BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001B09

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP40627.1|  hypothetical protein JCGZ_24626                         274   1e-84   Jatropha curcas
ref|XP_010096538.1|  Pectinesterase 1                                   261   1e-83   
emb|CDO97787.1|  unnamed protein product                                261   1e-83   Coffea canephora [robusta coffee]
ref|NP_001274969.1|  pectin methyl esterase                             269   8e-83   Solanum tuberosum [potatoes]
ref|XP_006369079.1|  pectinesterase family protein                      258   1e-82   
emb|CAB95025.1|  pectin methylesterase                                  268   2e-82   Nicotiana tabacum [American tobacco]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   2e-82   Nicotiana sylvestris
ref|XP_003627458.1|  Pectinesterase                                     267   5e-82   Medicago truncatula
gb|AAO85706.1|  pectin methyl-esterase                                  266   1e-81   Nicotiana benthamiana
gb|AFK42744.1|  unknown                                                 256   2e-81   Lotus japonicus
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    266   2e-81   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    265   3e-81   Nicotiana tomentosiformis
gb|KHG08631.1|  Pectinesterase 3                                        265   3e-81   Gossypium arboreum [tree cotton]
gb|AFI23411.1|  pectin methylesterase                                   265   4e-81   Coffea arabica [arabica coffee]
gb|AFW03480.1|  pectin methylesterase 1                                 265   4e-81   Gossypium hirsutum [American cotton]
ref|XP_002304257.2|  pectinesterase family protein                      265   4e-81   Populus trichocarpa [western balsam poplar]
gb|AFW03475.1|  pectin methylesterase 1                                 265   4e-81   Gossypium barbadense [Egyptian cotton]
gb|KJB57093.1|  hypothetical protein B456_009G147900                    265   4e-81   Gossypium raimondii
gb|AFB77929.1|  pectin methylesterase                                   265   4e-81   Gossypium hirsutum [American cotton]
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     265   4e-81   Populus euphratica
ref|XP_008361835.1|  PREDICTED: pectinesterase-like                     253   1e-80   
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              256   3e-80   Glycine soja [wild soybean]
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             263   3e-80   Populus trichocarpa [western balsam poplar]
ref|NP_001265901.1|  pectinesterase 3-like                              263   3e-80   Cicer arietinum [garbanzo]
gb|ABE67980.1|  pectin methylesterase                                   251   7e-80   Citrus bergamia [bergamot orange]
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   249   9e-80   Citrus sinensis [apfelsine]
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     261   1e-79   Populus euphratica
emb|CAC01624.1|  putative pectin methylesterase                         261   2e-79   Populus tremula x Populus tremuloides
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    258   2e-79   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  260   2e-79   
gb|AAQ21126.1|  pectinesterase                                          249   3e-79   Fragaria x ananassa
ref|XP_008228105.1|  PREDICTED: pectinesterase                          260   3e-79   Prunus mume [ume]
gb|AAR03544.1|  pectin methylesterase isoform 1                         249   4e-79   Fragaria x ananassa
pir||T10488  pectinesterase (EC 3.1.1.11) PECS1.2 - sweet orange ...    250   8e-79
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  251   1e-78   Daucus carota [carrots]
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    251   1e-78   Daucus carota [carrots]
ref|XP_002265171.1|  PREDICTED: pectinesterase                          259   2e-78   Vitis vinifera
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             258   3e-78   Prunus persica
gb|AFQ23194.1|  pectin methylesterase                                   257   3e-78   Theobroma cacao [chocolate]
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     258   3e-78   Nicotiana tomentosiformis
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                   257   4e-78   
dbj|BAD94011.1|  pectin methylesterase like protein                     247   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    257   7e-78   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             256   7e-78   Phaseolus vulgaris [French bean]
emb|CBI27741.3|  unnamed protein product                                250   7e-78   Vitis vinifera
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     256   8e-78   Nicotiana sylvestris
gb|AAL24278.1|  AT3g14310/MLN21_9                                       250   1e-77   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95369.1|  pectin methylesterase like protein                     250   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    256   2e-77   Camelina sativa [gold-of-pleasure]
emb|CDX97564.1|  BnaA05g25150D                                          256   2e-77   
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                   253   3e-77   Tarenaya hassleriana [spider flower]
ref|NP_001275859.1|  pectinesterase 1 precursor                         254   5e-77   Citrus sinensis [apfelsine]
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    254   5e-77   Citrus sinensis [apfelsine]
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    254   6e-77   Citrus sinensis [apfelsine]
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     254   7e-77   Eucalyptus grandis [rose gum]
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   254   8e-77   Cucumis sativus [cucumbers]
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                254   9e-77   Erythranthe guttata [common monkey flower]
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    254   9e-77   Camelina sativa [gold-of-pleasure]
emb|CBI35795.3|  unnamed protein product                                255   1e-76   Vitis vinifera
ref|XP_004303758.1|  PREDICTED: pectinesterase-like                     253   1e-76   Fragaria vesca subsp. vesca
emb|CDX98441.1|  BnaC05g39340D                                          253   1e-76   
gb|AJH66132.1|  pectin methylesterase                                   253   2e-76   Malus domestica [apple tree]
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     253   2e-76   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    253   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     252   2e-76   Vitis vinifera
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   252   3e-76   
ref|NP_188048.1|  pectin methylesterase 3                               252   4e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AAC72288.1|  putative pectin methylesterase                          252   4e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273801.1|  PREDICTED: pectinesterase                          251   5e-76   Nelumbo nucifera [Indian lotus]
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg             252   9e-76   
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             251   1e-75   Eutrema salsugineum [saltwater cress]
ref|XP_002885033.1|  ATPME3                                             250   2e-75   
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    250   2e-75   Brassica rapa
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...    250   3e-75   Brassica rapa
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                    249   4e-75   Arabis alpina [alpine rockcress]
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          248   6e-75   Sesamum indicum [beniseed]
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          248   7e-75   
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         248   8e-75   Jatropha curcas
emb|CDY60700.1|  BnaA01g37100D                                          247   2e-74   Brassica napus [oilseed rape]
emb|CDY33229.1|  BnaC01g37020D                                          246   5e-74   Brassica napus [oilseed rape]
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     246   1e-73   
ref|XP_007012502.1|  Pectin methylesterase 3                            245   1e-73   
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g             252   2e-73   Phaseolus vulgaris [French bean]
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     244   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                   243   5e-73   
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     243   5e-73   Cucumis melo [Oriental melon]
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   243   5e-73   
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                244   5e-73   Erythranthe guttata [common monkey flower]
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          243   7e-73   Amborella trichopoda
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         243   9e-73   Jatropha curcas
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                240   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...    242   2e-72   Brassica rapa
emb|CDY02461.1|  BnaA08g00680D                                          234   7e-72   
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...    241   1e-71   Brassica rapa
emb|CDY39109.1|  BnaA01g29470D                                          239   2e-71   Brassica napus [oilseed rape]
emb|CAB57457.2|  pectin methylesterase                                  230   4e-71   Nicotiana tabacum [American tobacco]
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     233   7e-71   Sesamum indicum [beniseed]
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             238   2e-70   
ref|XP_002516188.1|  Pectinesterase-3 precursor, putative               236   2e-70   
gb|KDO36004.1|  hypothetical protein CISIN_1g029714mg                   223   2e-70   Citrus sinensis [apfelsine]
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   236   2e-70   Citrus sinensis [apfelsine]
gb|AAC50023.1|  ATPME2 precursor                                        237   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     236   3e-70   Eucalyptus grandis [rose gum]
ref|NP_001275846.1|  putative thermostable pectinesterase               238   3e-70   Citrus sinensis [apfelsine]
ref|NP_175786.1|  pectin methylesterase 2                               236   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               236   4e-70   Ricinus communis
emb|CDY33228.1|  BnaC01g37010D                                          236   9e-70   Brassica napus [oilseed rape]
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              234   2e-69   Linum usitatissimum
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              233   4e-69   Gossypium arboreum [tree cotton]
gb|AFB77928.1|  pectin methylesterase                                   233   5e-69   Gossypium hirsutum [American cotton]
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        233   6e-69   Camelina sativa [gold-of-pleasure]
gb|KJB54563.1|  hypothetical protein B456_009G039100                    232   1e-68   Gossypium raimondii
ref|XP_011039649.1|  PREDICTED: pectinesterase-like isoform X2          231   1e-68   Populus euphratica
ref|XP_011039648.1|  PREDICTED: pectinesterase-like isoform X1          231   1e-68   Populus euphratica
ref|XP_006389476.1|  hypothetical protein POPTR_0022s002002g            223   2e-68   
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   232   2e-68   Camelina sativa [gold-of-pleasure]
gb|KJB70037.1|  hypothetical protein B456_011G055100                    232   2e-68   Gossypium raimondii
ref|XP_011039646.1|  PREDICTED: pectinesterase-like                     231   3e-68   Populus euphratica
ref|XP_006382081.1|  hypothetical protein POPTR_0006s27270g             230   4e-68   
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             231   4e-68   Eutrema salsugineum [saltwater cress]
ref|XP_002891774.1|  ATPME2                                             231   4e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_006387527.1|  putative pectin methylesterase LuPME5 family...    230   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   231   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002309641.2|  putative pectin methylesterase LuPME5 family...    230   6e-68   
ref|XP_006369081.1|  hypothetical protein POPTR_0001s16280g             231   7e-68   
ref|XP_006372149.1|  hypothetical protein POPTR_0018s12530g             231   7e-68   
ref|XP_006369080.1|  putative pectin methylesterase LuPME5 family...    231   9e-68   
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    229   2e-67   
ref|XP_011003715.1|  PREDICTED: pectinesterase-like                     229   2e-67   Populus euphratica
ref|XP_011048629.1|  PREDICTED: pectinesterase-like                     229   2e-67   Populus euphratica
ref|XP_006371892.1|  hypothetical protein POPTR_0018s05350g             219   2e-67   
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     229   2e-67   Populus euphratica
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             229   3e-67   Capsella rubella
ref|XP_011039647.1|  PREDICTED: pectinesterase-like                     228   3e-67   Populus euphratica
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    228   3e-67   
emb|CAC18725.1|  putative pectin methylesterase                         228   4e-67   Populus tremula x Populus tremuloides
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     228   4e-67   Sesamum indicum [beniseed]
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     228   6e-67   Populus euphratica
emb|CAC18727.1|  putative pectin methylesterase                         226   1e-66   Populus tremula x Populus tremuloides
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             226   2e-66   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         225   3e-66   Linum usitatissimum
emb|CDY08206.1|  BnaA05g14130D                                          225   7e-66   Brassica napus [oilseed rape]
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative               224   1e-65   Ricinus communis
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        225   1e-65   
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                    224   1e-65   Arabis alpina [alpine rockcress]
emb|CDY51798.1|  BnaC06g41940D                                          224   2e-65   Brassica napus [oilseed rape]
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     221   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC18726.1|  putative pectin methylesterase                         221   1e-64   Populus tremula x Populus tremuloides
gb|AAN84553.1|  methyl pectinesterase                                   210   5e-64   Lolium perenne [perennial ryegrass]
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        210   2e-63   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     218   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010534984.1|  PREDICTED: pectinesterase-like                     217   5e-63   Tarenaya hassleriana [spider flower]
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     213   3e-61   Elaeis guineensis
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          213   3e-61   Phoenix dactylifera
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     212   7e-61   Eucalyptus grandis [rose gum]
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     211   9e-61   Elaeis guineensis
ref|NP_001042866.1|  Os01g0312500                                       207   1e-60   
gb|ABK94644.1|  unknown                                                 204   2e-60   Populus trichocarpa [western balsam poplar]
dbj|BAJ96804.1|  predicted protein                                      210   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     201   3e-60   Elaeis guineensis
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   205   5e-60   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     209   5e-60   Eucalyptus grandis [rose gum]
ref|XP_002518523.1|  Pectinesterase precursor, putative                 208   1e-59   Ricinus communis
gb|EMT27728.1|  Pectinesterase                                          204   1e-59   
gb|EEC70505.1|  hypothetical protein OsI_01594                          207   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     207   2e-59   Eucalyptus grandis [rose gum]
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     199   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE54425.1|  hypothetical protein OsJ_01485                          207   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|EMS45437.1|  Pectinesterase                                          200   5e-59   Triticum urartu
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                206   8e-59   Erythranthe guttata [common monkey flower]
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     196   2e-58   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     205   2e-58   Phoenix dactylifera
ref|XP_002317208.1|  pectin methylesterase family protein               204   2e-58   
gb|EPS74082.1|  hypothetical protein M569_00674                         203   3e-58   Genlisea aurea
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         204   3e-58   Jatropha curcas
ref|XP_004293266.1|  PREDICTED: pectinesterase                          203   4e-58   Fragaria vesca subsp. vesca
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     203   1e-57   Eucalyptus grandis [rose gum]
ref|XP_011000694.1|  PREDICTED: pectinesterase                          202   1e-57   Populus euphratica
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     202   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_007038413.1|  Pectinesterase                                     201   2e-57   
gb|EMT05022.1|  Pectinesterase 3                                        200   3e-57   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             200   3e-57   
gb|KJB41904.1|  hypothetical protein B456_007G127000                    201   4e-57   Gossypium raimondii
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            201   4e-57   Morus notabilis
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    201   5e-57   Gossypium arboreum [tree cotton]
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   200   6e-57   Nelumbo nucifera [Indian lotus]
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    199   7e-57   
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   192   1e-56   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             199   2e-56   Prunus persica
gb|KJB09419.1|  hypothetical protein B456_001G140500                    199   2e-56   Gossypium raimondii
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               197   2e-56   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             199   2e-56   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     198   2e-56   
dbj|BAF95866.1|  pectin methylesterase isoform alpha                    191   3e-56   Vitis hybrid cultivar
ref|XP_010267745.1|  PREDICTED: pectinesterase                          199   3e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 199   3e-56   Sesamum indicum [beniseed]
ref|XP_002322401.1|  putative pectin methylesterase family protein      197   4e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   197   6e-56   Populus euphratica
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          197   7e-56   Amborella trichopoda
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         197   8e-56   Jatropha curcas
gb|AGG23325.1|  pectin methylesterase 1                                 198   9e-56   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     198   9e-56   
gb|ACQ85264.1|  pectin methylesterase                                   197   9e-56   Musa acuminata AAA Group [Cavendish banana]
ref|XP_004307817.2|  PREDICTED: pectinesterase 2-like                   197   1e-55   Fragaria vesca subsp. vesca
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     197   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 197   1e-55   Nicotiana sylvestris
gb|AHC69829.1|  pectin methylesterase PME2.1                            197   1e-55   Nicotiana tabacum [American tobacco]
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            197   1e-55   Morus notabilis
gb|KJB49889.1|  hypothetical protein B456_008G143700                    197   1e-55   Gossypium raimondii
ref|XP_002318285.1|  putative pectin methylesterase family protein      196   1e-55   Populus trichocarpa [western balsam poplar]
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         194   1e-55   Jatropha curcas
ref|XP_008224789.1|  PREDICTED: pectinesterase                          197   2e-55   Prunus mume [ume]
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            198   2e-55   
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    196   2e-55   Morus notabilis
ref|XP_010534985.1|  PREDICTED: pectinesterase-like                     197   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   196   3e-55   Pyrus x bretschneideri [bai li]
gb|EEC82670.1|  hypothetical protein OsI_27314                          196   3e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001060620.1|  Os07g0675100                                       196   3e-55   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   193   3e-55   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     196   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   195   5e-55   Prunus mume [ume]
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    196   5e-55   Citrus sinensis [apfelsine]
ref|XP_008371117.1|  PREDICTED: pectinesterase                          196   5e-55   
emb|CBI24582.3|  unnamed protein product                                188   6e-55   Vitis vinifera
gb|AAF16637.1|AC011661_15  T23J18.24                                    187   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     195   7e-55   Populus euphratica
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   195   8e-55   Citrus sinensis [apfelsine]
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     195   8e-55   Populus euphratica
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     195   8e-55   Prunus mume [ume]
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     195   9e-55   Fragaria vesca subsp. vesca
emb|CDO97717.1|  unnamed protein product                                187   1e-54   Coffea canephora [robusta coffee]
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     194   1e-54   Eucalyptus grandis [rose gum]
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   194   1e-54   Pyrus x bretschneideri [bai li]
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 194   1e-54   Medicago truncatula
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   194   2e-54   
emb|CDP20891.1|  unnamed protein product                                193   2e-54   Coffea canephora [robusta coffee]
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       194   2e-54   Cucumis sativus [cucumbers]
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   193   2e-54   Populus euphratica
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    190   2e-54
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           187   2e-54   Vigna radiata [mung bean]
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   193   3e-54   Citrus sinensis [apfelsine]
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   191   3e-54   
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    193   3e-54   Nicotiana tomentosiformis
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             193   3e-54   Citrus clementina [clementine]
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     192   3e-54   Glycine soja [wild soybean]
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   190   3e-54   Citrus sinensis [apfelsine]
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     191   4e-54   
gb|AFC98398.1|  pectin methylesterase                                   193   4e-54   Lepidium sativum
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             194   4e-54   Phaseolus vulgaris [French bean]
ref|XP_009364480.1|  PREDICTED: pectinesterase                          193   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     193   4e-54   
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     193   4e-54   Eucalyptus grandis [rose gum]
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    187   4e-54   Actinidia deliciosa [Chinese gooseberry]
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    187   4e-54   Actinidia chinensis
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   195   5e-54   
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                192   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             193   5e-54   Phaseolus vulgaris [French bean]
emb|CBI38888.3|  unnamed protein product                                186   5e-54   Vitis vinifera
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   192   6e-54   Cucumis sativus [cucumbers]
gb|AAF23891.1|  pectin methyl esterase                                  192   7e-54   Solanum tuberosum [potatoes]
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   193   7e-54   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     192   7e-54   Phoenix dactylifera
emb|CBI24284.3|  unnamed protein product                                185   7e-54   Vitis vinifera
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     192   7e-54   Nicotiana tomentosiformis
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   192   8e-54   Nicotiana sylvestris
ref|NP_001274785.1|  pectin methyl esterase                             192   9e-54   Solanum tuberosum [potatoes]
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               192   9e-54   Ricinus communis
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               192   1e-53   Ricinus communis
gb|EYU46749.1|  hypothetical protein MIMGU_mgv1a0044631mg               187   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             192   1e-53   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    192   1e-53   Glycine max [soybeans]
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             192   1e-53   Citrus clementina [clementine]
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   191   1e-53   Citrus sinensis [apfelsine]
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             191   2e-53   Citrus clementina [clementine]
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 190   2e-53   Gossypium arboreum [tree cotton]
gb|AIZ46897.1|  pectin methylesterase                                   182   2e-53   Dendrobium hybrid cultivar
ref|XP_010321856.1|  PREDICTED: pectinesterase                          191   2e-53   Solanum lycopersicum
ref|XP_007052106.1|  Pectinesterase 2                                   191   2e-53   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   190   3e-53   Cucumis melo [Oriental melon]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     189   3e-53   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            191   3e-53   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    191   3e-53   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     189   4e-53   
emb|CDY34642.1|  BnaC08g42010D                                          188   4e-53   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    190   4e-53   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    191   4e-53   
ref|NP_001275775.1|  pectinesterase 2 precursor                         189   4e-53   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     190   5e-53   
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    189   5e-53   
gb|AHB84678.1|  pectin methylesterase                                   191   5e-53   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    190   6e-53   
ref|NP_172624.1|  methylesterase PCR A                                  190   6e-53   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          189   7e-53   
gb|AAK59760.1|  At1g11580/T23J18_33                                     190   7e-53   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     190   8e-53   
ref|NP_001233948.1|  pectinesterase 2.1                                 189   8e-53   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     189   9e-53   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    188   1e-52   
gb|EPS62329.1|  pectinesterase                                          189   1e-52   
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   188   1e-52   
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             189   1e-52   
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    188   1e-52   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   188   1e-52   
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    189   2e-52   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     188   2e-52   
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    189   2e-52   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     189   2e-52   
ref|NP_001234151.1|  pectinesterase 1 precursor                         188   2e-52   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     188   2e-52   
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     187   2e-52   
ref|XP_002889876.1|  At1g11580/T23J18_33                                188   2e-52   
emb|CAA96436.1|  pectin methylesterase                                  182   2e-52   
gb|AAB67740.1|  PME1.9                                                  186   3e-52   
gb|ABZ89800.1|  pectin methylesterase-like protein                      189   3e-52   
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    189   3e-52   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     187   3e-52   
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          189   3e-52   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     187   3e-52   
gb|AAB67739.1|  pectin methylesterase PME2.1                            188   4e-52   
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    188   4e-52   
emb|CAA96434.1|  pectin methylesterase                                  182   4e-52   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               187   4e-52   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     188   4e-52   
emb|CAA96435.1|  pectin methylesterase                                  182   4e-52   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    187   4e-52   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         187   5e-52   
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     187   6e-52   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     187   6e-52   
gb|ABK24761.1|  unknown                                                 187   6e-52   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     187   6e-52   
gb|KJB67143.1|  hypothetical protein B456_010G177500                    187   7e-52   
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    187   7e-52   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     187   7e-52   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    187   7e-52   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             187   7e-52   
gb|AAB38794.1|  pectin methylesterase                                   185   7e-52   
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   188   7e-52   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   186   8e-52   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    186   9e-52   
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    187   1e-51   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     186   1e-51   
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 187   1e-51   
ref|XP_008439965.1|  PREDICTED: pectinesterase                          187   1e-51   
gb|ABQ42392.1|  pectin methylesterase-like protein                      187   1e-51   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        186   1e-51   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     187   1e-51   
emb|CAN83663.1|  hypothetical protein VITISV_017689                     186   1e-51   
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   186   1e-51   
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     186   1e-51   
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        186   1e-51   
gb|KHN42767.1|  Pectinesterase 2                                        184   1e-51   
ref|XP_010098737.1|  Putative pectinesterase/pectinesterase inhib...    184   1e-51   
gb|AAQ21125.1|  pectinesterase                                          177   1e-51   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    186   1e-51   
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   186   1e-51   
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     186   2e-51   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             185   2e-51   
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   185   2e-51   
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               185   2e-51   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     185   2e-51   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    186   2e-51   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    184   2e-51   
gb|KGN44975.1|  Pectinesterase                                          186   3e-51   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        185   3e-51   
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     185   3e-51   
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    185   3e-51   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     185   4e-51   
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     185   4e-51   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    185   5e-51   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     185   5e-51   
gb|KHN25547.1|  Pectinesterase 2                                        181   5e-51   
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    184   5e-51   
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     185   5e-51   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     184   5e-51   
gb|EPS67019.1|  pectinesterase                                          180   5e-51   
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     184   5e-51   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    184   6e-51   
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   184   6e-51   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        184   6e-51   
gb|KHN16553.1|  Pectinesterase 2                                        182   6e-51   
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   184   6e-51   
emb|CDP05792.1|  unnamed protein product                                182   7e-51   
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    184   7e-51   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     184   8e-51   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   184   8e-51   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    184   8e-51   
emb|CBI24285.3|  unnamed protein product                                182   9e-51   
ref|NP_001146685.1|  pectinesterase precursor                           184   9e-51   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          184   9e-51   
ref|XP_010271283.1|  PREDICTED: pectinesterase                          184   1e-50   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     183   1e-50   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             184   1e-50   
gb|KEH15723.1|  pectinesterase                                          176   2e-50   
ref|XP_010098738.1|  Pectinesterase 3                                   184   2e-50   
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    181   2e-50   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          182   2e-50   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      182   2e-50   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    182   2e-50   
gb|EYU25227.1|  hypothetical protein MIMGU_mgv1a0032971mg               175   3e-50   
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     182   3e-50   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             182   3e-50   
gb|KJB41089.1|  hypothetical protein B456_007G090100                    182   3e-50   
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     182   3e-50   
gb|AFW03479.1|  pectin methylesterase 5                                 182   4e-50   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     182   4e-50   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      182   4e-50   
gb|KJB57711.1|  hypothetical protein B456_009G176700                    182   4e-50   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    182   4e-50   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     182   4e-50   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     183   4e-50   
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        182   4e-50   
gb|AAQ21127.1|  pectinesterase                                          174   5e-50   
gb|KGN49865.1|  hypothetical protein Csa_5G139430                       182   7e-50   
ref|XP_004172937.1|  PREDICTED: probable pectinesterase/pectinest...    182   7e-50   
gb|ACJ02103.1|  pectin methylesterase                                   181   8e-50   
gb|EMS66304.1|  Pectinesterase 2.2                                      174   8e-50   
ref|XP_002266980.1|  PREDICTED: pectinesterase                          181   8e-50   
gb|ACN40984.1|  unknown                                                 182   9e-50   
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        181   9e-50   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   181   1e-49   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   181   1e-49   
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    181   1e-49   
gb|ABQ88349.1|  pectin methylesterase                                   171   1e-49   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   180   1e-49   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        180   1e-49   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   180   2e-49   
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   180   2e-49   
gb|KJB30790.1|  hypothetical protein B456_005G160000                    180   2e-49   
emb|CDP20872.1|  unnamed protein product                                180   2e-49   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        180   2e-49   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    181   2e-49   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     180   2e-49   
emb|CAN76835.1|  hypothetical protein VITISV_043176                     179   2e-49   
ref|XP_011095338.1|  PREDICTED: pectinesterase 2.1-like                 181   2e-49   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   179   3e-49   
gb|AFW03484.1|  pectin methylesterase 5                                 179   3e-49   
gb|KEH21378.1|  pectinesterase                                          176   3e-49   
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    179   3e-49   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             179   3e-49   
gb|KHN35618.1|  Pectinesterase 2                                        176   4e-49   
sp|Q96576.1|PME3_SOLLC  RecName: Full=Pectinesterase 3; Short=PE ...    179   4e-49   
gb|EYU33104.1|  hypothetical protein MIMGU_mgv1a012115mg                173   5e-49   
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   179   5e-49   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        179   6e-49   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             179   7e-49   
ref|XP_004297462.2|  PREDICTED: pectinesterase                          179   9e-49   
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    179   9e-49   
emb|CAN78759.1|  hypothetical protein VITISV_000562                     178   9e-49   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    179   9e-49   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         178   9e-49   
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   176   9e-49   
gb|AEW08385.1|  hypothetical protein 2_7981_01                          168   1e-48   
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    179   1e-48   
emb|CDO99718.1|  unnamed protein product                                178   1e-48   
gb|EAY76103.1|  hypothetical protein OsI_04029                          178   1e-48   
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             178   1e-48   
ref|XP_002321999.2|  pectin methylesterase family protein               179   1e-48   
ref|XP_011006351.1|  PREDICTED: probable pectinesterase/pectinest...    179   1e-48   
emb|CDP00815.1|  unnamed protein product                                178   1e-48   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 178   1e-48   
emb|CAA64217.1|  pectinmethylesterase                                   173   1e-48   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          177   2e-48   
gb|EPS67025.1|  pectinesterase                                          171   2e-48   
gb|EMT26847.1|  Pectinesterase 1                                        170   2e-48   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    177   2e-48   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     177   2e-48   
gb|EPS67066.1|  pectinesterase                                          181   2e-48   
emb|CDY18942.1|  BnaC04g04080D                                          171   2e-48   
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    178   2e-48   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    177   2e-48   
emb|CDX83392.1|  BnaA03g21140D                                          176   2e-48   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     176   2e-48   
ref|XP_011047961.1|  PREDICTED: pectinesterase-like                     177   2e-48   
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             178   2e-48   
gb|ABK92615.1|  unknown                                                 167   2e-48   
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   170   2e-48   
ref|XP_002882002.1|  predicted protein                                  177   3e-48   
gb|EMS67994.1|  putative pectinesterase/pectinesterase inhibitor 16     171   3e-48   
emb|CDX95641.1|  BnaC03g25220D                                          176   3e-48   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   176   3e-48   
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    176   4e-48   
ref|XP_006843574.1|  hypothetical protein AMTR_s00007p00101250          177   4e-48   
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    177   4e-48   
ref|XP_003591484.1|  Pectinesterase                                     172   4e-48   
emb|CAE76634.1|  pectin methylesterase                                  170   4e-48   
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                     177   4e-48   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   176   4e-48   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   176   4e-48   
ref|XP_003564371.1|  PREDICTED: pectinesterase                          177   5e-48   
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                     177   5e-48   
gb|AER38244.1|  PME5                                                    176   5e-48   
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    176   5e-48   
gb|AAC14742.1|  pectin methylesterase                                   176   6e-48   
dbj|BAC67661.1|  pectin methylesterase                                  176   6e-48   
emb|CAA47810.1|  pectinesterase                                         176   6e-48   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    176   6e-48   
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 176   7e-48   
ref|XP_008458040.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    177   7e-48   
ref|XP_004154436.1|  PREDICTED: pectinesterase/pectinesterase inh...    176   7e-48   
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     177   8e-48   



