSLLLPTDVVIADKFA DA+
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLGLATSLLEKAKSKGVSLLLPTDVVIADKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPDS+KTF+ ALE+TKT+IWNGPMGVFEF+KFAVGTE++AKK
Sbjct  283  SKIVPASGIPDGWMGLDIGPDSIKTFSGALESTKTIIWNGPMGVFEFEKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSG GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSGTGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A K
Sbjct  357  SKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  417  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  476

Query  207  PV  202
             V
Sbjct  477  AV  478



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKV+PAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFAVGTE++A+K
Sbjct  283  SKVLPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAVGTEAIARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+
Sbjct  223  GGGMMFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GTE+VAKK
Sbjct  283  SKIVPASAIPDGWMGLDIGPDSIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAVAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SLLEKAK+KGVS+LLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLLEKAKSKGVSILLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKVVPASAIPDGWMGLDIGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKA+AKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAEAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  283  SKIVPATAIPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAVAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVA+VEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVASVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL L TSL+EKAK+KGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLGTSLMEKAKSKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA+AIPDGWMGLD+GPD++K+F++AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A K
Sbjct  358  SKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  418  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  477

Query  207  PV  202
             V
Sbjct  478  AV  479



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score =   311 bits (798),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LAT+LLEKAK+KGVSLLLPTD+V+ADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLSLATALLEKAKSKGVSLLLPTDIVVADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDS+KTF ++L+TTKTVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPASAIPDGWMGLDIGPDSIKTFGESLDTTKTVIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  343  LAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALNDA  401



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VGSSLVE+DK+ LA +L++KAK KGVSLLLPTDVVIADKFA DAN
Sbjct  324  GGGMIFTFYKAQGLKVGSSLVEDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADAN  383

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKFA GTES+AKK
Sbjct  384  SKVVPASDIPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESIAKK  443

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGV TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+ALDEAV
Sbjct  444  LAELSGKGVITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLALDEAV  503

Query  207  PV  202
            PV
Sbjct  504  PV  505



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   314 bits (805),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  301  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  360

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA K
Sbjct  361  SKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANK  420

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  421  LAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  480

Query  207  PV  202
             V
Sbjct  481  TV  482



>gb|KDP25066.1| hypothetical protein JCGZ_22601 [Jatropha curcas]
Length=401

 Score =   311 bits (798),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA +L+EKAKAKGV LLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLANTLMEKAKAKGVFLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS+IPDGW+GLD+GPDS++TF +AL+TTKTVIWNGPMGVFEF+KFAVGTE++AKK
Sbjct  283  SKVVPASSIPDGWLGLDVGPDSIQTFCEALDTTKTVIWNGPMGVFEFEKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>gb|KJB14020.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=349

 Score =   310 bits (793),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVV+ADKFA DAN
Sbjct  171  GGGMMFTFYKAQGYAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVVADKFAADAN  230

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA GTE+VAKK
Sbjct  231  SKVVPASGIPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKK  290

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+AL++A
Sbjct  291  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALNDA  349



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VGSSLVE+DK+ LA +L++KAK KGVSLLLPTDVVIADKFA DAN
Sbjct  324  GGGMIFTFYKAQGLKVGSSLVEDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADAN  383

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKFA GTES+AKK
Sbjct  384  SKVVPASDIPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESIAKK  443

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGV TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+ALDEAV
Sbjct  444  LAELSGKGVITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLALDEAV  503

Query  207  PV  202
            PV
Sbjct  504  PV  505



>gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
Length=401

 Score =   311 bits (797),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQG SVG+SLVEEDKLGLATSL+EKAKAKGVSLLLPTDVVIADKF+ DAN
Sbjct  223  GGGMVFTFYKAQGYSVGTSLVEEDKLGLATSLIEKAKAKGVSLLLPTDVVIADKFSADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++TVIWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  DKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTVIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAE+SGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAEISGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>emb|CDX79326.1| BnaC06g19770D [Brassica napus]
Length=353

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG +VGSSL+EEDKL LA SL+EKA+ KGVSLLLPTDVVIADKFAPDAN
Sbjct  175  GGGMIYTFYKAQGHAVGSSLLEEDKLDLARSLMEKAQDKGVSLLLPTDVVIADKFAPDAN  234

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+
Sbjct  235  SKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQ  294

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  295  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  353



>gb|AAX57302.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57303.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57304.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57305.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57306.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57307.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57308.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57309.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57310.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57311.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57312.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57313.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57314.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57315.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57316.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57317.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57318.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57319.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57320.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57321.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57322.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57324.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57325.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57326.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57327.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57328.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57329.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85283.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85284.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85285.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85286.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85287.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85288.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85289.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85290.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85291.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85292.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|ABS19549.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19552.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19557.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ABS19535.1| CT114 [Solanum chilense]
Length=224

 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66344.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG S+GSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKF+ DAN
Sbjct  223  GGGMIYTFYKAQGYSIGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFSADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  DKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAEVSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66343.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LAT+L+EKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYAVGSSLVEEDKLDLATTLIEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  DKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAEVSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|ABS19537.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++A+K
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIARK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|AAX57323.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85276.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85278.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85282.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|ABS19539.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19540.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19541.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19542.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19543.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19545.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19546.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19548.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19550.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19551.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19553.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19554.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19555.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19558.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19559.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVV+ADKFA DAN
Sbjct  223  GGGMMFTFYKAQGYAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVVADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA GTE+VAKK
Sbjct  283  SKVVPASGIPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+AL++A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALNDA  401



>gb|ABS19544.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSG+GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGRGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SLLEKAKAKGVS+LLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLDLAKSLLEKAKAKGVSILLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDS+KTF++AL TT+T+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKVVPASAIPDGWMGLDIGPDSIKTFSEALVTTQTIIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSDKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKF+PDAN
Sbjct  251  GGGMIFTFYKAQGLAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFSPDAN  310

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  311  SKIVPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAKK  370

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL  KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  371  LAELGDKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALNDA  429



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVE DKL LATSL+EKAKAKGVSLLLP+DVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHAVGSSLVEADKLDLATSLIEKAKAKGVSLLLPSDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+K+F +ALETTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPASQIPDGWMGLDIGPDSIKSFGEALETTKTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALNDA  401



>emb|CBI24183.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG  VGSSLVEEDKL LATSLLEKAK+KGVSLLLP DVVIADKFA DAN
Sbjct  171  GGGMIFTFYKAQGYGVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADAN  230

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF ++L+TTKT+IWNGPMGVFEFDKFA+GTE++AKK
Sbjct  231  SKVVPASCIPDGWMGLDIGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAIAKK  290