>gb|KDP40627.1| hypothetical protein JCGZ_24626 [Jatropha curcas]
Length=581

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  435  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQSSFPTYLGRPWKEYSR  494

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQSTISDVI PAGWH WTG FALNTLTYREYQN+GAGAGTS RVTWKGYKV+TS+SE
Sbjct  495  TVIMQSTISDVIHPAGWHLWTGDFALNTLTYREYQNSGAGAGTSNRVTWKGYKVITSASE  554

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP NFIAGS+WL  TTFPFSLGL
Sbjct  555  AQAFTPGNFIAGSNWLRGTTFPFSLGL  581



>ref|XP_010096538.1| Pectinesterase 1 [Morus notabilis]
 gb|EXB64658.1| Pectinesterase 1 [Morus notabilis]
Length=233

 Score =   261 bits (666),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  87   HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQSSFPTYLGRPWKEYSR  146

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS IS+VI PAGWHEW+G+FALNTL YREYQNTGAGA TSKRVTWKGYKV+T +SE
Sbjct  147  TVVMQSDISNVIVPAGWHEWSGSFALNTLVYREYQNTGAGADTSKRVTWKGYKVITGASE  206

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT  NFIAG SWL +T FPFSLGL
Sbjct  207  AQQYTAGNFIAGGSWLRATGFPFSLGL  233



>emb|CDO97787.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR PGSGQKNM+TAQGR DPNQNTGIVIQKCRI ATSDL+PVQ+NFPTFLGRPWKEYSR
Sbjct  114  HARLPGSGQKNMVTAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTFLGRPWKEYSR  173

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQST++DVIDPAGWHEW G FAL+TL Y EYQNTGAGAGTS RV WKGYKV+TS++E
Sbjct  174  TVVMQSTVTDVIDPAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWKGYKVITSAAE  233

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FI G+SWL +T FPF+LGL
Sbjct  234  AQAFTPGRFIDGNSWLGATGFPFALGL  260



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+PVQK+FPT+LGRPWKEYSR
Sbjct  430  HARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSR  489

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW G FALNTL Y EY NTGAGA TS RV WKG+KV+TSS+E
Sbjct  490  TVIMQSSITDVIQPAGWHEWNGNFALNTLFYGEYANTGAGAATSGRVKWKGHKVITSSTE  549

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP +FIAG SWLSST FPFSLGL
Sbjct  550  AQAYTPGSFIAGGSWLSSTGFPFSLGL  576



>ref|XP_006369079.1| pectinesterase family protein, partial [Populus trichocarpa]
 gb|ERP65648.1| pectinesterase family protein, partial [Populus trichocarpa]
Length=229

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL PVQ +FPT+LGRPWKEYSR
Sbjct  83   HARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSR  142

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW+GTFAL+TL Y EYQN+G+GAGTS RVTW+GYKV+TS++E
Sbjct  143  TVIMQSSITDVIQPAGWHEWSGTFALSTLFYAEYQNSGSGAGTSSRVTWEGYKVITSATE  202

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ + P NFIAGSSWL ST+FPFSLGL
Sbjct  203  AQAFAPGNFIAGSSWLGSTSFPFSLGL  229



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGR+DPNQNTGIVIQKCRI ATSDL+PVQK+FPT+LGRPWKEYSR
Sbjct  433  HARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSR  492

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGTS RV WKG+KV+TS++E
Sbjct  493  TVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATE  552

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP  FIAG SWLSST FPFSLGL
Sbjct  553  AQAYTPGRFIAGGSWLSSTGFPFSLGL  579



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGR+DPNQNTGIVIQKCRI ATSDL+PVQK+FPT+LGRPWKEYSR
Sbjct  443  HARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSR  502

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGTS RV WKG+KV+TS++E
Sbjct  503  TVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATE  562

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP  FIAG SWLSST FPFSLGL
Sbjct  563  AQAYTPGRFIAGGSWLSSTGFPFSLGL  589



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+ NFPT+LGRPWKEYSR
Sbjct  443  HARRPNSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGVKGNFPTYLGRPWKEYSR  502

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS+ISDVIDP GWHEW G FALNTL YREYQNTG GAGTSKRVTWKG+KV+TS++E
Sbjct  503  TVFMQSSISDVIDPVGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVTWKGFKVITSAAE  562

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ++TP NFI GSSWL ST FPFSLGL
Sbjct  563  AQSFTPGNFIGGSSWLGSTGFPFSLGL  589



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGR+DPNQNTGIVIQKCRI ATSDL+PVQK+FP +LGRPWKEYSR
Sbjct  433  HARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPMYLGRPWKEYSR  492

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGTS RV WKG+KV+TS++E
Sbjct  493  TVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATE  552

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP  FIAG SWLSST FPFSLGL
Sbjct  553  AQAYTPGRFIAGGSWLSSTGFPFSLGL  579



>gb|AFK42744.1| unknown [Lotus japonicus]
Length=260

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+ +FPTFLGRPWK+YSR
Sbjct  114  HARRPNSGQKNMVTAQGRLDPNQNTGIVIQKCRIGATKDLEAVKSSFPTFLGRPWKDYSR  173

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVIDPAGWHEW G FALNTL Y EY NTG GA TS+RV WKG+KV+TS+SE
Sbjct  174  TVIMQSSITDVIDPAGWHEWNGNFALNTLFYGEYLNTGPGAATSRRVNWKGFKVITSASE  233

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP+NFIAGS+WLSST FPFSLGL
Sbjct  234  AQAFTPANFIAGSTWLSSTGFPFSLGL  260



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+PVQK+FPT+LGRPWKEYSR
Sbjct  437  HARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSR  496

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW G FAL+TL Y EY NTGAGA TS RV WKG+KV+TSS+E
Sbjct  497  TVIMQSSITDVIQPAGWHEWNGNFALDTLFYGEYANTGAGAPTSGRVKWKGHKVITSSTE  556

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP  FIAG SWLSST FPFSLGL
Sbjct  557  AQAYTPGRFIAGGSWLSSTGFPFSLGL  583



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGRTDPNQNTGIVIQ CRI ATSDL+PVQK+FPT+LGRPWKEYSR
Sbjct  443  HARRPGSGQKNMVTAQGRTDPNQNTGIVIQNCRIGATSDLRPVQKSFPTYLGRPWKEYSR  502

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGTS RV W+G+KV+TS++E
Sbjct  503  TVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWRGFKVITSATE  562

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP  FIAG SWL ST FPFSLGL
Sbjct  563  AQAYTPGRFIAGGSWLGSTGFPFSLGL  589



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+PV+KNFPT+LGRPWKEYSR
Sbjct  436  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA TS RV W GYKV+TS+SE
Sbjct  496  TVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FIAG SWLSST FPF+LGL
Sbjct  556  AQAFTPGRFIAGGSWLSSTGFPFALGL  582



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR PGSGQKNM+TAQGR DPNQNTGIVIQKCRI ATSDL+PVQ+NFPTFLGRPWKEYSR
Sbjct  441  HARLPGSGQKNMVTAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTFLGRPWKEYSR  500

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQST++DVIDPAGWHEW G FAL+TL Y EYQNTGAGAGTS RV WKGYKV+TS++E
Sbjct  501  TVVMQSTVTDVIDPAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWKGYKVITSAAE  560

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FI G+SWL +T FPF+LGL
Sbjct  561  AQAFTPGRFIDGNSWLGATGFPFALGL  587



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+PV+KNFPT+LGRPWKEYSR
Sbjct  436  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA TS RV W GYKV+TS+SE
Sbjct  496  TVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FIAG SWLSST FPF+LGL
Sbjct  556  AQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+PV+ +FPT+LGRPWKEYSR
Sbjct  438  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTYLGRPWKEYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGW EW+G+FALNTL Y EYQN+GAGAGTS+RVTWKGY+V+TS++E
Sbjct  498  TVIMQSSITDVIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWKGYRVITSATE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP NFIAGSSWL STTFPFSLGL
Sbjct  558  AQRFTPGNFIAGSSWLRSTTFPFSLGL  584



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+PV+KNFPT+LGRPWKEYSR
Sbjct  436  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA TS RV W GYKV+TS+SE
Sbjct  496  TVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FIAG SWLSST FPF+LGL
Sbjct  556  AQAFTPGRFIAGGSWLSSTGFPFALGL  582



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+PV+KNFPT+LGRPWKEYSR
Sbjct  436  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA TS RV W GYKV+TS+SE
Sbjct  496  TVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FIAG SWLSST FPF+LGL
Sbjct  556  AQAFTPGRFIAGGSWLSSTGFPFALGL  582



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+PV+KNFPT+LGRPWKEYSR
Sbjct  436  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA TS RV W GYKV+TS+SE
Sbjct  496  TVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FIAG SWLSST FPF+LGL
Sbjct  556  AQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+PV+ +FPT+LGRPWKEYSR
Sbjct  434  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTYLGRPWKEYSR  493

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGW EW+G+FALNTL Y EYQN+GAGAGTS+RVTWKGY+V+TS++E
Sbjct  494  TVIMQSSITDVIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWKGYRVITSATE  553

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP NFIAGSSWL STTFPFSLGL
Sbjct  554  AQRFTPGNFIAGSSWLRSTTFPFSLGL  580



>ref|XP_008361835.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=233

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI ATSDL+  + +F TFLGRPWKEYSR
Sbjct  87   HARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTFLGRPWKEYSR  146

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+IDP GWHEW+GTFALNTL Y EY NTGAGAGTSKRVTWKG+KV+TS++E
Sbjct  147  TVIMQSSITDIIDPVGWHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWKGFKVITSTTE  206

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP  FIAG SWLSST FPF+LGL
Sbjct  207  AQAYTPGRFIAGGSWLSSTGFPFALGL  233



>gb|KHN15840.1| Pectinesterase/pectinesterase inhibitor U1 [Glycine soja]
Length=362

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+KNF T+LGRPWKEYSR
Sbjct  216  HARLPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTYLGRPWKEYSR  275

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVIDP GWHEW+G FAL+TL YREYQNTG GAGTS RVTWKGYKV+T ++E
Sbjct  276  TVIMQSSISDVIDPIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWKGYKVITDAAE  335

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YTP +FI GSSWL ST FPFSLGL
Sbjct  336  ARDYTPGSFIGGSSWLGSTGFPFSLGL  362



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL PVQ +FPT+LGRPWKEYSR
Sbjct  433  HARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSR  492

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW+GTFAL+TL Y EYQN+G+GAGTS RVTW+GYKV+TS++E
Sbjct  493  TVIMQSSITDVIQPAGWHEWSGTFALSTLFYAEYQNSGSGAGTSSRVTWEGYKVITSATE  552

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ + P NFIAGSSWL ST+FPFSLGL
Sbjct  553  AQAFAPGNFIAGSSWLGSTSFPFSLGL  579



>ref|NP_001265901.1| pectinesterase 3-like [Cicer arietinum]
 emb|CAE76633.2| pectin methylesterase [Cicer arietinum]
Length=584

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ ++  FPT+LGRPWKEYSR
Sbjct  438  HARKPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGLKGTFPTYLGRPWKEYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVIDP GWHEW G FALNTL YREYQNTG GAGTSKRV WKG+KV+TS+SE
Sbjct  498  TVIMQSSISDVIDPIGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVNWKGFKVITSASE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQT+TP NFI GS+WL ST FPFSLGL
Sbjct  558  AQTFTPGNFIGGSTWLGSTGFPFSLGL  584



>gb|ABE67980.1| pectin methylesterase, partial [Citrus bergamia]
Length=229

 Score =   251 bits (641),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  83   HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSR  142

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+I PAGWHEW G FALNTL Y E+QN+GAGAGTS RV WKG++V+TS++E
Sbjct  143  TVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATE  202

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  203  AQAFTPGSFIAGSSWLGSTGFPFSLGL  229



>gb|KDO36003.1| hypothetical protein CISIN_1g029714mg [Citrus sinensis]
Length=189

 Score =   249 bits (636),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR DPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  43   HARKPNSGQKNMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSR  102

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW G FALNTL Y E+QN GAGAGTS RV WKG++V+TS++E
Sbjct  103  TVIMQSSITDVIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATE  162

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  163  AQAFTPGSFIAGSSWLGSTGFPFSLGL  189



>ref|XP_011048630.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=579

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL PVQ +FPT+LGRPWKEYSR
Sbjct  433  HARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSR  492

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW+G+FAL+TL Y EYQN+GAGAGTS RVTW+GY+V+TS++E
Sbjct  493  TVIMQSSITDVIQPAGWHEWSGSFALSTLFYAEYQNSGAGAGTSSRVTWEGYRVITSATE  552

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
             Q +TP NFIAGSSWL ST+FPFSLGL
Sbjct  553  VQEFTPGNFIAGSSWLGSTSFPFSLGL  579



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL PVQ +FPT+LGRPWKEYSR
Sbjct  433  HARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSR  492

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW+G+FAL+TL Y EYQN+GAGAGTS RV W+GYKV+TS++E
Sbjct  493  TVIMQSSITDVIQPAGWHEWSGSFALSTLFYAEYQNSGAGAGTSSRVKWEGYKVITSATE  552

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ + P NFIAGSSWL ST+FPFSLGL
Sbjct  553  AQAFAPGNFIAGSSWLGSTSFPFSLGL  579



>ref|XP_006599763.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=492

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+KNF T+LGRPWKEYSR
Sbjct  346  HARLPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTYLGRPWKEYSR  405

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVIDP GWHEW+G FAL+TL YREYQNTG GAGTS RVTWKGYKV+T ++E
Sbjct  406  TVIMQSSISDVIDPIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWKGYKVITDAAE  465

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YTP +FI GSSWL ST FPFSLGL
Sbjct  466  ARDYTPGSFIGGSSWLGSTGFPFSLGL  492



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ NFPT+LGRPWKEYSR
Sbjct  436  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVRSNFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI PAGWHEW+ +FAL TL Y EYQNTGAGAGTS RV W+GYKV+TS+SE
Sbjct  496  TVVMQSVISDVIHPAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWEGYKVITSASE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ Y+P  FIAG SWLSST FPFSLGL
Sbjct  556  AQAYSPGRFIAGGSWLSSTGFPFSLGL  582



>gb|AAQ21126.1| pectinesterase [Fragaria x ananassa]
Length=209

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI ATSDL+ V+ +F T+LGRPWKEYSR
Sbjct  63   HARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSR  122

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+IDPAGW+EW+GTFAL+TL Y EY NTGAGA TS RVTWKGYKV+TS++E
Sbjct  123  TVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATE  182

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP NFIAG SWLS+T FPF+LGL
Sbjct  183  AQAFTPGNFIAGGSWLSATGFPFTLGL  209



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+ V+ +F TFLGRPWKEYSR
Sbjct  441  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTFLGRPWKEYSR  500

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISD+IDPAGWHEW+GTFAL+TL Y EY NTGAGAGTS RVTWKG+KV+TS++E
Sbjct  501  TVIMQSSISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTSNRVTWKGFKVITSATE  560

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQT+TP +FIAG SWLSST FPFSLGL
Sbjct  561  AQTFTPGSFIAGGSWLSSTGFPFSLGL  587



>gb|AAR03544.1| pectin methylesterase isoform 1 [Fragaria x ananassa]
Length=224

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI ATSDL+ V+ +F T+LGRPWKEYSR
Sbjct  78   HARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSR  137

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+IDPAGW+EW+GTFAL+TL Y EY NTGAGA TS RVTWKGYKV+TS++E
Sbjct  138  TVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATE  197

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP NFIAG SWLS+T FPF+LGL
Sbjct  198  AQAFTPGNFIAGGSWLSATGFPFTLGL  224



>pir||T10488 pectinesterase (EC 3.1.1.11) PECS1.2 - sweet orange  (fragment)
 gb|AAB57668.1| pectinesterase [Citrus sinensis]
Length=290

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR DPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  144  HARKPNSGQKNMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSR  203

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW G FALNTL Y E+QN GAGAGTS RV WKG++V+TS++E
Sbjct  204  TVIMQSSITDVIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATE  263

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  264  AQAFTPGSFIAGSSWLGSTGFPFSLGL  290



>pdb|1GQ8|A Chain A, Pectin Methylesterase From Carrot
Length=319

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+PVQ +FPT+LGRPWKEYSR
Sbjct  173  HARRPGSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSR  232

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+I++VI+PAGW  W G FAL+TL Y EYQNTGAGA TS RVTWKG+KV+TSS+E
Sbjct  233  TVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTE  292

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAG SWL +TTFPFSLGL
Sbjct  293  AQGFTPGSFIAGGSWLKATTFPFSLGL  319



>sp|P83218.1|PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Daucus carota]
Length=319

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+PVQ +FPT+LGRPWKEYSR
Sbjct  173  HARRPGSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSR  232

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+I++VI+PAGW  W G FAL+TL Y EYQNTGAGA TS RVTWKG+KV+TSS+E
Sbjct  233  TVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTE  292

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAG SWL +TTFPFSLGL
Sbjct  293  AQGFTPGSFIAGGSWLKATTFPFSLGL  319



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNMLTAQGRTDPNQNTGIVIQKCRI ATSDL+ V  +F T+LGRPWKEYSR
Sbjct  465  HARRPNSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGRPWKEYSR  524

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ++I++VIDPAGWHEW+G+FAL+TL Y EYQNTGAGAGTSKRVTWKG+KV+TS+SE
Sbjct  525  TVVMQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFKVITSASE  584

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FIAGSSWL ST FP+SLGL
Sbjct  585  AQGFTPGTFIAGSSWLGSTGFPYSLGL  611



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+ V+ +F TFLGRPWKEYSR
Sbjct  441  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTFLGRPWKEYSR  500

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISD+IDPAGWHEW+GTFAL+TL Y EY NTGAGAG S RVTWKG+KV+TS++E
Sbjct  501  TVIMQSAISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGISNRVTWKGFKVITSATE  560