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  291  LADLSEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVLALDDA  349



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A+K
Sbjct  283  SKVVPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SLLEKAKAKGVS+LLPTDVVIADKFA DAN
Sbjct  271  GGGMIFTFYKAQGYSVGSSLVEEDKLDLAKSLLEKAKAKGVSILLPTDVVIADKFAADAN  330

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLDIGPDS+KTF++AL TT+T+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  331  SKVVPASAIPDGWMGLDIGPDSIKTFSEALVTTQTIIWNGPMGVFEFEKFAAGTEAIAKK  390

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  391  LAELSDKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLPGVLALDDA  449



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score =   309 bits (792),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVE DKL LA+SL+EKAKAKGV LLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEGDKLDLASSLIEKAKAKGVDLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS+IPDGWMGLD+GPD++KTF +AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  283  SKVVPASSIPDGWMGLDVGPDAIKTFCEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  297  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  356

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A K
Sbjct  357  SKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANK  416

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+
Sbjct  417  LAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAI  476

Query  207  PV  202
             V
Sbjct  477  AV  478



>gb|ABS19536.1| CT114 [Solanum chilense]
Length=224

 Score =   303 bits (775),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYK QG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKVQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|NP_001167912.1| phosphoglycerate kinase [Zea mays]
 gb|ACN26497.1| unknown [Zea mays]
 tpg|DAA57247.1| TPA: phosphoglycerate kinase [Zea mays]
Length=371

 Score =   308 bits (789),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG S+GSSLVE+DKL LATSLL KAK KGVSL+LP D+V+ADKFAPDA+
Sbjct  193  GGGMIFTFYKAQGHSIGSSLVEDDKLELATSLLRKAKEKGVSLMLPFDLVVADKFAPDAS  252

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPASAIPD WMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEFDKFAVGT+++AKK
Sbjct  253  SQVVPASAIPDAWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFDKFAVGTKAIAKK  312

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTI+GGGDS+AAVEKVGVA  +SHISTGGGASLELLEGKELPGV ALDEA
Sbjct  313  LAELSGKGVTTIVGGGDSIAAVEKVGVADSLSHISTGGGASLELLEGKELPGVAALDEA  371



>gb|ABS19556.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   303 bits (775),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATS +EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLELATSFMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA+
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVVADKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF + LE+TK +IWNGPMGVFEF+KFAVGTE++AKK
Sbjct  283  SKVVPASGIPDGWMGLDIGPDSIKTFCETLESTKAIIWNGPMGVFEFEKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTK +IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKNIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAKAKGVSLLLP DVVIADKF+ DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLIEKAKAKGVSLLLPADVVIADKFSADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F +AL+TTKT+IWNGPMGVFEF+ FA GTE++AKK
Sbjct  283  SKIVPASEIPDGWMGLDIGPDAIKSFGEALDTTKTIIWNGPMGVFEFENFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>gb|AAZ85273.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85274.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85275.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85277.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85279.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85280.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85281.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
Length=224

 Score =   302 bits (774),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPT+VVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTNVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ABS19538.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGG DSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGSDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|AFK46712.1| unknown [Medicago truncatula]
Length=401

 Score =   308 bits (790),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LAT+L+EKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYAVGSSLVEEDKLDLATTLIEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  DKIVPASSIPDGWMGLDIGPDSIKTFNEALDRSQTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAE+SGKGVTTIIGGGDSVAAVEKVG+   MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAEVSGKGVTTIIGGGDSVAAVEKVGLEDKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG  VGSSLVEEDKL LATSLLEKAK+KGVSLLLP DVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYGVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF ++L+TTKT+IWNGPMGVFEFDKFA+GTE++AKK
Sbjct  283  SKVVPASCIPDGWMGLDIGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG+SVGSSLVEEDKL LATSLL KAK KGVSLLLPTDVVIADKFA DA+
Sbjct  250  GGGMIFTFYKAQGMSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAADAD  309

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEF+KFA GTE++AKK
Sbjct  310  SKIVPASGIPDGWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAIAKK  369

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            L E+S KG TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK+LPGV+AL+EA 
Sbjct  370  LEEISKKGATTIIGGGDSVAAVEKVGVAEAMSHISTGGGASLELLEGKQLPGVLALNEAD  429

Query  207  PV  202
            PV
Sbjct  430  PV  431



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQG SVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+ADKFA DA+
Sbjct  223  GGGMMFTFYKAQGYSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVVADKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF++ LE+TKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  283  SKVVPASGIPDGWMGLDIGPDSIKTFSETLESTKTIIWNGPMGVFEFDKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   308 bits (790),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQG SVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+ADKFA DA+
Sbjct  231  GGGMMFTFYKAQGYSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVVADKFAADAD  290

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF++ LE+TKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  291  SKVVPASGIPDGWMGLDIGPDSIKTFSETLESTKTIIWNGPMGVFEFDKFAVGTEAIAKK  350

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  LADLSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  409



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DV++ADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A+K
Sbjct  283  SKVVPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS IPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEF+KFA GTE++A+K
Sbjct  283  SKVVAASEIPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVV+ADKFA DAN
Sbjct  223  GGGMIYTFYKAQGHAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVVADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA GTE+VAKK
Sbjct  283  SKVVPASGIPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+AL++A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALNDA  401



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK V AS+IPDGWMGLDIGPDS+KTF++AL+ T+TVIWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKTVSASSIPDGWMGLDIGPDSIKTFSEALDATQTVIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALNDA  401



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLP+DVVIA+KFA DA+
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLELAKSLMEKAKAKGVSLLLPSDVVIANKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS IPDGWMGLDIGPDS+KTF +AL+TT+T+IWNGPMGVFEFDKFAVGTE++A+K
Sbjct  283  SKVVSASDIPDGWMGLDIGPDSIKTFGEALDTTQTIIWNGPMGVFEFDKFAVGTETIARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLPTDVV+ADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPTDVVVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A K
Sbjct  283  SKVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   307 bits (786),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDV+IADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVLIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S VVPAS IPDGWMGLDIGPDS+KTF+++L+TTKT+IWNGPMGVFEF+KFA+GTE++AKK
Sbjct  283  SMVVPASGIPDGWMGLDIGPDSIKTFSESLDTTKTIIWNGPMGVFEFEKFALGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS  GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSASGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_006858233.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score =   307 bits (786),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFY+AQG SVGSSLVEEDKL LATSLLEKAKAKGV+LLLPTDVV+ADKFAPDA 
Sbjct  223  GGGMIFTFYEAQGFSVGSSLVEEDKLDLATSLLEKAKAKGVALLLPTDVVVADKFAPDAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IP+GWMGLDIGPDS+KTFNDALE  KT+IWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SKVVPASEIPEGWMGLDIGPDSIKTFNDALEPAKTIIWNGPMGVFEFEKFAAGTKAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAVE+ G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSEKGVTTIIGGGDSVAAVEQAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|ABS19547.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   300 bits (769),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DAN
Sbjct  50   GGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADAN  109