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQT+TP +FIAG SWLSST FPFSLGL
Sbjct  561  AQTFTPGSFIAGGSWLSSTGFPFSLGL  587



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V  NFPT+LGRPWKEYSR
Sbjct  436  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVTSNFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI PAGWHEW+ +FAL TL Y EYQNTGAGAGTS RV W+GYKV+TS+SE
Sbjct  496  TVVMQSVISDVIHPAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWEGYKVITSASE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLG  258
            AQ Y+P  FIAG SWLSST FPFSLG
Sbjct  556  AQAYSPGRFIAGGSWLSSTGFPFSLG  581



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPG GQKNM+TAQGR DPNQNTGIVIQK RI ATSDLK VQKNFPT+LGRPWKEYSR
Sbjct  446  HARRPGPGQKNMVTAQGRKDPNQNTGIVIQKSRIGATSDLKSVQKNFPTYLGRPWKEYSR  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ +I+DVI P GWHEW G FAL+TL Y EY+NTGAGAGTS RV WKG+KV+TS++E
Sbjct  506  TVIMQCSIADVISPTGWHEWNGDFALDTLFYGEYENTGAGAGTSGRVKWKGFKVITSATE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP+ FIAG+SWLSST FPF+LGL
Sbjct  566  AQDYTPNKFIAGNSWLSSTGFPFALGL  592



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI ATSDL+  + +F TFLGRPWKEYSR
Sbjct  427  HARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTFLGRPWKEYSR  486

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+IDP GWHEW+GTFALNTL Y EY NTGAGAGTSKRVTWKG+KV+TS++E
Sbjct  487  TVIMQSSITDIIDPVGWHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWKGFKVITSTTE  546

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP  FIAG SWLSST FPF+LGL
Sbjct  547  AQAYTPGXFIAGGSWLSSTGFPFALGL  573



>dbj|BAD94011.1| pectin methylesterase like protein [Arabidopsis thaliana]
Length=244

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  98   HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQ  157

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  158  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAE  217

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  218  AQKYTAGQFIGGGGWLSSTGFPFSLGL  244



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score =   257 bits (656),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT+DL+ V+KNF T+LGRPWKEYSR
Sbjct  452  HARLPSSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATNDLESVKKNFKTYLGRPWKEYSR  511

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVIDP GWHEW+G F L+TL YREYQNTG GAGTS RVTWKGYKV+T ++E
Sbjct  512  TVIMQSSISDVIDPIGWHEWSGNFGLSTLVYREYQNTGPGAGTSNRVTWKGYKVITDTAE  571

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YTP +FI GSSWL ST FPFSLGL
Sbjct  572  AREYTPGSFIGGSSWLGSTGFPFSLGL  598



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQKNM+TAQGR DPNQNTGIVIQK RI AT DL+ V+K+FPTFLGRPWK+YSR
Sbjct  434  HARRPNPGQKNMVTAQGRVDPNQNTGIVIQKSRIGATKDLESVKKSFPTFLGRPWKQYSR  493

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVIDPAGWH W G FALNTL Y EYQNTG GA TS+RVTWKG+KV+TS++E
Sbjct  494  TVIMQSSISDVIDPAGWHVWDGNFALNTLFYGEYQNTGPGAATSRRVTWKGFKVITSAAE  553

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ++TP+NFIAGSSWL ST FPFSLGL
Sbjct  554  AQSFTPANFIAGSSWLPSTGFPFSLGL  580



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  220  HARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKEYSR  279

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ++ISDVI+PAGW+ W G FAL+TL Y EYQNTGAGA TSKRV WKG+KV+TS+SE
Sbjct  280  TVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFKVITSASE  339

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  +FI GSSWL ST FPFSLGL
Sbjct  340  AQAFTAGSFIGGSSWLPSTGFPFSLGL  366



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPG GQKNM+TAQGRTDPNQNTGIVI K RI ATSDLK VQKNFPT+LGRPWKEYSR
Sbjct  447  HARRPGPGQKNMVTAQGRTDPNQNTGIVIHKSRIGATSDLKSVQKNFPTYLGRPWKEYSR  506

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ +I+DVI P GWHEW G FAL+TL Y EY+NTGAGAGTS+RV WKG+KV+TS++E
Sbjct  507  TVIMQCSIADVISPTGWHEWNGNFALDTLFYGEYENTGAGAGTSERVKWKGFKVITSATE  566

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YTP+ FIAG+SWLSST FP +LGL
Sbjct  567  AQDYTPNKFIAGNSWLSSTGFPIALGL  593



>gb|AAL24278.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
Length=388

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  242  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQ  301

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  302  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAE  361

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  362  AQKYTAGQFIGGGGWLSSTGFPFSLGL  388



>dbj|BAD95369.1| pectin methylesterase like protein [Arabidopsis thaliana]
Length=381

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  235  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQ  294

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  295  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAE  354

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  355  AQKYTAGQFIGGGGWLSSTGFPFSLGL  381



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL PV+ +FPTFLGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLLPVKGSFPTFLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  506  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWRGFKVITAAAE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  566  AQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RVTWKG+KV+T+++E
Sbjct  506  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVTWKGFKVITAAAE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  566  AQPYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|XP_010543030.1| PREDICTED: pectinesterase 2-like [Tarenaya hassleriana]
Length=529

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYSR
Sbjct  383  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQAVKGSFPTYLGRPWKEYSR  442

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI P GWHEW G FAL+TLTY EY NTGAGAGT+ RVTWKG+KV+TS++E
Sbjct  443  TVVMQSEISDVIRPEGWHEWNGNFALDTLTYGEYANTGAGAGTANRVTWKGFKVITSATE  502

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FI G SWLSST FPFSLGL
Sbjct  503  AQEFTAGQFIGGGSWLSSTGFPFSLGL  529



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  438  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+I PAGWHEW G FALNTL Y E+QN+GAGAGTS RV WKG++V+TS++E
Sbjct  498  TVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  558  AQAFTPGSFIAGSSWLGSTGFPFSLGL  584



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  438  HARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+I PAGWHEW G FALNTL Y E+QN+GAGAGTS RV WKG++V+TS++E
Sbjct  498  TVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  558  AQAFTPGSFIAGSSWLGSTGFPFSLGL  584



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR DPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  438  HARKPNSGQKNMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI PAGWHEW G FALNTL Y E+QN GAGAGTS RV WKG++V+TS++E
Sbjct  498  TVIMQSSITDVIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  558  AQAFTPGSFIAGSSWLGSTGFPFSLGL  584



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P  GQKNM+TAQGR DPNQNTGIVIQKCRIA T+DL+ V+ +FPT+LGRPWKEYSR
Sbjct  441  HARKPNPGQKNMVTAQGRIDPNQNTGIVIQKCRIAETNDLRSVKSSFPTYLGRPWKEYSR  500

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVIDP GWHEW+GTFALNTL Y EYQN GAGAGT+KRV WKG+KV+TS++E
Sbjct  501  TVIMQSSISDVIDPVGWHEWSGTFALNTLYYGEYQNIGAGAGTTKRVNWKGFKVITSATE  560

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  NFI G+SWLSST FPFSL L
Sbjct  561  AQGFTAGNFIGGASWLSSTGFPFSLTL  587



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR+DPNQNTGIVIQK RI ATSDL+PVQK+FPTFLGRPWKEYSR
Sbjct  449  HARKPNSGQKNMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTFLGRPWKEYSR  508

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ TISDVIDP GWHEW+G+FALNTL Y EYQNTGAGA T  RVTWKG++V+ S++E
Sbjct  509  TVIMQCTISDVIDPKGWHEWSGSFALNTLFYGEYQNTGAGASTGGRVTWKGFRVIRSATE  568

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+++T   FI G SWLSST FPFSLGL
Sbjct  569  AESFTAGKFIGGGSWLSSTGFPFSLGL  595



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM TAQGRTDPNQNTGIVIQKCR+ ATSDL+PVQ +FPT+LGRPWKEYSR
Sbjct  448  HARRPNSGQKNMFTAQGRTDPNQNTGIVIQKCRLGATSDLRPVQSSFPTYLGRPWKEYSR  507

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DV+  AGWHEW G FAL+TL Y E+QNTGAGAGTS RV WKG+KV+TS++E
Sbjct  508  TVIMQSSITDVVHSAGWHEWDGNFALSTLFYGEHQNTGAGAGTSGRVNWKGFKVITSATE  567

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ+YT  +FIAG SWLSST FPFSL L
Sbjct  568  AQSYTAGSFIAGGSWLSSTGFPFSLAL  594



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL PV+ +FPT+LGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLLPVKGSFPTYLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  506  TVVMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWRGFKVITAAAE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  566  AQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>emb|CBI35795.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNMLTAQGRTDPNQNTGIVIQKCRI ATSDL+ V  +F T+LGRPWKEYSR
Sbjct  114  HARRPNSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGRPWKEYSR  173

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ++I++VIDPAGWHEW+G+FAL+TL Y EYQNTGAGAGTSKRVTWKG+KV+TS+SE
Sbjct  174  TVVMQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFKVITSASE  233

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP  FIAGSSWL ST FP+SLGL
Sbjct  234  AQGFTPGTFIAGSSWLGSTGFPYSLGL  260


 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 91/146 (62%), Gaps = 6/146 (4%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+P S Q N +TAQG+ DPNQNTGI IQKC I+A + L       PT+LGRPWK YS T+
Sbjct  530  RQPMSNQFNTITAQGKKDPNQNTGISIQKCSISALNTLTA-----PTYLGRPWKAYSTTI  584

Query  509  IMQSTISDVIDPAGWHEW-TGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            +MQS I   ++P GW EW TG    +T+ Y E+QNTG GA   +RV W G+    +  EA
Sbjct  585  VMQSNIGSFLNPKGWTEWVTGVDPPSTIFYAEFQNTGPGATLDQRVKWAGFMTNITEDEA  644

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
              +T   FI G+SWLS ++  F   L
Sbjct  645  AKFTVGTFIQGASWLSESSVTFDASL  670



>ref|XP_004303758.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=578

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI ATSDL+ V+ +F T+LGRPWKEYSR
Sbjct  432  HARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSR  491

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+IDPAGW+EW+GTFAL+TL Y EY NTGAGA TS RVTWKGYKV+TS++E
Sbjct  492  TVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATE  551

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP NFIAG SWLS+T FPF+LGL
Sbjct  552  AQAFTPGNFIAGGSWLSATGFPFTLGL  578



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  426  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQ  485

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFAL+TLTYREY NTGAGAGT+ RVTWKG+KV+T+++E
Sbjct  486  TVIMQSAISDVIRPEGWSEWTGTFALSTLTYREYANTGAGAGTANRVTWKGFKVITAAAE  545

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  546  AQPYTAGQFIGGGGWLSSTGFPFSLGL  572



>gb|AJH66132.1| pectin methylesterase [Malus domestica]
Length=585

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+  + +F TFLGRPWKEYSR
Sbjct  439  HARKPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQASKSSFKTFLGRPWKEYSR  498

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+IDPAGWHEW+GTFAL+TL Y EY NTGAGAGT+ RVTWKG+KV+TS +E
Sbjct  499  TVIMQSSITDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTANRVTWKGFKVITSPTE  558

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YTP NFIAG SWLSST FPFSL L
Sbjct  559  AEAYTPGNFIAGGSWLSSTGFPFSLAL  585



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI ATSDL+  + +F TFLGRPWKEYSR
Sbjct  439  HARKPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQASKSSFKTFLGRPWKEYSR  498

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+D+IDPAGWHEW+GTFAL+TL Y EY NTGAGAGT+ RVTWKG+KV+TS +E
Sbjct  499  TVIMQSSITDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTANRVTWKGFKVITSPTE  558

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YTP NFIAG SWLSST FPFSL L
Sbjct  559  AEAYTPGNFIAGGSWLSSTGFPFSLAL  585



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYSR
Sbjct  441  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSR  500

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI P GWHEWTG FALNTLTYREY N GAGAGT+ RV W+G+KV+TS++E
Sbjct  501  TVVMQSDISDVIRPEGWHEWTGNFALNTLTYREYANRGAGAGTANRVKWRGFKVITSATE  560

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FI G  WLSST FPFSLGL
Sbjct  561  AQAFTAGRFIGGGGWLSSTGFPFSLGL  587



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDLKPVQ +FPT+LGRPWKEYSR
Sbjct  432  HARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKEYSR  491

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ++ISDVI+PAGW+ W G FAL+TL Y EYQNTGAGA TSKRV WKG+KV+TS+SE
Sbjct  492  TVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFKVITSASE  551

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  +FI GSSWL ST FPFSLGL
Sbjct  552  AQAFTAGSFIGGSSWLPSTGFPFSLGL  578



>ref|XP_004172115.1| PREDICTED: pectinesterase 3-like, partial [Cucumis sativus]
Length=592

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR+DPNQNTGIVIQK RI ATSDL+PVQK+FPTFLGRPWKEYSR
Sbjct  446  HARKPNSGQKNMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTFLGRPWKEYSR  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ TISDVIDP GWHEW+G+FALNTL Y EYQNTGAGA T  RVTWKG++V+ S++E
Sbjct  506  TVIMQCTISDVIDPKGWHEWSGSFALNTLFYGEYQNTGAGASTGGRVTWKGFRVIRSATE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+++T   FI G SWLSST FPFSLGL
Sbjct  566  AESFTAGKFIGGGSWLSSTGFPFSLGL  592



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  506  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  566  AQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  506  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  566  AQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNMLTAQGR DPNQNTGIVIQ CRIAATSDL+ V+ +FPT+LGRPWKEYSR
Sbjct  434  HARRPNSGQKNMLTAQGRDDPNQNTGIVIQNCRIAATSDLQAVKSSFPTYLGRPWKEYSR  493

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQSTISDVI PAGWHEW+G FAL TL Y EYQNTG GA T+ RV+WKGYKV+TS++E
Sbjct  494  TVIMQSTISDVIHPAGWHEWSGNFALTTLYYAEYQNTGPGAATANRVSWKGYKVITSATE  553

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T SNFIAG SWL ST FPFS GL
Sbjct  554  ALRFTVSNFIAGGSWLGSTGFPFSSGL  580



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  477  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQAVKGSFPTYLGRPWKEYSQ  536

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W+G+KV+T+++E
Sbjct  537  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWRGFKVITAAAE  596

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT S FI G  WLSST FPF+LGL
Sbjct  597  AQKYTASQFIGGGGWLSSTGFPFTLGL  623



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL  V+ +FPTFLGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLLSVKSSFPTFLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT+ RV WKG+KV+T+++E
Sbjct  506  TVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANRGAGAGTANRVKWKGFKVITAAAE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL+ST FPFSLGL
Sbjct  566  AQRYTAGQFIGGGGWLASTGFPFSLGL  592



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  444  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQ  503

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT+ RV W G+KV+T+++E
Sbjct  504  TVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWGGFKVITAAAE  563

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  564  AQKYTAGQFIGGGGWLSSTGFPFSLGL  590



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+T
Sbjct  447  ARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQT  506

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS ISDVI P GW EWTGTFALNTLTYREY NTG GAGT+ RVTWKG+KV+T+++EA
Sbjct  507  VIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGTGAGTANRVTWKGFKVITAAAEA  566

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q YT   FI G  WLSST FPFSLGL
Sbjct  567  QPYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQRVRSHFPTYLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT++RV W+G+KV+T++SE
Sbjct  506  TVIMQSDISDVIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSLGL
Sbjct  566  AQRYTAGQFIGGGGWLRSTGFPFSLGL  592



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  447  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQ  506