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDG MGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  110  SKIVPASEIPDGRMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  169

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  223
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  170  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   306 bits (785),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEED+L LA SL+EKAKAKGV LLLPTDVV ADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDRLDLALSLIEKAKAKGVPLLLPTDVVAADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPD++K+F++AL+ TKT+IWNGPMGVFE+DKFA GTE++AKK
Sbjct  283  SKVVPASGIPDGWMGLDIGPDAIKSFSEALDATKTIIWNGPMGVFEYDKFATGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSG GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGNGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VGSSLVE+DK+ LA++L++KAK KGVSLLLPTDVVIADKFA DAN
Sbjct  324  GGGMIFTFYKAQGLKVGSSLVEDDKIELASTLMKKAKEKGVSLLLPTDVVIADKFAADAN  383

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKF++GT S+AKK
Sbjct  384  SKVVPASDIPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFSLGTTSIAKK  443

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+AV
Sbjct  444  LAELSGKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLALDDAV  503

Query  207  PV  202
            PV
Sbjct  504  PV  505



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   306 bits (784),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPDS+K+F+  LE+TKT+IWNGPMGVFE++KFAVGTE++AKK
Sbjct  283  SKIVPASGIPDGWMGLDIGPDSIKSFSGTLESTKTIIWNGPMGVFEYEKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSG GVTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSGSGVTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score =   306 bits (784),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DV++ADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+ TF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A+K
Sbjct  283  SKVVPASEIPDGWMGLDIGPDSITTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|EEC71648.1| hypothetical protein OsI_04088 [Oryza sativa Indica Group]
Length=449

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG  VG+SLVE+DKL LATSLL KAK KGVSL+LPTDV++ADKFAP+AN
Sbjct  271  GGGMIFTFYKAQGFPVGASLVEDDKLELATSLLAKAKEKGVSLMLPTDVIVADKFAPEAN  330

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             +VV A AIPDGWMGLDIGPDSV  F+ ALETT+TVIWNGPMGVFEF+KFAVGTE++AKK
Sbjct  331  CQVVSAYAIPDGWMGLDIGPDSVAAFSSALETTQTVIWNGPMGVFEFEKFAVGTEAIAKK  390

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGG DSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEA
Sbjct  391  LAELSGKGVTTIIGGKDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVVALDEA  449



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAK KGV  LLP+DVVIADKFAPDAN
Sbjct  294  GGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKEKGVFFLLPSDVVIADKFAPDAN  353

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA AIPDGWMGLDIGPD VK+FN+AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  354  SKVVPAFAIPDGWMGLDIGPDFVKSFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKK  413

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LA+ S KGV  IIGGGD VAAVEKVGVA+VMSHI TGGGASLELLEGKELPGV+A DEA 
Sbjct  414  LADFSEKGVPPIIGGGDFVAAVEKVGVANVMSHIFTGGGASLELLEGKELPGVVAFDEAP  473

Query  207  PV  202
            PV
Sbjct  474  PV  475



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  299  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  358

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A K
Sbjct  359  SKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANK  418

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALDEA
Sbjct  419  LAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEA  477



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLV+EDKL LATSL+EKAK KGVSLLLPTDVVIADKFA +AN
Sbjct  224  GGGMIFTFYKAQGYAVGSSLVKEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAANAN  283

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLD GPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  284  SKIVPASEIPDGWMGLDFGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKK  343

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  344  LAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  402



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 ref|XP_004159164.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA+
Sbjct  223  GGGMIFTFYKAQGLAVGKSLVEEDKLDLATSLIEKAKAKGVSLLLPTDVVVADKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS+IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKVVAASSIPDGWMGLDIGPDSIKSFGEALDSTQTIIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA+
Sbjct  223  GGGMIFTFYKAQGLAVGKSLVEEDKLDLATSLIEKAKAKGVSLLLPTDVVVADKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS+IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVAASSIPDGWMGLDIGPDSIKSFGEALDSTQTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVSALDDA  401



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVE DKL LATSL++KAKAKGVSLLLP+DVVIADKFA DA+
Sbjct  223  GGGMIFTFYKAQGQSVGSSLVEADKLDLATSLIDKAKAKGVSLLLPSDVVIADKFAADAS  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEFDKFA GTE++A+K
Sbjct  283  SKVVPASEIPDGWMGLDIGPDSIKSFGEALDSTETIIWNGPMGVFEFDKFAAGTEAIARK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  401



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA G SVGSSLVE+DKL LATSL+EKAKAKGVSLLLP DVVIADKFA DAN
Sbjct  223  GGGMIFTFYKALGYSVGSSLVEDDKLDLATSLIEKAKAKGVSLLLPADVVIADKFAVDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA+ IPDGWMGLDIGPD++K+F +AL+TTKT+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKVVPATEIPDGWMGLDIGPDAIKSFGEALDTTKTIIWNGPMGVFEFEKFASGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  298  GGGMIFTFYKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDAN  357

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFAVGTE++AKK
Sbjct  358  SKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAIAKK  417

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  208
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALDE  
Sbjct  418  LAELSSKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGEELPGVLALDEVE  477

Query  207  PVA  199
             VA
Sbjct  478  RVA  480



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS IPDGWMGLDIGPDS+K+F+  LE+TKT+IWNGPMGVFE++KFAVGTE++AKK
Sbjct  283  SKIVPASGIPDGWMGLDIGPDSIKSFSGTLESTKTIIWNGPMGVFEYEKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSG GVTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  343  LADLSGSGVTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLPGVLALEDA  401



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score =   304 bits (778),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGM+FTFYKAQGLSVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+A+KFA DA+
Sbjct  223  GGGMMFTFYKAQGLSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVVANKFAADAD  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            +KVVPAS IPDGWMGLDIGPDS+K F++ L++TKT+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  283  TKVVPASGIPDGWMGLDIGPDSIKIFSETLDSTKTIIWNGPMGVFEFDKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSGKG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSGKGATTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG S+GSSLVE+DKL LA SLL+KAK KGVSL+LP DVVIADKFAPDA+
Sbjct  311  GGGMIFTFYKAQGHSIGSSLVEDDKLELAISLLKKAKEKGVSLMLPIDVVIADKFAPDAS  370

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+VVPASAIPD WMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEFDKF+VGT+++AKK
Sbjct  371  SQVVPASAIPDAWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFDKFSVGTKAIAKK  430

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEGKELPGV ALDEA
Sbjct  431  LAELSGKGVTTIIGGGDSVAAVEKAGVADSMSHISTGGGASLELLEGKELPGVAALDEA  489



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKA+ KGV LLLPTDVV+ADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLIEKARVKGVKLLLPTDVVVADKFASDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A K
Sbjct  283  SKVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum]
Length=401

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA +L+EKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLELANTLIEKAKAKGVSLLLPTDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             K+V AS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  DKIVSASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAE+S KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAEVSDKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG S+GSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGYSIGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A K
Sbjct  283  SKVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010544342.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Tarenaya 
hassleriana]
Length=401

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVE DKL LA+SL+EKAKAKGVSLLLPTDVV+ADKFA DAN
Sbjct  223  GGGMIFTFYKAQGLSVGSSLVEGDKLELASSLMEKAKAKGVSLLLPTDVVVADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS IP+GWMGLDIGPDSV TFN+AL+ T+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  283  SKVVSASEIPEGWMGLDIGPDSVTTFNEALDKTQTIIWNGPMGVFEFDKFAVGTEAMAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL  KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD A
Sbjct  343  LAELGEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDHA  401



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV ADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVAADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
              VVPAS IPDGWMGLDIGPDS+K F+++L+TTKT+IWNGPMGVFEF+KFAVGTE++AKK
Sbjct  283  CMVVPASGIPDGWMGLDIGPDSIKAFSESLDTTKTIIWNGPMGVFEFEKFAVGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LS  GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSAAGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVV ADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHSVGSSLVEEDKLDLALSLIEKAKAKGVSLLLPTDVVAADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGP S+K+F++AL+TTKT+IWNGPMGVFEFDKFA GT+++AKK
Sbjct  283  SKVVPASGIPDGWMGLDIGPVSIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTDTIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSG GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD A
Sbjct  343  LAELSGNGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDNA  401



>dbj|BAJ88371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA 
Sbjct  204  GGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAE  263

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GT+++AK+
Sbjct  264  SKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQ  323

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  324  LAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  382



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG  VGSSLVEEDKL LATSL+EKAKAKGVSLLLP+DVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYKVGSSLVEEDKLDLATSLIEKAKAKGVSLLLPSDVVIADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPA  IPDGWMGLDIGPDS+K+F++ L+TTKTVIWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKVVPAKEIPDGWMGLDIGPDSIKSFSETLDTTKTVIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVTTII GGDSVAAVEKVG+A  MSHISTGGGASL+LLEGK LPGV+AL+EA
Sbjct  343  LAELSGKGVTTII-GGDSVAAVEKVGLADKMSHISTGGGASLQLLEGKTLPGVLALNEA  400



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GT+++AK+
Sbjct  283  SKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVV+ADKFA DAN
Sbjct  254  GGGMIFTFYKAQGHAVGSSLVEEDKLSLANSLMEKAKAKGVSLLLPTDVVVADKFAADAN  313

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK V AS IP+GWMGLDIGPDS++TF++AL+ T+T+IWNGPMGVFEFDKFAVGTE++AKK
Sbjct  314  SKTVSASEIPEGWMGLDIGPDSIETFSEALDETQTIIWNGPMGVFEFDKFAVGTEAIAKK  373

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  374  LAELSDKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  432



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG +VGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGHAVGSSLLEEDKLDLARSLMEKAKAKGVSLLLPTDVVIADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+V A+AIPDGWMGLDIGPDS+KTF++AL+T KT+IWNGPMGVFEF+KFA GTE+V K+
Sbjct  283  SKIVLATAIPDGWMGLDIGPDSIKTFSEALDTAKTIIWNGPMGVFEFEKFAAGTEAVVKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELSGKGVT IIGGGDSVAAVEKVG+A  MSHISTGGGA LELLEGK  PGV+ALD+A
Sbjct  343  LAELSGKGVTKIIGGGDSVAAVEKVGLADKMSHISTGGGARLELLEGKPRPGVLALDDA  401



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDAN
Sbjct  619  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDAN  678

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A K
Sbjct  679  SKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANK  738

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA
Sbjct  739  LAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEA  797



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFAPDA 
Sbjct  223  GGGMIYTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAPDAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPD WMGLD+GPD+ KTFNDAL+ T+T+IWNGPMGVFEF+KFA GTE++AKK
Sbjct  283  SKIVPATAIPDDWMGLDVGPDATKTFNDALDKTQTIIWNGPMGVFEFEKFAAGTEAIAKK  342

Query  387  LAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score =   298 bits (764),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 170/179 (95%), Gaps = 1/179 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG  VGSSLVE D+L LAT+LLEKAK+KGVSLLLPTDVV+ADKFA DA+
Sbjct  223  GGGMIFTFYKAQGHPVGSSLVE-DQLDLATALLEKAKSKGVSLLLPTDVVVADKFAADAD  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS IPDGWMGLDIGPDS+KTF+++L++TKT+IWNGPMGVFEF+KFAVGTE++AKK
Sbjct  282  SKVVPASGIPDGWMGLDIGPDSIKTFSESLDSTKTIIWNGPMGVFEFEKFAVGTEAIAKK  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSGKGVTTIIGGGDSVAAVEK+G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  342  LADLSGKGVTTIIGGGDSVAAVEKMGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  400



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AKAKGV LLLP DVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKAKGVKLLLPIDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPASAIPDGWMGLD+GPD++KTF++AL+T KT+IWNGPMGVFEF+KFA GT+++AK+
Sbjct  283  SKVVPASAIPDGWMGLDVGPDAIKTFSEALDTCKTIIWNGPMGVFEFEKFAAGTDAIAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELTAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   296 bits (759),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG +VG SLVEEDKL LATSL+EKAK+KGVSLLLPTD+V+ADKFA DA 
Sbjct  223  GGGMIYTFYKAQGYAVGKSLVEEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPASAIPDGWMGLDIGPDS+KTF++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SKTVPASAIPDGWMGLDIGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+++ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  343  LADITAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALNDA  401



>ref|XP_002977295.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
 gb|EFJ21299.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
Length=402

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTF+KAQGLSVGSSLVEEDKL LAT L+EKAK KGV+LLLPTDVV+ADKFAPDA+
Sbjct  224  GGGMIFTFFKAQGLSVGSSLVEEDKLILATKLMEKAKLKGVTLLLPTDVVVADKFAPDAS  283