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT+ RV W+G+KV+T+++E
Sbjct  507  TVVMQSDISDVIRPEGWAEWTGTFALNTLTYREYANRGAGAGTANRVKWRGFKVITAATE  566

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WLSST FPFSLGL
Sbjct  567  AQRYTAGQFIGGGGWLSSTGFPFSLGL  593



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP +GQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDL+PVQ +FPT+LGRPWKEYSR
Sbjct  421  HARRPNAGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSR  480

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            T++MQ+ IS+VI+PAGW+EW G FALNTL Y EYQNTGAGAGTS RVTW+G++V+TS++E
Sbjct  481  TIVMQTDISNVINPAGWYEWNGNFALNTLFYAEYQNTGAGAGTSNRVTWRGFRVLTSAAE  540

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FIAG +WL +T FPFSLGL
Sbjct  541  AQPFTAGRFIAGGNWLGATGFPFSLGL  567



>ref|XP_011078160.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=567

 Score =   248 bits (634),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP +GQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDL+PVQ +FPT+LGRPWKEYSR
Sbjct  421  HARRPNAGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSR  480

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            T++MQ+ IS+VI+PAGW+EW G FALNTL Y EYQNTGAGAGTS RVTW+G++V+TS++E
Sbjct  481  TIVMQTDISNVINPAGWYEWNGNFALNTLFYAEYQNTGAGAGTSNRVTWRGFRVLTSAAE  540

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FIAG +WL +T FPFSLGL
Sbjct  541  AQPFTAGRFIAGGNWLGATGFPFSLGL  567



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score =   248 bits (634),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+LGRPWK YSR
Sbjct  437  HARRPNPGQKNMVTAQGRTDPNQNTGIVIQKCRIGATQDLQAVKSSFPTYLGRPWKLYSR  496

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ+ I+DVI+PAGW EW G FAL+TLTYREYQNTGAG+ T+ RV WKG+KVMTS++E
Sbjct  497  TVIMQTDINDVINPAGWFEWDGNFALDTLTYREYQNTGAGSDTANRVNWKGFKVMTSATE  556

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT  NFIAG +WLS+T FPFSLGL
Sbjct  557  AQPYTAGNFIAGGNWLSATGFPFSLGL  583



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKN++TAQGRTDPNQNTGI+IQKCRI ATSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  410  HARRPNSGQKNIVTAQGRTDPNQNTGIIIQKCRIGATSDLQRVRSHFPTYLGRPWKEYSQ  469

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT++RV W+G+KV+T++SE
Sbjct  470  TVIMQSDISDVIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASE  529

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSLGL
Sbjct  530  AQRYTAGQFIGGGGWLRSTGFPFSLGL  556



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSDL+ V+  FPT+LGRPWKEYS+
Sbjct  424  HARQPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQRVRSYFPTYLGRPWKEYSQ  483

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT++RV W+G+KV+T++SE
Sbjct  484  TVIMQSDISDVIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASE  543

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSLGL
Sbjct  544  AQRYTAGQFIGGRGWLRSTGFPFSLGL  570



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR+DPNQNTGIVIQK RI ATSDL+PVQK+FPTFLGRPWKEYSR
Sbjct  452  HARKPNSGQKNMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTFLGRPWKEYSR  511

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ +ISDVIDP GWHEW+G+FALNTL Y EYQNTG GA T  RVTWKG++V+ S++E
Sbjct  512  TVIMQCSISDVIDPKGWHEWSGSFALNTLFYGEYQNTGPGASTGGRVTWKGFRVIRSATE  571

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ +T   FI G SWL ST FPFSLGL
Sbjct  572  AEGFTAGKFIGGGSWLRSTGFPFSLGL  598



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDL  V+ +F ++LGRPWK+YSR
Sbjct  427  HARRPNPGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFASYLGRPWKQYSR  486

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISD+I PAGW EW G FAL+TLTYRE+QNTGAGAGTS RVTWKGYKV+ S +E
Sbjct  487  TVIMQSNISDIIHPAGWFEWNGPFALDTLTYREHQNTGAGAGTSNRVTWKGYKVIASVTE  546

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT  NFIAG SWL++T FPFSLGL
Sbjct  547  AQGYTAGNFIAGGSWLAATGFPFSLGL  573



>ref|XP_007135363.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
 gb|ESW07357.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
Length=1192

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGR DPNQNTGIVIQKCRI ATSDL+ V+K+F T+LGRPWKEYSR
Sbjct  465  HARRPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATSDLESVKKSFKTYLGRPWKEYSR  524

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVIDP GWHEW+G FAL+TL YREYQNTG GAGTS RV+WKG++V+T + E
Sbjct  525  TVIMQSSISDVIDPVGWHEWSGNFALSTLVYREYQNTGPGAGTSSRVSWKGFQVITDAGE  584

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ +TP +FI GSSWL ST FPFSLG 
Sbjct  585  ARAFTPGSFIGGSSWLGSTGFPFSLGF  611


 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = -3

Query  689   RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNF--PTFLGRPWKEYSR  516
             R+P   Q N +TAQG+ DPNQNTGI+IQK      S + P   N   PT+LGRPWK++S 
Sbjct  1051  RQPLPNQFNTITAQGKKDPNQNTGIIIQK------STITPFGNNLTAPTYLGRPWKDFST  1104

Query  515   TVIMQSTISDVIDPAGWHEWTGTFAL-NTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSS  339
             TVIMQS I  +++P GW  W        T+ Y EYQN+G GA  S+RV W GYK   +  
Sbjct  1105  TVIMQSDIGALLNPVGWMSWVPNVEPPTTIFYAEYQNSGPGADVSQRVKWAGYKPTITDR  1164

Query  338   EAQTYTPSNFIAGSSWLSSTTFPFS  264
              A+ +T  +FI G  WL +    F 
Sbjct  1165  NAEEFTVQSFIQGPEWLPNAAVQFD  1189



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQKNM+TAQGR DPNQNTGI+IQKCRI ATSDLKPV+++FPT+LGRPWKEYSR
Sbjct  430  HARRPNRGQKNMVTAQGRDDPNQNTGIIIQKCRIGATSDLKPVKRSFPTYLGRPWKEYSR  489

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS I+DVI P GWH W G FALNTL Y EY+NTGAGA T+KRV WKGYKV+TS++ 
Sbjct  490  TVIMQSFITDVIHPEGWHAWNGNFALNTLYYGEYRNTGAGAATAKRVKWKGYKVITSATV  549

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  NFI G  WL ST FPFS GL
Sbjct  550  AQQFTVKNFILGDHWLGSTGFPFSAGL  576



>ref|XP_004144447.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
Length=556

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ+NM+TAQGRTDPNQNTGIVIQKCRI  TSDL+PV  NFPTFLGRPW+ YSR
Sbjct  410  HARRPNPGQRNMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTFLGRPWQRYSR  469

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ++IS+VIDPAGWH W G FAL+TL Y EYQN+GAGA TS+RV WKG++V+T ++E
Sbjct  470  TVVMQTSISNVIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVKWKGFRVLTRAAE  529

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ +T  NFI G +WLSST FPFSLGL
Sbjct  530  AEAFTAGNFIGGGTWLSSTGFPFSLGL  556



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ+NM+TAQGRTDPNQNTGIVIQKCRI  TSDL+PV  NFPTFLGRPW+ YSR
Sbjct  413  HARRPNPGQRNMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTFLGRPWQRYSR  472

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ++IS+VIDPAGWH W G FAL+TL Y EYQN+GAGA TS+RV WKG++V+T ++E
Sbjct  473  TVVMQTSISNVIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVRWKGFRVLTRAAE  532

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ +T  NFI G +WLSST FPFSLGL
Sbjct  533  AEAFTAGNFIGGGTWLSSTGFPFSLGL  559



>ref|XP_004168887.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ+NM+TAQGRTDPNQNTGIVIQKCRI  TSDL+PV  NFPTFLGRPW+ YSR
Sbjct  415  HARRPNPGQRNMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTFLGRPWQRYSR  474

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ++IS+VIDPAGWH W G FAL+TL Y EYQN+GAGA TS+RV WKG++V+T ++E
Sbjct  475  TVVMQTSISNVIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVKWKGFRVLTRAAE  534

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ +T  NFI G +WLSST FPFSLGL
Sbjct  535  AEAFTAGNFIGGGTWLSSTGFPFSLGL  561



>gb|EYU29496.1| hypothetical protein MIMGU_mgv1a003055mg [Erythranthe guttata]
Length=611

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDL+PVQ +FPT+LGRPWKEYSR
Sbjct  465  HARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSR  524

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS IS+VI+PAGW  W G FALNTL Y EYQNTGAGAGT  RVTW+G++V+TS+S+
Sbjct  525  TVVMQSEISNVINPAGWFMWDGNFALNTLFYAEYQNTGAGAGTGSRVTWRGFRVLTSASQ  584

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NFI G +WLS+T FPFSLGL
Sbjct  585  ATPFTAGNFIGGGNWLSATGFPFSLGL  611



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARRP SGQKNM+TAQGR DPNQNTGI I KCRI+A SDL PV+ +FPT+LGRPWKEYSRT
Sbjct  419  ARRPNSGQKNMVTAQGREDPNQNTGISIHKCRISADSDLAPVKSSFPTYLGRPWKEYSRT  478

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQSTISDVI+PAGWHEW G FALNTL Y EYQNTGAGAGTS RV WKGYKV+TS+SEA
Sbjct  479  VIMQSTISDVINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKGYKVITSASEA  538

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            + +T  +FI G SWL ST FPF+ G 
Sbjct  539  KQFTVGDFINGGSWLGSTGFPFTAGF  564



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   QKNMLTAQGRTDPN+NTGIVIQ CRI AT DL+ V+ +FPT+LGRPWK YSR
Sbjct  437  HARRPNPKQKNMLTAQGRTDPNENTGIVIQNCRIGATKDLEEVKSSFPTYLGRPWKLYSR  496

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            T++MQ+ ISD+I PAGW+EW G FAL+TLTYREYQNTG GA T+ RV WKG+KVMTS+SE
Sbjct  497  TIVMQTYISDIIHPAGWYEWDGNFALDTLTYREYQNTGEGANTANRVNWKGFKVMTSASE  556

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YT  NFIAGSSWL ST FP+SLGL
Sbjct  557  ARPYTAENFIAGSSWLPSTGFPYSLGL  583



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQKNM+TAQGR DPNQNTGIVIQKCRI AT+DL PVQ +FPT+LGRPWKEYSR
Sbjct  347  HARRPNPGQKNMVTAQGRDDPNQNTGIVIQKCRIGATADLVPVQSSFPTYLGRPWKEYSR  406

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ+ IS+VI+PAGW EW G FALNTL Y EY+NTGAGAGT+ RVTWKG++V+ S +E
Sbjct  407  TVVMQTQISNVINPAGWFEWDGNFALNTLFYAEYKNTGAGAGTANRVTWKGFRVLKSDAE  466

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FI+G SWL++T FPF+LGL
Sbjct  467  AQPFTAGRFISGGSWLAATGFPFTLGL  493



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPG GQKNM+TAQGRTDPNQNTGIVIQ CRI ATSDL  V+ +FPT+LGRPWKEYS 
Sbjct  445  HARRPGPGQKNMVTAQGRTDPNQNTGIVIQNCRIGATSDLLSVKSSFPTYLGRPWKEYSH  504

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EW+GTFALNTLTYREY NTGAGAGT  RV WK +KV+T ++E
Sbjct  505  TVIMQSDISDVIRPEGWFEWSGTFALNTLTYREYANTGAGAGTGDRVKWKDFKVITDAAE  564

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YT   FI G  WL+ST FPFSLGL
Sbjct  565  AEPYTAGQFIGGGGWLASTGFPFSLGL  591



>emb|CDY02461.1| BnaA08g00680D [Brassica napus]
Length=336

 Score =   234 bits (597),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI  TSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  190  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGVTSDLQSVKGSFPTYLGRPWKEYSQ  249

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT++RV W+G+KV+T++SE
Sbjct  250  TVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASE  309

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSLGL
Sbjct  310  AQRYTAGQFIGGGGWLGSTGFPFSLGL  336



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI ATSDL+PV+ +FPT+LGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGATSDLQPVKGSFPTYLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT++RV W+G+KV+T++SE
Sbjct  506  TVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSLGL
Sbjct  566  AQRYTAGQFIGGGGWLGSTGFPFSLGL  592



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI ATSDL+PV+ +FPT+LGRPWKEYS+
Sbjct  412  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGATSDLQPVKGSFPTYLGRPWKEYSQ  471

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT++RV W+G+KV+T++SE
Sbjct  472  TVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASE  531

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSLGL
Sbjct  532  AQRYTAGQFIGGGGWLGSTGFPFSLGL  558



>emb|CAB57457.2| pectin methylesterase [Nicotiana tabacum]
Length=266

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRPGSGQKNM+TAQGRTDPNQNTG+VIQ CRI ATSDL+PVQK+FPT+LGRPWKEYSR
Sbjct  139  HARRPGSGQKNMVTAQGRTDPNQNTGVVIQNCRIGATSDLRPVQKSFPTYLGRPWKEYSR  198

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGTS RV W+G+KV+TS++E
Sbjct  199  TVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWRGFKVITSATE  258

Query  335  AQTYTP  318
            AQ YTP
Sbjct  259  AQAYTP  264



>ref|XP_011069392.1| PREDICTED: pectinesterase-like, partial [Sesamum indicum]
Length=398

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             ARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI ATSDLKPVQ +FPT+LGRPWK+YSR
Sbjct  252  QARRPNPRQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKKYSR  311

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            T++MQ+ IS+VI+PAGW+EW G FALNTL Y EYQN GAGA TS RVTW+G++V+TS++E
Sbjct  312  TIVMQTDISNVINPAGWYEWDGNFALNTLFYAEYQNRGAGARTSNRVTWRGFRVLTSAAE  371

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FIAG +WL +T FPFSLGL
Sbjct  372  AQPFTAGRFIAGGNWLGATGFPFSLGL  398



>ref|XP_006452919.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
 gb|ESR66159.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
Length=594

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI ATSDL  V+ +F T+LGRPWK YSR
Sbjct  448  HARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSR  507

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI+PAGW+EW+G FAL+TL Y EYQNTGAGA TS RV W  +KV+TS++E
Sbjct  508  TVVMQSDISDVINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAE  567

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQTYT +NFIAGS+WL ST FPFSLGL
Sbjct  568  AQTYTAANFIAGSTWLGSTGFPFSLGL  594



>ref|XP_002516188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46190.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=541

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   QKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+ +F ++LGRPWK YSR
Sbjct  395  HARRPNPSQKNMVTAQGRDDPNQNTGIVIQKCRIGATQDLEAVKDSFQSYLGRPWKLYSR  454

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ+ ISD+I+PAGW EW G FAL+TLTYREYQNTG GA T+ RVTWKGYKVMTS+SE
Sbjct  455  TVVMQTQISDIINPAGWFEWDGNFALDTLTYREYQNTGPGANTANRVTWKGYKVMTSASE  514

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  YT  NFI+G++WL +T FP+SLGL
Sbjct  515  ALPYTAENFISGANWLPATGFPYSLGL  541



>gb|KDO36004.1| hypothetical protein CISIN_1g029714mg [Citrus sinensis]
Length=136

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -3

Query  662  MLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTVIMQSTISDV  483
            M   QGR DPNQNTGIVIQK RI ATSDLKPVQ +FPT+LGRPWKEYSRTVIMQS+I+DV
Sbjct  1    MHETQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDV  60

Query  482  IDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQTYTPSNFIA  303
            I PAGWHEW G FALNTL Y E+QN GAGAGTS RV WKG++V+TS++EAQ +TP +FIA
Sbjct  61   IHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIA  120