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+V ASAIPDGWMGLDIGPDS+K F++AL++T T+IWNGPMGVFEF  FAVGTE++A K
Sbjct  284  SKIVSASAIPDGWMGLDIGPDSIKAFSEALDSTNTIIWNGPMGVFEFKNFAVGTEAIAAK  343

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LPGV ALD+A
Sbjct  344  LAELSDKGVTTIIGGGDSVAAVEKAGVADQMSHISTGGGASLELLEGRILPGVAALDDA  402



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFA DA 
Sbjct  223  GGGMIYTFYKAQGYSVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPD WMGLD+GPD+ KTF++AL+TTKTVIWNGPMGVFEF KFA GTE++AKK
Sbjct  283  SKIVPATAIPDDWMGLDVGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAIAKK  342

Query  387  LAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  402



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTF+KAQGLSVGSSLVEEDKL LAT L+EKAK KGV+LLLPTDVV+ADKFAPDA+
Sbjct  224  GGGMIFTFFKAQGLSVGSSLVEEDKLILATKLMEKAKLKGVTLLLPTDVVVADKFAPDAS  283

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+V ASAIPDGWMGLDIGPDS+K F+ AL +T T+IWNGPMGVFEF  FAVGTE++A K
Sbjct  284  SKIVSASAIPDGWMGLDIGPDSIKAFSQALNSTNTIIWNGPMGVFEFKNFAVGTEAIAAK  343

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LPGV ALD+A
Sbjct  344  LAELSDKGVTTIIGGGDSVAAVEKAGVADRMSHISTGGGASLELLEGRILPGVAALDDA  402



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKAK+KGVSLLLPTDVV+ADKF  +A 
Sbjct  223  GGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKSKGVSLLLPTDVVVADKFDANAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPAS+IPDGWMGLDIGPDS+KTF+  L+TTKTVIWNGPMGVFEF+KFA GT+++A K
Sbjct  283  SKIVPASSIPDGWMGLDIGPDSIKTFSQTLDTTKTVIWNGPMGVFEFEKFAAGTDAIAMK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+ KGVTTIIGGGDSVAAVEK G+A+ MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELTAKGVTTIIGGGDSVAAVEKAGLANKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG SVG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFA DA 
Sbjct  393  GGGMIYTFYKAQGYSVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAE  452

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPD WMGLD+GPD+ KTF++AL+TTKTVIWNGPMGVFEF KFA GTE++AKK
Sbjct  453  SKIVPATAIPDDWMGLDVGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAIAKK  512

Query  387  LAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  513  LAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  572



>gb|EMT08517.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=401

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG +VG SLVEEDKL LA SL+EKAK+KGVSLLLPTD+V+AD FA DA 
Sbjct  223  GGGMIYTFYKAQGHAVGKSLVEEDKLELANSLIEKAKSKGVSLLLPTDIVVADNFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPASAIPDGWMGLDIGPDS+K F++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SKIVPASAIPDGWMGLDIGPDSIKKFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+++ KGVTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LPGV++LD A
Sbjct  343  LADITAKGVTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLPGVLSLDNA  401



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKA +KGVSLLLPTDVV+ADKF  DA 
Sbjct  223  GGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKANSKGVSLLLPTDVVVADKFTADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK V ASAIPDGWMGLDIGPDS+KTF++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SKTVLASAIPDGWMGLDIGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+++ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADITAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK V ASAIP+GWMGLD+GPD++KTF+ AL+T  T+IWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SKTVAASAIPEGWMGLDVGPDAIKTFSGALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKK  342

Query  387  LAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|WP_015184203.1| phosphoglycerate kinase [Microcoleus sp. PCC 7113]
 gb|AFZ20067.1| 3-phosphoglycerate kinase [Microcoleus sp. PCC 7113]
Length=401

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GLSVG SLVEEDKL LA SL  KAK +GV+LLLPTDVV+AD FAPDAN
Sbjct  223  GGGMIFTFYKARGLSVGKSLVEEDKLELAKSLEAKAKERGVALLLPTDVVVADNFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V   +IPDGWMGLDIGPDSVK F DAL   KTVIWNGPMGVFEFDKFAVGTE++A  
Sbjct  283  SQTVSIDSIPDGWMGLDIGPDSVKVFQDALSDCKTVIWNGPMGVFEFDKFAVGTEAIAHT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            +A+L+ +G TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  343  MADLTKQGATTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKELPGITALDDA  401



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 166/207 (80%), Gaps = 28/207 (14%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG S+GSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDAN
Sbjct  223  GGGMIYTFYKAQGYSIGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDAN  282

Query  567  SKV----------------------------VPASAIPDGWMGLDIGPDSVKTFNDALET  472
            SKV                            VPAS I DGWMGLDIGPDS+KTF++AL+T
Sbjct  283  SKVCIIVRLNYVHSLEYVHVNLLFSAIFLQVVPASEIADGWMGLDIGPDSIKTFSEALDT  342

Query  471  TKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMS  292
            TKT+IWNGPMGVFEF+KFA GTE++A KLAELSGKGVTTIIGGGDSVAAVEK G+A  MS
Sbjct  343  TKTIIWNGPMGVFEFEKFAAGTEAIAWKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMS  402

Query  291  HISTGGGASLELLEGKELPGVIALDEA  211
            HISTGGGASLELLEGK LPGV+ALD+A
Sbjct  403  HISTGGGASLELLEGKPLPGVLALDDA  429



>dbj|BAJ85222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMI+TFYKAQG +VG SLVE+DKL LA SL+EKAK+KGVSLLLPTD+V+A+ FA DA 
Sbjct  223  GGGMIYTFYKAQGHAVGKSLVEDDKLELANSLIEKAKSKGVSLLLPTDIVVANNFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK VPASAIPDGWMGLDIGPDS++ F++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SKTVPASAIPDGWMGLDIGPDSIRKFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKK  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+++ +GVTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADITAQGVTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|WP_035992253.1| phosphoglycerate kinase [Leptolyngbya sp. KIOST-1]
Length=401

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GL+VG SLVEEDKL LA +L  KAK KGV LLLPTDVV+AD FA DAN
Sbjct  223  GGGMIFTFYKARGLAVGKSLVEEDKLELAKALEAKAKEKGVDLLLPTDVVLADNFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V   AIPDGWMGLDIGPDSVK F DAL+  K+VIWNGPMGVFEFDKFAVGTE++A  
Sbjct  283  SQTVSVDAIPDGWMGLDIGPDSVKVFQDALKQCKSVIWNGPMGVFEFDKFAVGTEAIAHT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+G GVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  343  LAELTGTGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKELPGIAALDDA  401



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK+VPA+AIPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GT+++AK+
Sbjct  283  SKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQ  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  235
            LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  343  LAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393



>ref|WP_017300589.1| phosphoglycerate kinase [Nodosilinea nodulosa]
Length=401

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GL+VG SLVEEDKL LA SL  KAK KGV LLLPTDVV+AD FAPDAN
Sbjct  223  GGGMIFTFYKARGLNVGKSLVEEDKLELAKSLEAKAKEKGVDLLLPTDVVLADNFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            ++ V   AIPDGWMGLDIGPDS+K F DAL+  K+VIWNGPMGVFEFDKFA GTE++A  
Sbjct  283  AQTVSVEAIPDGWMGLDIGPDSIKVFQDALKQCKSVIWNGPMGVFEFDKFAAGTEAIAHT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+  GVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  343  LAELTDTGVTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKELPGIAALDDA  401



>gb|ABR25550.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=176

 Score =   278 bits (710),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  735  IFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVV  556
            IFTFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V
Sbjct  1    IFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTV  60

Query  555  PASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL  376
             ASAIPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEFDKFA GT+++AKKLA+L
Sbjct  61   AASAIPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFDKFAAGTDAIAKKLADL  120

Query  375  -SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
             + KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  121  TTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  176



>ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
Length=402

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK V ASAIPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SKTVAASAIPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKK  342

Query  387  LAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+L + KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LADLTTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V ASAIPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEF+KFA GT+++AKK
Sbjct  283  SRTVAASAIPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKK  342

Query  387  LAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+L + KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LADLTTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|WP_011377868.1| MULTISPECIES: phosphoglycerate kinase [Synechococcus]
 sp|Q31P73.1|PGK_SYNE7 RecName: Full=Phosphoglycerate kinase [Synechococcus elongatus 
PCC 7942]
 gb|ABB57146.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
 gb|AJD58338.1| phosphoglycerate kinase [Synechococcus sp. UTEX 2973]
Length=402

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVG SLVEEDKL LA SL+ KA+ KGV LLLP DVV+ADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGLSVGGSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            +K V   AIPDGWMGLDIGP+SVK F +AL   ++VIWNGPMGVFEFD+FAVGTE++A+ 
Sbjct  283  AKTVAIDAIPDGWMGLDIGPESVKQFEEALADCRSVIWNGPMGVFEFDQFAVGTEAIARS  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA L+ KG TTIIGGGDSVAAVEKVGVAS MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  343  LAGLTRKGATTIIGGGDSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAALDDA  401



>dbj|BAA21478.1| phosphoglycerate kinase [Robinia pseudoacacia]
Length=229

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFA DAN
Sbjct  71   GGGMIFTFYKAQGHSVGSSLVEEDKLDLANSLMEKAKAKGVSLLLPTDVVIADKFAADAN  130

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SKVVPAS+IPDGWMGLDIGPD++KTF++ L+ T+++IWNGPMGVFEFDKFA GTE++AKK
Sbjct  131  SKVVPASSIPDGWMGLDIGPDAIKTFSETLDKTQSIIWNGPMGVFEFDKFAAGTEAIAKK  190

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGG  271
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGG
Sbjct  191  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGG  229



>ref|WP_041032823.1| phosphoglycerate kinase [Tolypothrix campylonemoides]
 gb|KIJ78650.1| phosphoglycerate kinase [Tolypothrix campylonemoides VB511288]
Length=400

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTF+KA+GL+VG SLVEEDKL LA SL  KAK +GV LLLPTDVV+AD FAPDAN
Sbjct  222  GGGMIFTFFKARGLNVGKSLVEEDKLELAKSLEAKAKERGVDLLLPTDVVVADNFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V    IPDGWMGLDIGP+SVK F  AL  TKTVIWNGPMGVFEFDKFAVGTE++A+ 
Sbjct  282  SQTVSVENIPDGWMGLDIGPESVKFFQQALADTKTVIWNGPMGVFEFDKFAVGTEAIART  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA++S  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG++ALDEA
Sbjct  342  LADISKTGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIVALDEA  400



>ref|WP_011242745.1| phosphoglycerate kinase [Synechococcus elongatus]
 sp|Q5N4Z6.1|PGK_SYNP6 RecName: Full=Phosphoglycerate kinase [Synechococcus elongatus 
PCC 6301]
 dbj|BAD78623.1| phosphoglycerate kinase [Synechococcus elongatus PCC 6301]
Length=402

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVG SLVEEDKL LA SL+ KA+ KGV LLLP DVV+ADKFAPDAN
Sbjct  223  GGGMIFTFYKAQGLSVGGSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            +K V   AIPDGWMGLDIGP+SVK F  AL   ++VIWNGPMGVFEFD+FAVGTE++A+ 
Sbjct  283  AKTVAIDAIPDGWMGLDIGPESVKQFEGALADCRSVIWNGPMGVFEFDQFAVGTEAIARS  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA L+ KG TTIIGGGDSVAAVEKVGVAS MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  343  LAGLTRKGATTIIGGGDSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAALDDA  401



>ref|WP_039728851.1| MULTISPECIES: phosphoglycerate kinase [Oscillatoriophycideae]
 gb|KIF16377.1| phosphoglycerate kinase [Aphanocapsa montana BDHKU210001]
 gb|KIF41302.1| phosphoglycerate kinase [Lyngbya confervoides BDU141951]
Length=401

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GLSVG SLVEEDKL LA +L  KAK KGV LLLPTDVV+AD FAPDAN
Sbjct  223  GGGMIFTFYKARGLSVGKSLVEEDKLELAKALEAKAKEKGVELLLPTDVVVADNFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            ++ V   AIPDGWMGLDIGPD+VK F +AL+  K+VIWNGPMGVFEFDKFA GTE++A  
Sbjct  283  AQTVSIEAIPDGWMGLDIGPDAVKVFQEALKQCKSVIWNGPMGVFEFDKFAAGTEAIAHT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+  GVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  343  LAELTPSGVTTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKTLPGIAALDEA  401



>ref|WP_016865730.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GLSVG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+AD FA DAN
Sbjct  222  GGGMIFTFYKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAADAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V    IPDGWMGLDIGPDSVK F DAL   KTV+WNGPMGVFEFDKFAVGTE++A+ 
Sbjct  282  SQTVSIENIPDGWMGLDIGPDSVKLFQDALADCKTVVWNGPMGVFEFDKFAVGTEAIART  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LS KG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  342  LADLSKKGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA 
Sbjct  223  GGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAE  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            SK V ASAIPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEF+K A GT+++AKK
Sbjct  283  SKTVAASAIPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKLAAGTDAIAKK  342