Query  302  GSSWLSSTTFPFSLGL  255
            GSSWL ST FPFSLGL
Sbjct  121  GSSWLGSTGFPFSLGL  136



>gb|KDO73733.1| hypothetical protein CISIN_1g008261mg [Citrus sinensis]
Length=572

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI ATSDL  V+ +F T+LGRPWK YSR
Sbjct  426  HARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSR  485

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI+PAGW+EW+G FAL+TL Y EYQNTGAGA TS RV W  +KV+T+++E
Sbjct  486  TVVMQSDISDVINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITNAAE  545

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQTYT +NFIAGS+WL ST FPFSLGL
Sbjct  546  AQTYTAANFIAGSTWLGSTGFPFSLGL  572



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP SGQKNM+TAQGR+DPNQNTGIVIQ CRI  TSDL  V+  FPT+LGRPWKEYSR
Sbjct  436  NARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N G GAGT+ RV WKGYKV+TS +E
Sbjct  496  TVIMQSDISDVIRPEGWHEWSGSFALDTLTYREYLNRGGGAGTANRVKWKGYKVITSDTE  555

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FI G  WL+ST FPFSL L
Sbjct  556  AQPFTAGQFIGGGGWLASTGFPFSLSL  582



>ref|XP_010029511.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=577

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P  GQKNM+TAQGR DPNQNTGIVIQKCRIA T+DL+ V+ +FPT+LGRPWKEYSR
Sbjct  432  HARKPDPGQKNMVTAQGRIDPNQNTGIVIQKCRIAETNDLQSVKSSFPTYLGRPWKEYSR  491

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVID  GWH+W GTFAL+TL Y EYQNTG GAG SKRV W GYKV+T ++E
Sbjct  492  TVIMQSSISDVIDEVGWHDWNGTFALDTLYYGEYQNTGTGAGISKRVNWTGYKVIT-ATE  550

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T +NFI+G SWLSST  PFSL L
Sbjct  551  AQGFTAANFISGGSWLSSTGVPFSLTL  577



>ref|NP_001275846.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84485.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84486.1| putative thermostable pectinesterase [Citrus sinensis]
Length=631

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI ATSDL  V+ +F T+LGRPWK YSR
Sbjct  485  HARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSR  544

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI+PAGW+EW+G FAL+TL Y EYQNTGAGA TS RV W  +KV+TS++E
Sbjct  545  TVVMQSDISDVINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAE  604

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQTYT +NFIAGS+WL ST FPFSLGL
Sbjct  605  AQTYTAANFIAGSTWLGSTGFPFSLGL  631



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP SGQKNM+TAQGR+DPNQNTGIVIQ CRI  TSDL  V+  FPT+LGRPWKEYSR
Sbjct  441  NARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTYLGRPWKEYSR  500

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N G GAGT+ RV WKGYKV+TS +E
Sbjct  501  TVIMQSDISDVIRPEGWHEWSGSFALDTLTYREYLNRGGGAGTANRVKWKGYKVITSDTE  560

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FI G  WL+ST FPFSL L
Sbjct  561  AQPFTAGQFIGGGGWLASTGFPFSLSL  587



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL+  + +F ++LGRPWK YSR
Sbjct  443  HARRPNPGQRNMVTAQGREDPNQNTGIVIQKCRIGATQDLEAAKNSFQSYLGRPWKLYSR  502

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISD+I PAGW  W GTFAL+TLTYREYQNTG GA T+ RVTW GYKVMTS+SE
Sbjct  503  TVIMQSQISDIIHPAGWFMWDGTFALDTLTYREYQNTGPGANTANRVTWMGYKVMTSASE  562

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  YT  NFI+G +WLSST FPFSLGL
Sbjct  563  ALPYTAGNFISGGNWLSSTGFPFSLGL  589



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score =   236 bits (601),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI  TSDL+ V+ +FPT+LGRPWKEYS+
Sbjct  446  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGVTSDLQSVKGSFPTYLGRPWKEYSQ  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT++RV W+G+KV+T++SE
Sbjct  506  TVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITTASE  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSLGL
Sbjct  566  AQRYTAGQFIGGGGWLGSTGFPFSLGL  592



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQKNMLTA GRTDPNQNTGIVIQK RIAATSDL+ V+ +F T+LGRPWK Y+R
Sbjct  409  HARRPNPGQKNMLTAHGRTDPNQNTGIVIQKSRIAATSDLQSVKGSFGTYLGRPWKAYAR  468

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQSTISDV+ PAGWHEW G FALNTL Y E++N+GAG+G + RV WKG+KV++S +E
Sbjct  469  TVIMQSTISDVVHPAGWHEWDGNFALNTLFYGEHKNSGAGSGVNGRVKWKGHKVISSDAE  528

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +TP  FIAG SWL STTFPF+LGL
Sbjct  529  AAGFTPGRFIAGGSWLGSTTFPFTLGL  555



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGR+DPN+NTGIVIQKCRI ATSDL+ V+ +F T+LGRPWK +SR
Sbjct  421  HARRPNPNQRNMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFETYLGRPWKTHSR  480

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISD+I PAGW  W   FAL+TLTYREYQNTG GA TS RVTWKGY V+T+ SE
Sbjct  481  TVIMQSVISDIIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWKGYSVITNISE  540

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQTYT  NFI G++WLS+T FPFSL L
Sbjct  541  AQTYTARNFIGGANWLSATGFPFSLDL  567



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGR+DPN+NTGIVIQKCRI ATSDL+ V+ +F T+LGRPWK +SR
Sbjct  421  HARRPNPNQRNMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFETYLGRPWKTHSR  480

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISD+I PAGW  W   FAL+TLTYREYQNTG GA TS RVTWKGY V+T+ SE
Sbjct  481  TVIMQSVISDIIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWKGYSVITNISE  540

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQTYT  NFI G++WLS+T FPFSL L
Sbjct  541  AQTYTARNFIGGANWLSATGFPFSLDL  567



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP  GQKNM+TAQGR+DPNQNTGIVIQ CRI  T DL  V++ FPT+LGRPWKEYSR
Sbjct  438  NARRPNPGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTPDLLAVKETFPTYLGRPWKEYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N GAGAGT+ RVTWKG+KV+TS +E
Sbjct  498  TVIMQSAISDVIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWKGFKVITSVTE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL+ST FPF L L
Sbjct  558  AQQYTAGQFIGGGGWLASTGFPFLLSL  584



>gb|KJB54563.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=567

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGR+DPN+NTGIVIQKCRI ATSDL+ V+ +F T+LGRPWK +SR
Sbjct  421  HARRPNPNQRNMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFATYLGRPWKTHSR  480

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISD+I PAGW  W   FAL+TLTYREYQNTG GA TS RVTWKGY V+T+ SE
Sbjct  481  TVIMQSVISDIIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWKGYSVITNISE  540

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQTYT  NFI G++WL++T FPFSL L
Sbjct  541  AQTYTARNFIGGANWLNATGFPFSLDL  567



>ref|XP_011039649.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=548

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  TSDL PV+ NF  +LGRPWKEY+R
Sbjct  402  RARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYAR  461

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGTSKRVTW+GYK++TS++E
Sbjct  462  TVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATE  521

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ++TP NFIAGSSWL STTFPFSL L
Sbjct  522  AQSFTPRNFIAGSSWLKSTTFPFSLDL  548



>ref|XP_011039648.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=548

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  TSDL PV+ NF  +LGRPWKEY+R
Sbjct  402  RARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYAR  461

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGTSKRVTW+GYK++TS++E
Sbjct  462  TVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATE  521

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ++TP NFIAGSSWL STTFPFSL L
Sbjct  522  AQSFTPRNFIAGSSWLKSTTFPFSLDL  548



>ref|XP_006389476.1| hypothetical protein POPTR_0022s002002g, partial [Populus trichocarpa]
 gb|ERP48390.1| hypothetical protein POPTR_0022s002002g, partial [Populus trichocarpa]
Length=255

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +LGRPWKEYSRT
Sbjct  110  ARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSAYLGRPWKEYSRT  169

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGT+ RV WKGYKV+T ++EA
Sbjct  170  VIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTAGRVPWKGYKVITDATEA  229

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T  NFI GSSWL STTFPFSLGL
Sbjct  230  QAFTARNFITGSSWLKSTTFPFSLGL  255



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP  GQKNM+TAQGR+DPNQNTGIVIQ CRI  + DL  V++ FPT+LGRPWKEYSR
Sbjct  448  NARRPNPGQKNMVTAQGRSDPNQNTGIVIQNCRIGGSPDLLAVKETFPTYLGRPWKEYSR  507

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N GAGAGT+ RVTWKG+KV+TS +E
Sbjct  508  TVIMQSAISDVIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWKGFKVITSVTE  567

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL+ST FPF L L
Sbjct  568  AQQYTAGQFIGGGGWLASTGFPFMLSL  594



>gb|KJB70037.1| hypothetical protein B456_011G055100 [Gossypium raimondii]
Length=579

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARRP  GQKNM+TAQGRTD NQNTGIV QKCRI ATSDL+ V+  FPT+LGRPWKEYSRT
Sbjct  434  ARRPHRGQKNMVTAQGRTDRNQNTGIVFQKCRIGATSDLQSVKNKFPTYLGRPWKEYSRT  493

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VI+QS ISDVI PAGWH+W G+FAL TL Y EYQNTGA AGT  RV W G+KV+T+ SEA
Sbjct  494  VILQSDISDVIHPAGWHDWNGSFALKTLFYGEYQNTGASAGTHARVKWDGHKVITNESEA  553

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q+YT   FI+G SWL ST FPFSL L
Sbjct  554  QSYTAGEFISGGSWLYSTGFPFSLDL  579



>ref|XP_011039646.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=548

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  TSDL PV+ NF  +LGRPWKEY+R
Sbjct  402  RARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRGNFSAYLGRPWKEYAR  461

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGTSKRVTW+GYK++TS++E
Sbjct  462  TVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATE  521

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ++TP NFIAGSSWL STTFPFSL L
Sbjct  522  AQSFTPRNFIAGSSWLKSTTFPFSLDL  548



>ref|XP_006382081.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
 gb|ERP59878.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
Length=542

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  TSDL PV+ NF  +LGRPWKEY+R
Sbjct  396  RARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYAR  455

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGTS+RVTW+GYK++TS++E
Sbjct  456  TVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSERVTWEGYKMITSATE  515

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ++TP NFIAGSSWL STTFPFSL L
Sbjct  516  AQSFTPRNFIAGSSWLKSTTFPFSLDL  542



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP S QKNM+TAQGR+DPNQNTGIVIQ CRI ATSDL  V+ +FPT+LGRPWK+YSR
Sbjct  438  NARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCRIGATSDLLAVKGSFPTYLGRPWKQYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N G GAGT+ RV WKG+KV+TS +E
Sbjct  498  TVIMQSDISDVIRPAGWLEWSGSFALDTLTYREYLNRGGGAGTANRVKWKGFKVITSVTE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YT   FI G SWL+ST FPF L L
Sbjct  558  AEQYTAGQFIGGGSWLASTGFPFLLSL  584



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP  GQKNM+TAQGR+DPNQNTGIVIQ CRI  TSDL  V+  FPT+LGRPWKEYSR
Sbjct  440  NARRPNPGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTYLGRPWKEYSR  499

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EW+G+FAL+TLTYREY N G GAGT+ RVTWKG+KV+TS +E
Sbjct  500  TVIMQSDISDVIRPEGWLEWSGSFALDTLTYREYLNRGGGAGTTNRVTWKGFKVITSDTE  559

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FI G  WL+ST FPFSL L
Sbjct  560  AQQFTAGQFIGGGGWLASTGFPFSLSL  586



>ref|XP_006387527.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP46441.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=542

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  TSDL PV+ NF  +LGRPWKEY+R
Sbjct  396  RARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYAR  455

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGTSKRVTW+GYK++TS++E
Sbjct  456  TVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATE  515

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ++TP NFI GSSWL STTFPFSL L
Sbjct  516  AQSFTPRNFIGGSSWLKSTTFPFSLDL  542



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP  GQKNM+TAQGR+DPNQNTGIVI  CRI  T DL  V++ FPT+LGRPWKEYSR
Sbjct  448  NARRPNPGQKNMVTAQGRSDPNQNTGIVIHNCRIGGTPDLLAVKETFPTYLGRPWKEYSR  507

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N GAGAGT+ RVTWKG+KV+TS +E
Sbjct  508  TVIMQSAISDVIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWKGFKVITSITE  567

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL+ST FPF L L
Sbjct  568  AQQYTAGQFIGGGGWLASTGFPFLLSL  594



>ref|XP_002309641.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|EEE93164.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=567

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  TSDL PV+ NF  +LGRPWKEY+RT
Sbjct  422  ARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYART  481

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGTS+RVTW+GYK++TS++EA
Sbjct  482  VIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYKNSGAGAGTSERVTWEGYKMITSATEA  541

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q++TP NFIAGSSWL STTFPFSL L
Sbjct  542  QSFTPRNFIAGSSWLKSTTFPFSLDL  567



>ref|XP_006369081.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
 gb|ERP65650.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
Length=623

 Score =   231 bits (589),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+D NQNTGIVIQK RI ATSDL PV+ NF  +LGRPWKEYSR
Sbjct  477  HARRPNPGQTITITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSR  536

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+ISDVI+PAGW EW G +ALNTL Y EY N+GAGA TS+RV WKGYKV+T+++E
Sbjct  537  TVVMQSSISDVINPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATE  596

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+++TP NFIAGS+WL STTFPFSL L
Sbjct  597  AKSFTPRNFIAGSTWLKSTTFPFSLDL  623



>ref|XP_006372149.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
 gb|ERP49946.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
Length=623

 Score =   231 bits (589),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+D NQNTGIVIQK RI ATSDL PV+ NF  +LGRPWKEYSR
Sbjct  477  HARRPNPGQTITITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSR  536

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+ISDVI+PAGW EW G +ALNTL Y EY N+GAGA TS+RV WKGYKV+T+++E
Sbjct  537  TVVMQSSISDVINPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATE  596

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+++TP NFIAGS+WL STTFPFSL L
Sbjct  597  AKSFTPRNFIAGSTWLKSTTFPFSLDL  623



>ref|XP_006369080.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP65649.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=623

 Score =   231 bits (588),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+D NQNTGIVIQK RI ATSDL PV+ NF  +LGRPWKEYSR
Sbjct  477  HARRPNPGQTITITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSR  536

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+ISDVI+PAGW EW G +ALNTL Y EY N+GAGA TS+RV WKGYKV+T+++E
Sbjct  537  TVVMQSSISDVINPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATE  596

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+++TP NFIAGS+WL STTFPFSL L
Sbjct  597  AKSFTPRNFIAGSTWLKSTTFPFSLDL  623



>ref|XP_006389479.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP48393.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +LGRPWKEYSR
Sbjct  426  HARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSAYLGRPWKEYSR  485

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGTS RV WKGYKV+T ++E
Sbjct  486  TVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTSGRVPWKGYKVITDATE  545

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  NFI GSSWL STTFPFSLGL
Sbjct  546  AQAFTARNFITGSSWLKSTTFPFSLGL  572



>ref|XP_011003715.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=575

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +LGRPWKEYSR
Sbjct  429  HARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATRDLQHARSNFSAYLGRPWKEYSR  488

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW EW G FAL+TL + EY+N+GAGAGTS RV WKGYKV+T ++E
Sbjct  489  TVIMQSSISDVISPAGWREWKGRFALDTLHFAEYENSGAGAGTSGRVPWKGYKVITDATE  548