Query  387  LAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+L + KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LADLTTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|WP_029637902.1| phosphoglycerate kinase [[Scytonema hofmanni] UTEX B 1581]
Length=400

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GL+VG SLVEEDK+ LA SL  KAK +GV LLLPTDVV+ADKFAPDAN
Sbjct  222  GGGMIFTFYKARGLNVGKSLVEEDKIELAKSLEAKAKERGVDLLLPTDVVVADKFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V    IPDGWMGLDIGPDS+K F +AL   KTVIWNGPMGVFEFDKFA GTE++A  
Sbjct  282  SQTVSIENIPDGWMGLDIGPDSIKVFQEALADCKTVIWNGPMGVFEFDKFAAGTEAIAHT  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA++S KG  TIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG++ALD+A
Sbjct  342  LADISKKGAITIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIVALDDA  400



>ref|WP_011936642.1| phosphoglycerate kinase [Synechococcus sp. RCC307]
 sp|A5GW73.1|PGK_SYNR3 RecName: Full=Phosphoglycerate kinase [Synechococcus sp. RCC307]
 emb|CAK29132.1| Phosphoglycerate kinase [Synechococcus sp. RCC307]
Length=402

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GLSVG SLVEEDKL LA  L  KAKAKGV LLLPTDVV+AD FAPDAN
Sbjct  223  GGGMIFTFYKARGLSVGKSLVEEDKLELAKELEAKAKAKGVQLLLPTDVVLADNFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+V    AIP+GWMGLDIGPDS+K F DAL   KTVIWNGPMGVFEFDKFA GT ++A  
Sbjct  283  SQVASIDAIPEGWMGLDIGPDSIKVFQDALGDCKTVIWNGPMGVFEFDKFAAGTNAIATT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAELS KG  TIIGGGDSVAAVEK G+A+ MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  343  LAELSAKGCCTIIGGGDSVAAVEKAGLAAQMSHISTGGGASLELLEGKVLPGVAALDEA  401



>ref|WP_015166011.1| phosphoglycerate kinase [Pseudanabaena sp. PCC 7367]
 gb|AFY71055.1| phosphoglycerate kinase [Pseudanabaena sp. PCC 7367]
Length=401

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GL+VG SLVEEDKL LA SL  KAK +GV LLLPTDVV+AD F+PDAN
Sbjct  223  GGGMIFTFYKARGLAVGKSLVEEDKLDLAKSLEAKAKERGVDLLLPTDVVVADNFSPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V   +IPDGWMGLDIGPDSVKTF  AL    TVIWNGPMGVFEFDKFAVGTE++A  
Sbjct  283  SQTVSIESIPDGWMGLDIGPDSVKTFQAALADCMTVIWNGPMGVFEFDKFAVGTEAIAHS  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LAEL+GKG  TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct  343  LAELTGKGAITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGIAALDDA  401



>ref|WP_026734580.1| phosphoglycerate kinase [Fischerella sp. PCC 9605]
Length=400

 Score =   280 bits (717),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GL+VG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+ADKFA DAN
Sbjct  222  GGGMIFTFYKARGLNVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADKFAADAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V    IPDGWMGLDIGPDSVK F +AL   KT+IWNGPMGVFEFDKFAVGTE++A+ 
Sbjct  282  SQTVSVENIPDGWMGLDIGPDSVKLFQEALSDCKTIIWNGPMGVFEFDKFAVGTEAIART  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LS  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  342  LADLSKNGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>ref|WP_016924803.1| phosphoglycerate kinase [Prochlorothrix hollandica]
Length=401

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GL+VGSSLVEEDKL LA +L  KAK KGV LLLPTDVV+ADKFA DAN
Sbjct  223  GGGMIFTFYKARGLAVGSSLVEEDKLELAQALEAKAKEKGVELLLPTDVVVADKFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            +K V   AIPDGWMGLDIGPDS+KTF +AL+T K+VIWNGPMGVFEF +FA GTE VAK 
Sbjct  283  AKTVAVDAIPDGWMGLDIGPDSLKTFQEALKTCKSVIWNGPMGVFEFPQFAAGTEGVAKT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA L+ +GVTTIIGGGDSVAAVE+VG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  343  LASLTPQGVTTIIGGGDSVAAVEQVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  401



>ref|WP_026097925.1| phosphoglycerate kinase [Geitlerinema sp. PCC 7105]
Length=401

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTF+KA+GLSVG SLVEEDKL LA +L  KAK +GV LLLPTDV++AD FAPDAN
Sbjct  223  GGGMIFTFFKARGLSVGKSLVEEDKLELAKALEAKAKERGVELLLPTDVIVADNFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
             + V   AIPDGWMGLDIGPDSVKTF DAL   K+VIWNGPMGVFEF+KFA GTE++A+ 
Sbjct  283  DRTVAVDAIPDGWMGLDIGPDSVKTFQDALADCKSVIWNGPMGVFEFEKFAKGTEAIART  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+L+G+G TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct  343  LADLTGQGTTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGIAALDDA  401



>ref|WP_035831895.1| phosphoglycerate kinase [Cyanobium sp. CACIAM 14]
 gb|KEF41737.1| phosphoglycerate kinase [Cyanobium sp. CACIAM 14]
Length=401

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTF+KA+GL+VG SLVEEDKL LA  L  KA AKGV LLLPTDVV+AD FAPDAN
Sbjct  223  GGGMIFTFFKARGLAVGKSLVEEDKLELARELEAKAAAKGVQLLLPTDVVLADNFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S   P  AIP+GWMGLDIGPDSVKTF DAL   +TVIWNGPMGVFEFD+FA GT ++A  
Sbjct  283  SMTTPIDAIPEGWMGLDIGPDSVKTFQDALADCQTVIWNGPMGVFEFDRFAAGTNAIAHT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LS KG  TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  343  LADLSAKGCCTIIGGGDSVAAVEKVGVADRMSHISTGGGASLELLEGKVLPGVAALDEA  401



>ref|WP_006105635.1| phosphoglycerate kinase [Coleofasciculus chthonoplastes]
 gb|EDX71471.1| phosphoglycerate kinase [Coleofasciculus chthonoplastes PCC 7420]
Length=401

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GLSVG SLVEEDKL LA SL  KAK KGV LLLPTDVV+AD FA DAN
Sbjct  223  GGGMIFTFYKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVDLLLPTDVVVADNFAADAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V   +IPDGWMGLDIGPDSVK F DAL   K+VIWNGPMGVFEFDKFA GTE++A+ 
Sbjct  283  SQTVSVESIPDGWMGLDIGPDSVKFFQDALGDCKSVIWNGPMGVFEFDKFAAGTEAIART  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+L+ KG TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct  343  LADLTKKGTTTIIGGGDSVAAVEKVGVADQMSHISTGGGASLELLEGKVLPGIAALDDA  401



>ref|WP_017309094.1| MULTISPECIES: phosphoglycerate kinase [Stigonematales]
 gb|KIY12309.1| phosphoglycerate kinase [Mastigocladus laminosus UU774]
Length=400

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GLSVG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+ADKFAPDAN
Sbjct  222  GGGMIFTFYKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADKFAPDAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V    IPDGWMGLDIGPDSVK F DAL   K+V+WNGPMGVFEFDKFAVGTE++A  
Sbjct  282  SQTVSIENIPDGWMGLDIGPDSVKLFQDALADCKSVVWNGPMGVFEFDKFAVGTEAIAHT  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA++   G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  342  LADIGKNGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>gb|AFH41108.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41121.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40271.1| 3-phosphoglycerate kinase, partial [Leymus pseudoracemosus]
 gb|AGL91047.1| 3-phosphoglycerate kinase, partial [Psathyrostachys huashanica]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAVAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40274.1| 3-phosphoglycerate kinase, partial [Hystrix duthiei]
 gb|ACO40275.1| 3-phosphoglycerate kinase, partial [Hystrix duthiei subsp. longearistata]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVIADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE+VAKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAVAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>ref|WP_009454679.1| MULTISPECIES: phosphoglycerate kinase [Fischerella]
 gb|EHC18638.1| Phosphoglycerate kinase [Fischerella sp. JSC-11]
Length=400

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GLSVG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+AD FA DAN
Sbjct  222  GGGMIFTFYKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAADAN  281

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ V    IPDGWMGLDIGPDSVK F +AL   KTV+WNGPMGVFEFDKFAVGTE++A+ 
Sbjct  282  SQTVSIENIPDGWMGLDIGPDSVKLFQEALADCKTVVWNGPMGVFEFDKFAVGTEAIART  341

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LS  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  342  LADLSKNGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>gb|AID16262.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>ref|WP_007099195.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
 gb|EAU75098.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
Length=401

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKA+GL+VG SLVEEDKL LA  L  KAKAKGV LLLPTDVV+AD FAPDAN
Sbjct  223  GGGMIFTFYKARGLAVGKSLVEEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDAN  282

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+  P +AIPDGWMGLDIGPDSVK F +AL   +TVIWNGPMGVFEFDKFA GT ++A  
Sbjct  283  SQTAPVTAIPDGWMGLDIGPDSVKVFQNALADCQTVIWNGPMGVFEFDKFAAGTNAIATT  342

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  211
            LA+LSGKG  TIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV ALD A
Sbjct  343  LADLSGKGCCTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAALDAA  401



>gb|AFH41102.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41091.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41092.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AID16252.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AAM51702.1|AF343476_1 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AAM51706.1|AF343480_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51716.1|AF343490_1 3-phosphoglycerate kinase, partial [Aegilops speltoides var. 
ligustica]
 gb|AFH41077.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41080.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41082.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii x Triticum turgidum subsp. polonicum]
 gb|AFH41085.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41090.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41093.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41096.1| plastid 3-phosphoglycerate kinase, partial [Triticum carthlicum]
 gb|AFH41098.1| plastid 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AFH41100.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41105.1| plastid 3-phosphoglycerate kinase, partial [Triticum macha]
 gb|AFH41111.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41113.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41116.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41119.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41126.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41129.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41132.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41134.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41136.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41138.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41143.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41146.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41151.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41154.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AID16251.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
 gb|AID16258.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16264.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16267.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16269.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AAM51700.1|AF343474_1 3-phosphoglycerate kinase, partial [Triticum urartu]
 gb|AAM51701.1|AF343475_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51703.1|AF343477_1 3-phosphoglycerate kinase, partial [Triticum timopheevii subsp. 
armeniacum]
 gb|AAM51704.1|AF343478_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51705.1|AF343479_1 3-phosphoglycerate kinase, partial [Aegilops tauschii subsp. 
tauschii]
 gb|AAM51707.1|AF343481_1 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AAM51711.1|AF343485_1 3-phosphoglycerate kinase, partial [Aegilops bicornis]
 gb|AAM51712.1|AF343486_1 3-phosphoglycerate kinase, partial [Aegilops sharonensis]
 gb|AAM51713.1|AF343487_1 3-phosphoglycerate kinase, partial [Aegilops longissima]
 gb|AAM51714.1|AF343488_1 3-phosphoglycerate kinase, partial [Triticum timopheevii subsp. 
armeniacum]
 gb|AAM51715.1|AF343489_1 3-phosphoglycerate kinase, partial [Aegilops searsii]
 gb|AAM51718.1|AF343492_1 3-phosphoglycerate kinase, partial [Aegilops speltoides subsp. 
speltoides]
 gb|ACO40252.1| 3-phosphoglycerate kinase, partial [Taeniatherum caput-medusae]
 gb|ACO40253.1| 3-phosphoglycerate kinase, partial [Triticum monococcum]
 gb|AFH41072.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii]
 gb|AFH41075.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41076.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41078.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41079.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41083.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii x Triticum turgidum subsp. polonicum]
 gb|AFH41086.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41087.1| plastid 3-phosphoglycerate kinase, partial [Triticum carthlicum]
 gb|AFH41089.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41094.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41097.1| plastid 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AFH41103.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41107.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41109.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41110.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41112.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41114.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41115.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41117.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41118.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41120.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41122.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41123.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41125.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41127.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41133.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41135.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41141.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41142.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41145.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41147.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41148.1| plastid 3-phosphoglycerate kinase, partial [Triticum timopheevii]
 gb|AFH41150.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41152.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41153.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AID16245.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16247.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16250.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16254.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16256.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16257.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16259.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16260.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16263.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16265.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16266.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16268.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16270.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
 gb|AID16271.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41101.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AID16248.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
Length=298

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  747  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  568
            GGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDAN
Sbjct  149  GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN  208

Query  567  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  388
            S+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKK
Sbjct  209  SQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKK  268

Query  387  LAELSGKGVTTIIGGGDSVAAVEKVGVASV  298
            LAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  269  LAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630