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  NFI GSSWL STTFPFSLGL
Sbjct  549  AQAFTARNFITGSSWLKSTTFPFSLGL  575



>ref|XP_011048629.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=587

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+DPNQNTGIVIQK RI ATSDL PV+ NF  +LGRPWKEYSR
Sbjct  441  HARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSR  500

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+ISDVI+ AGW EW G +ALNTL Y EY N+GAGA TS+RV WKGYKV+T+++E
Sbjct  501  TVVMQSSISDVINRAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATE  560

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+++TP NFIAG +WL STTFPFSL L
Sbjct  561  AKSFTPRNFIAGGTWLKSTTFPFSLDL  587



>ref|XP_006371892.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
 gb|ERP49689.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
Length=229

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQKNM+TAQGR+DPN+NTGIVIQKCRI AT DL   + +F ++LGRPWK YSR
Sbjct  83   HARRPNPGQKNMVTAQGRSDPNENTGIVIQKCRIGATQDLLAAKSSFRSYLGRPWKLYSR  142

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            T++MQ+ ISD+IDPAGW EW G FAL+TL YREYQNTG GA T+ RV WKG+KV+TS+ E
Sbjct  143  TIVMQTEISDIIDPAGWFEWDGDFALDTLVYREYQNTGPGANTANRVNWKGFKVVTSAIE  202

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
             Q +   NFI G+SWL ST FP+S  L
Sbjct  203  VQPFIARNFIRGASWLPSTGFPYSFDL  229



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQKNM+TAQGR DPN+NTGIVIQKCRI AT DL   + NF ++LGRPWK YSR
Sbjct  427  HARRPNPGQKNMVTAQGRNDPNENTGIVIQKCRIGATQDLLAEKSNFRSYLGRPWKLYSR  486

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            T+IMQ+ ISD+IDPAGW EW G FAL+TL YREYQNTG GA T+ RV WKG+KV+TS++E
Sbjct  487  TIIMQTEISDIIDPAGWFEWDGDFALDTLVYREYQNTGPGANTTIRVNWKGFKVVTSATE  546

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
             Q +T  NF+ G+SWL ST+FP+SL L
Sbjct  547  VQPFTARNFVGGASWLPSTSFPYSLDL  573



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P SGQKNM+TAQGR+DPNQNTGIVIQ  RI  T DL  V+  FPT+LGRPWK+YSR
Sbjct  438  NARKPNSGQKNMVTAQGRSDPNQNTGIVIQNSRIGGTPDLSAVKGTFPTYLGRPWKQYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N GAGAGT+ RV WKG+KV+TS +E
Sbjct  498  TVIMQSAISDVIRPEGWHEWSGSFALDTLTYREYLNRGAGAGTANRVKWKGFKVITSVTE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G+ WL+ST FPF L L
Sbjct  558  AQQYTAGQFIGGAGWLASTGFPFLLSL  584



>ref|XP_011039647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=565

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  TSDL PV+ NF  +LGRPWKEY+RT
Sbjct  420  ARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYART  479

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGTSKRVTW+GYK++TS++EA
Sbjct  480  VIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATEA  539

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q++TP NFI GSSWL STTFPF L L
Sbjct  540  QSFTPRNFIGGSSWLKSTTFPFCLDL  565



>ref|XP_006385198.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP62995.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT+DL+  + NF  +LGRPWKEYSR
Sbjct  426  HARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATADLQHARSNFSAYLGRPWKEYSR  485

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW EW G FALNTL + EY+N+G GAGT+ RV WKGYKV+T ++E
Sbjct  486  TVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGVGAGTAGRVPWKGYKVITDATE  545

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  NFI GSSWL STTFPFSLGL
Sbjct  546  AQAFTARNFITGSSWLKSTTFPFSLGL  572



>emb|CAC18725.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=588

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+DPNQ TGIVIQK RI ATSDL PV+ NF  +LGRPWKE+SR
Sbjct  442  HARRPNPGQTITITAQGRSDPNQKTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEHSR  501

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+ISDVI+ AGW EW G +ALNTL Y EY N+GAGA TS+RVTWKGYKV+T+++E
Sbjct  502  TVVMQSSISDVINRAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVTWKGYKVITATAE  561

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+++TP NFIAGS+WL STTFPFSL L
Sbjct  562  AKSFTPRNFIAGSTWLKSTTFPFSLDL  588



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 119/147 (81%), Gaps = 13/147 (9%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI ATSD              PWKEYSR
Sbjct  418  HARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDW-------------PWKEYSR  464

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS+I+DVIDPAGWHEW G FALNTL Y EYQNTGAGA TS RV W+G+KV+TS++E
Sbjct  465  TVVMQSSITDVIDPAGWHEWNGNFALNTLFYGEYQNTGAGASTSGRVRWRGFKVITSATE  524

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ+YT   FIAG SWLSST FPFSLGL
Sbjct  525  AQSYTAGRFIAGGSWLSSTGFPFSLGL  551



>ref|XP_011047860.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=574

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +LGRPWKEYSR
Sbjct  428  HARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATRDLQHARSNFSAYLGRPWKEYSR  487

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW EW G FAL+TL + EY+N+GAGAGT+ RV WKGYKV+T ++E
Sbjct  488  TVIMQSSISDVISPAGWREWKGRFALDTLHFAEYENSGAGAGTAGRVPWKGYKVITDATE  547

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  NFI GSSWL STTFPFSLGL
Sbjct  548  AQAFTARNFITGSSWLKSTTFPFSLGL  574



>emb|CAC18727.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=536

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +LGRPWKEYSRT
Sbjct  391  ARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSVYLGRPWKEYSRT  450

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGTS RV WKGYKV+T ++EA
Sbjct  451  VIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTSGRVPWKGYKVITDATEA  510

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T  NFI GSSWL STTFPFSLGL
Sbjct  511  QAFTARNFITGSSWLKSTTFPFSLGL  536



>ref|XP_006385197.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
 gb|ERP62994.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
Length=572

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             ARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT+DL+  + NF  +LGRPWKEYSR
Sbjct  426  RARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATADLQHARSNFSAYLGRPWKEYSR  485

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGT+ RV WKGYKV+T ++E
Sbjct  486  TVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTAGRVPWKGYKVITDTTE  545

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T  NFI GSSWL STTFPFSLGL
Sbjct  546  AQAFTARNFITGSSWLKSTTFPFSLGL  572



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL  VQ +  ++LGRPWK YSR
Sbjct  407  HARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATQDLLQVQSSVESYLGRPWKMYSR  466

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ+ IS+VI PAGW  W G FAL TLTYREY NTGAG+GTS RV W GYKV+TS+SE
Sbjct  467  TVIMQTDISNVIRPAGWFMWDGNFALATLTYREYANTGAGSGTSGRVRWGGYKVITSASE  526

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ + P +FI G+SWL +T FPFSL L
Sbjct  527  AQPFAPRSFIGGASWLPATGFPFSLDL  553



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP S QKNM+TAQGR+DPNQNTGIVIQ C+I ATSDL  V+ +F T+LGRPWK+YSR
Sbjct  439  NARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTYLGRPWKQYSR  498

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EW+G FAL+TLTYREY N GAG+GT+ RV WKGY+V+T+ +E
Sbjct  499  TVIMQSDISDVIRPEGWLEWSGDFALDTLTYREYLNRGAGSGTANRVKWKGYQVITNVTE  558

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSL L
Sbjct  559  AQQYTAGQFIGGEGWLGSTGFPFSLSL  585



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P SGQKNM+TAQGR+DPNQNTGIVIQKCRI ATSDL+PVQ +FPT+LGRPWKEYSR
Sbjct  436  HARKPNSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSR  495

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQ+ ISDVI PAGWHEW+G+FAL+TL Y EYQN+GAGAGTSKRV+WKG+KV+TS++E
Sbjct  496  TVVMQTAISDVIHPAGWHEWSGSFALSTLFYGEYQNSGAGAGTSKRVSWKGFKVITSATE  555

Query  335  AQ  330
            AQ
Sbjct  556  AQ  557



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP S QKNM+TAQGR+DPNQNTGIVIQ C+I ATSDL  V+ +F T+LGRPWK+YSR
Sbjct  458  NARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTYLGRPWKQYSR  517

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EW+G FAL+TLTYREY N GAG+GT+ RV WKGY+V+T+ +E
Sbjct  518  TVIMQSDISDVIRPEGWLEWSGDFALDTLTYREYLNRGAGSGTANRVKWKGYQVITNVTE  577

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPFSL L
Sbjct  578  AQQYTAGQFIGGEGWLGSTGFPFSLSL  604



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP SGQKNM+TAQGR+DPNQNTGIVIQ CRI ATSDL  V+ +FPT+LGRPWKEYSR
Sbjct  442  NARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGATSDLLAVKGSFPTYLGRPWKEYSR  501

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N+GAGAGT+ RV WKG++V+TS ++
Sbjct  502  TVIMQSEISDVIRPEGWHEWSGSFALDTLTYREYLNSGAGAGTANRVKWKGFEVITSVTD  561

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPF L L
Sbjct  562  AQQYTAGQFIGGGGWLGSTGFPFLLSL  588



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP S QKNM+TAQGR+DPNQNTGIVIQ C+I ATSDL  V+ +F T+LGRPWK+YSR
Sbjct  439  NARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTYLGRPWKQYSR  498

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDVI P GW EW+G FAL+TLTYREY N GAGAGT+ RV WKGY+V+T+ +E
Sbjct  499  TVIMQSDISDVIRPEGWLEWSGDFALDTLTYREYLNRGAGAGTANRVKWKGYQVITNVTE  558

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ YT   FI G  WL ST FPF L L
Sbjct  559  AQQYTAGQFIGGEGWLGSTGFPFLLSL  585



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            RRP   QKNM+TA GR DPN+ TGIVI + RI A  DL PVQ +F T+LGRPWKEY+RTV
Sbjct  422  RRPNPNQKNMVTASGRDDPNEPTGIVIHRSRITAAPDLAPVQGSFRTYLGRPWKEYARTV  481

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            IM+S ISDVI+P GWHEW+GTFAL+TL Y EY+NTGAGAGT  RV WKGYKV+TS++EA 
Sbjct  482  IMESEISDVIEPEGWHEWSGTFALDTLYYGEYRNTGAGAGTGSRVQWKGYKVITSAAEAA  541

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +TP +FIAGSSWL +T FP+SLGL
Sbjct  542  EFTPGSFIAGSSWLEATGFPYSLGL  566



>emb|CAC18726.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=574

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            ARR   GQ   +TAQGR+DPNQNTGIVIQK RI  T DL+  + NF  FLGRPWKEYSRT
Sbjct  429  ARRANPGQTITITAQGRSDPNQNTGIVIQKSRIGGTPDLQHARSNFSAFLGRPWKEYSRT  488

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS+ISDVI PAGW EW G FAL+TL + EY+N+GAGAGTS RV WKGYKV+T ++EA
Sbjct  489  VIMQSSISDVISPAGWREWKGRFALDTLHFAEYENSGAGAGTSGRVPWKGYKVITDATEA  548

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T  NFI GSSWL STTFPFSLGL
Sbjct  549  QAFTARNFITGSSWLKSTTFPFSLGL  574



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP + Q N+ TAQGRTDPNQNTGI IQKC++AA SDL  VQ +F T+LGRPWK+YSR
Sbjct  80   YARRPLASQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLAAVQTSFRTYLGRPWKQYSR  139

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS +  V+DP GW EW GTFAL+TL Y EYQNTGAGA TS RV WKGY+V++SSSE
Sbjct  140  TVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGAGASTSNRVKWKGYRVISSSSE  199

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A T+T  +FI G  WL+ T+ PFS GL
Sbjct  200  ASTFTVGSFIDGDVWLAGTSIPFSTGL  226



>ref|XP_008800483.1| PREDICTED: pectinesterase 3-like isoform X2 [Phoenix dactylifera]
Length=262

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
              RRP + QKNM+TA GR DPN+ TGI I + RI A  DL+PV+ +F ++LGRPWKEYSR
Sbjct  114  QVRRPNANQKNMVTADGRDDPNEPTGIAIHRSRITAAPDLEPVKSSFRSYLGRPWKEYSR  173

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
             VIM+S ISDVIDPAGWHEW G F L+TL Y EY+NTGAGAGT+ RV WKGY+V+T   E
Sbjct  174  AVIMESEISDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKWKGYRVLTDVQE  233

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ + P N + GS+WL ST FP+SLGL
Sbjct  234  AKQFAPGNLLGGSNWLDSTGFPYSLGL  260



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HAR+P S QKNM+TAQ RTD NQNTGIVIQKCRI  TSDL+  + +F T+LGRPWK+YSR
Sbjct  446  HARKPNSNQKNMITAQSRTDINQNTGIVIQKCRIDGTSDLQATKNSFSTYLGRPWKDYSR  505

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQS ISDV+   GWHEW G +AL TL Y EY+N+G GA TSKRV W+G + ++   +
Sbjct  506  TVIMQSFISDVVHENGWHEWEGEYALKTLHYMEYKNSGPGADTSKRVQWRGVQEISEVDK  565

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +TP NFIAG SWL+STTFP+SLGL
Sbjct  566  AQEFTPGNFIAGGSWLASTTFPYSLGL  592



>ref|XP_010534984.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=567

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGRTDPNQNTGIVIQ CRI AT DL+  + +FPT+LGRPWK +SR
Sbjct  421  HARRPNPEQRNMVTAQGRTDPNQNTGIVIQNCRIGATLDLREAEDDFPTYLGRPWKRFSR  480

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+MQS ISDVI P GWH W G FAL+TL YREY N G GA T  RV WKG++V+T   E
Sbjct  481  TVVMQSDISDVIRPEGWHLWNGNFALDTLIYREYANRGPGANTEFRVNWKGFEVITDPEE  540

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YT   FI G+ WLS T FPF+L L
Sbjct  541  AEEYTADRFIDGADWLSETGFPFNLAL  567



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  686  RPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTVI  507
            RPG+ QKNM+TA GR DP++ TGI I + RI A +DL+PV+ +F ++LGRPWKEYSRT+I
Sbjct  437  RPGANQKNMVTADGREDPDEPTGIAIHRSRITAAADLEPVKSSFRSYLGRPWKEYSRTLI  496

Query  506  MQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQT  327
            M+S I DVIDPAGWHEW G F L+TL Y EY+NTGAGAGT+ RV WKG++V+T + EA+ 
Sbjct  497  MESEIGDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTAGRVKWKGHEVITDAGEAEK  556

Query  326  YTPSNFIAGSSWLSSTTFPFSLGL  255
            +TP NF+ GS+WL ST FP+SLGL
Sbjct  557  FTPGNFLGGSNWLGSTGFPYSLGL  580



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            RRP + QKNM+TA GR DPN+ TGI I + RI A  DL+PV+ +F ++LGRPWKEYSR V
Sbjct  439  RRPNANQKNMVTADGRDDPNEPTGIAIHRSRITAAPDLEPVKSSFRSYLGRPWKEYSRAV  498

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            IM+S ISDVIDPAGWHEW G F L+TL Y EY+NTGAGAGT+ RV WKGY+V+T   EA+
Sbjct  499  IMESEISDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKWKGYRVLTDVQEAK  558

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             + P N + GS+WL ST FP+SLGL
Sbjct  559  QFAPGNLLGGSNWLDSTGFPYSLGL  583



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 1/147 (1%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDL  V+ +F T+LGRPWK YSR
Sbjct  440  HARRPNPGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTYLGRPWKMYSR  499

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ+ ISDVI+PAGW+EW G FAL+TL Y E+ NTG GA T+ RVTWKGY+V+ S+ E
Sbjct  500  TVIMQTAISDVINPAGWYEWNGNFALDTLYYAEHANTGPGASTANRVTWKGYRVI-SAPE  558

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T + FI   SWL  T FP+  GL
Sbjct  559  AQPFTANQFIVAGSWLKPTGFPYYPGL  585



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            RRP   QKNM+TA GR DPN+ TGI I + RIAA  DL+PV+ +F ++LGRPWKE+SRTV
Sbjct  445  RRPNPNQKNMVTADGRDDPNEPTGITIHRSRIAAAPDLEPVKSSFRSYLGRPWKEHSRTV  504

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            IM+S I DVIDPAGWHEW G FAL+TL Y EY+NTGAGAGT+ RV W GY+V+T   EA+
Sbjct  505  IMESDIGDVIDPAGWHEWNGPFALDTLYYGEYKNTGAGAGTAGRVKWNGYRVLTDVREAE  564

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +TP N + GS+WL ST FP+SLGL
Sbjct  565  QFTPGNLLGGSNWLGSTGFPYSLGL  589



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   Q N+ TAQGR DPNQNTGI IQKC++AA SDL  VQ +F T+LGRPWK+YSR
Sbjct  280  YARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSR  339

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  V++PAGW EW+G FAL+TL Y EYQNTG GA TS RV WKGY+V+TS+SE
Sbjct  340  TVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASE  399

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A T+T  NFI G  WL+ T+ PF++GL
Sbjct  400  ASTFTVGNFIDGDVWLAGTSVPFTVGL  426



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+P SGQKNM+TAQGRTDPNQNTG  IQKC I A+SDL PV+ +F +FLGRPWKEYSRTV
Sbjct  183  RKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRTV  242

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            +MQS I D+IDPAGW  W G FAL TL Y EY N GAGAGTSKRV W GY V+TS++EA+
Sbjct  243  VMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYHVITSANEAK  302

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T +  I G  WL ST   ++ GL
Sbjct  303  KFTVAELIQGGVWLKSTGVSYTEGL  327



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   Q N+ TAQGRTDPNQNTGI IQKC++AA SDL  VQ +F T+LGRPWK+YSR
Sbjct  420  YARRPLPNQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLAAVQSSFKTYLGRPWKQYSR  479

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  V++PAGW  W GTFAL+TL Y EYQNTG GAGTS RVTWKGY+V+TS+SE
Sbjct  480  TVFMQSELDSVVNPAGWLAWDGTFALDTLYYGEYQNTGPGAGTSGRVTWKGYRVITSASE  539

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A T+T  +FI G  WL+ T+ PFS GL
Sbjct  540  ASTFTVGSFIDGDVWLAGTSIPFSAGL  566



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI IQKC++AA SDL PVQ NF T+LGRPWK+YSR
Sbjct  93   YARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTYLGRPWKQYSR  152

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ TS+RVTW GY+V+TS++E
Sbjct  153  TVFMQSYLGSLINPAGWLEWDGDFALSTLYYGEYMNLGPGSNTSRRVTWPGYRVITSAAE  212

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FI G  WL +T+ PF+ GL
Sbjct  213  ASNFTVQSFIQGDQWLGATSVPFTSGL  239



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   Q N  TAQGR DPNQNTGI IQKC++AA SDL  VQ +F T+LGRPWK+YSR
Sbjct  260  YARRPLPNQSNAYTAQGREDPNQNTGISIQKCKVAAASDLAAVQSSFKTYLGRPWKQYSR  319

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  V++PAGW EW G FAL+TL Y EYQNTG GA T+ RV WKGY+V+TSSSE
Sbjct  320  TVFMQSQLDSVVNPAGWLEWNGNFALDTLYYGEYQNTGDGASTANRVKWKGYRVITSSSE  379

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A T+T  +FI G  WL+ T+ PFS+GL
Sbjct  380  ASTFTVGSFIDGDVWLAGTSVPFSVGL  406



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 115/147 (78%), Gaps = 1/147 (1%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI ATSDL  V+ +F T+LGRPWK YSR
Sbjct  433  HARRPNPGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTYLGRPWKMYSR  492

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ+ ISDVI+P GW+EW G FAL+TL Y E+ NTG GA T+ RVTWKGY+V+ S+ E
Sbjct  493  TVIMQTEISDVINPTGWYEWDGNFALDTLYYAEHANTGPGASTANRVTWKGYRVI-SAPE  551

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T + FI   SWL  T FP+  GL
Sbjct  552  AQPFTANQFIVAGSWLKPTGFPYYPGL  578



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P +GQKNM+TAQGRTDPNQNTG  IQKC + A+SDL+PV+ +FP++LGRPWKEYSRT
Sbjct  402  ARKPMAGQKNMVTAQGRTDPNQNTGTSIQKCDVIASSDLQPVKGSFPSYLGRPWKEYSRT  461

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDPAGW  W G FAL TL Y EY N GAGAGTSKRV W GY V+TS++EA
Sbjct  462  VVMQSNIGDHIDPAGWSIWDGEFALKTLYYGEYMNKGAGAGTSKRVKWPGYHVITSATEA  521

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            + +T +  I G +WL ST   F+ GL
Sbjct  522  KKFTVAELIQGGAWLKSTGVAFTEGL  547



>gb|EMT27728.1| Pectinesterase [Aegilops tauschii]
Length=389

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRPG GQKN+ TAQGR DPNQNTGI +Q C+IAA +DL PVQ NF ++LGRPWK YSR
Sbjct  242  YARRPGPGQKNVFTAQGREDPNQNTGIAVQGCKIAAAADLVPVQANFSSYLGRPWKTYSR  301

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  ++ P GW EW GTFAL+TL Y EY N G GA TS RV W GY+V+T++++
Sbjct  302  TVFMQSKMESLVHPRGWLEWNGTFALDTLYYAEYMNRGPGANTSARVAWPGYRVITTAAD  361

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G  WL+ST+FP+SLGL
Sbjct  362  AGNFTAQAFIQGDLWLNSTSFPYSLGL  388



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   Q N+ TAQGR DPNQNTGI IQKC++AA SDL  VQ +F T+LGRPWK+YSR
Sbjct  419  YARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSR  478

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  V++PAGW EW+G FAL+TL Y EYQNTG GA TS RV WKGY+V+TS+SE
Sbjct  479  TVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASE  538

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A T+T  NFI G  WL+ T+ PF++GL
Sbjct  539  ASTFTVGNFIDGDVWLAGTSVPFTVGL  565



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            HARRP   Q+NM+TAQGR DPNQNTGIVIQ+CRI ATSDL   + +F ++LGRPWK YSR
Sbjct  419  HARRPNPSQRNMVTAQGRDDPNQNTGIVIQRCRIGATSDLLEAKDSFESYLGRPWKMYSR  478

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ+ ISD+I PAGW+ W G FAL+TL Y E+ NTG GA T+ RVTWKGY+V+ S+SE
Sbjct  479  TVIMQTVISDIIHPAGWYPWDGDFALDTLYYAEHANTGDGADTANRVTWKGYRVI-SASE  537

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            AQ +T   FI G SWL ST FP+  GL
Sbjct  538  AQAFTVDPFITGGSWLDSTGFPYYPGL  564



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P S Q+N+ TAQGR DPNQNTGI I KC++AA +DL PVQ NF T+LGRPWKE+SR
Sbjct  92   YARKPMSNQQNVFTAQGREDPNQNTGISIHKCKVAAAADLIPVQSNFSTYLGRPWKEFSR  151

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS + ++IDPAGW EW G FALNTL Y EY N G G+ T+ RV W GY+V+ S++E
Sbjct  152  TVFMQSYLDNLIDPAGWLEWNGDFALNTLYYGEYMNRGPGSNTTGRVKWPGYRVINSTAE  211

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T ++FI G  WL ST+ PF+ GL
Sbjct  212  ASNFTVTSFIQGDQWLGSTSVPFTSGL  238



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   Q N+ TAQGR DPNQNTGI IQKC++AA SDL  VQ +F T+LGRPWK+YSR
Sbjct  438  YARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSR  497

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  V++PAGW EW+G FAL+TL Y EYQNTG GA TS RV WKGY+V+TS+SE
Sbjct  498  TVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASE  557

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A T+T  NFI G  WL+ T+ PF++GL
Sbjct  558  ASTFTVGNFIDGDVWLAGTSVPFTVGL  584



>gb|EMS45437.1| Pectinesterase [Triticum urartu]
Length=311

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRPG GQKN+ TAQGR DPNQNTGI +Q C+IAA +DL PV  NF ++LGRPWK YSR
Sbjct  164  YARRPGPGQKNVFTAQGREDPNQNTGIAVQGCKIAAAADLVPVLSNFSSYLGRPWKTYSR  223

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  ++ P GW EW GTFAL+TL Y EY N G GA TS RV W GY+V+TS ++
Sbjct  224  TVFMQSKMESLVHPRGWLEWNGTFALDTLYYAEYMNRGPGANTSARVAWPGYRVITSDAD  283

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G  WL+ST+FP++LGL
Sbjct  284  AGNFTAQAFIQGDLWLNSTSFPYTLGL  310



>gb|EYU19222.1| hypothetical protein MIMGU_mgv1a003983mg [Erythranthe guttata]
Length=551

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P   QKNM+TAQGRTDPNQNTG  IQ C I A++DL PV+ +FPT+LGRPWKEYSRT
Sbjct  406  ARKPMKSQKNMVTAQGRTDPNQNTGTSIQDCEIIASADLAPVKGSFPTYLGRPWKEYSRT  465

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQSTI D+IDPAGW EW+G FAL TL Y EY N G GAGTSKRV W GY V+T ++EA
Sbjct  466  VVMQSTIGDLIDPAGWAEWSGDFALKTLYYGEYMNKGGGAGTSKRVNWTGYHVITDAAEA  525

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
              +T    I G  WL ST   F+ GL
Sbjct  526  TKFTVKELIQGGDWLGSTGVTFTEGL  551



>ref|XP_008386773.1| PREDICTED: pectinesterase-like, partial [Malus domestica]
Length=238

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C++ A SDL PV+ NF T+LGRPWKEYSR
Sbjct  90   YARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTYLGRPWKEYSR  149

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV ++S I D++DPAGW EW G+FAL+TL Y EY N G G+ TS RVTW GY+V+ SS E
Sbjct  150  TVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSVE  209

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI GS WL+ST  P+ LGL
Sbjct  210  ASQFTVGEFIQGSDWLNSTNIPYFLGL  236



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI IQKC++AA SDL PVQ NF T+LGRPWK+YSR
Sbjct  411  YARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTYLGRPWKQYSR  470

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  +IDPAGW EW G FAL+TL Y EY N G G+ TS+RVTW GY+V+TS++E
Sbjct  471  TVFMQSFLGSLIDPAGWLEWDGDFALSTLYYGEYMNQGPGSNTSRRVTWPGYRVITSAAE  530

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T ++FI G  WL +T+ PF+ GL
Sbjct  531  ASNFTVASFIQGDQWLGATSVPFTSGL  557



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+P SGQKNM+TAQGRTDPNQNTG  IQKC I A+SDL PV+ +F +FLGRPWKEYSRTV
Sbjct  405  RKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRTV  464

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            +MQS I D+IDPAGW  W G FAL TL Y EY N GAGAGTSKRV W GY V+TS++EA+
Sbjct  465  VMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYHVITSANEAK  524

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T +  I G  WL ST   ++ GL
Sbjct  525  KFTVAELIQGGVWLKSTGVSYTEGL  549



>gb|EPS74082.1| hypothetical protein M569_00674, partial [Genlisea aurea]
Length=502

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
             AR P + QKNM+TAQGR DPNQNTGIVIQ+  I  TSDL PV KNFPT+LGRPWK+YSR
Sbjct  356  RARVPLANQKNMVTAQGREDPNQNTGIVIQRSTIDGTSDLLPVIKNFPTYLGRPWKQYSR  415

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIMQ+TIS VI P GW+ W G FAL+TL Y EY NTG GA T+ RV W G+ V TSSS+
Sbjct  416  TVIMQTTISAVIRPEGWYPWEGDFALSTLFYAEYANTGPGASTANRVNWVGFTVFTSSSQ  475

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YT  NFI  +SWL +T FPF+ GL
Sbjct  476  AKPYTAENFIGANSWLPATGFPFNAGL  502



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P +GQKNM+TAQGR DPNQNTG  IQKC I A+SDL+PV+ +  ++LGRPWKEYSRT
Sbjct  399  ARKPMNGQKNMVTAQGRIDPNQNTGTSIQKCEIIASSDLEPVKSSVKSYLGRPWKEYSRT  458

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I+D IDPAGW  W G FAL TL Y EY N GAGAGTSKRV W GY+V+TS++EA
Sbjct  459  VVMQSNIADHIDPAGWSIWEGDFALKTLYYGEYMNRGAGAGTSKRVKWAGYRVITSATEA  518

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T +  I G  WL ST   F+ GL
Sbjct  519  QKFTVAELIQGGVWLKSTGVAFTEGL  544



>ref|XP_004293266.1| PREDICTED: pectinesterase [Fragaria vesca subsp. vesca]
Length=528

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P SGQ NM+TAQGRTDPNQNTG  IQKC++ A+SDL+PV+    ++LGRPWKEYSRT
Sbjct  383  ARKPASGQNNMVTAQGRTDPNQNTGTSIQKCQVIASSDLEPVKGTVRSYLGRPWKEYSRT  442

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQSTI D IDP GW  W+G FAL TL Y EY N+G GAGTSKRVTW GY V+ ++SEA
Sbjct  443  VVMQSTIGDHIDPTGWSIWSGDFALKTLYYGEYANSGPGAGTSKRVTWAGYHVIKTASEA  502

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q++T +  I G SWL ST   F+ GL
Sbjct  503  QSFTVAGLIQGGSWLKSTGVSFTEGL  528



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C++AA +DL PV+ +F T+LGRPWKEYSR
Sbjct  414  YARKPNENQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFKTYLGRPWKEYSR  473

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M S I DV+DPAGW EW GTFALNTL Y EY+N G G+ TS RVTW GYKV+T+ +E
Sbjct  474  TVYMLSNIEDVVDPAGWLEWNGTFALNTLYYAEYRNQGPGSNTSARVTWPGYKVLTNVTE  533

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T S+FI G+ WL+ T+ P+ LGL
Sbjct  534  ATQFTVSSFIQGNDWLNGTSIPYYLGL  560



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+P SGQKNM+TAQGRTDPNQNTG  IQKC I A+SDL PV+ +F ++LGRPWKEYSRTV
Sbjct  413  RKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSYLGRPWKEYSRTV  472

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            +MQS I D+IDPAGW  W G FAL TL Y EY N GAGAGTSKRV W GY V+TS++EA+
Sbjct  473  VMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVKWPGYHVITSANEAK  532

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T +  I G  WL ST   ++ GL
Sbjct  533  KFTVAELIQGGVWLKSTGVSYTEGL  557



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP +GQ N  TAQGRTDPNQNTGI +Q+C+++A SDL  VQ +F T+LGRPW++YSR
Sbjct  415  YARRPLAGQSNTYTAQGRTDPNQNTGISVQRCKVSAASDLAAVQSSFRTYLGRPWQQYSR  474

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M+S +  V++PAGW EW G FAL+TL Y EYQNTGAGA TS RV WKGY+V+TS+SE
Sbjct  475  TVFMESQMDSVVNPAGWLEWNGNFALDTLYYGEYQNTGAGAATSNRVKWKGYRVITSASE  534

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FI G  WL  T+ PFS GL
Sbjct  535  ASAFTVGSFIDGDVWLPRTSVPFSTGL  561



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNTGI I   R+ A +DL PV  +F TFLGRPWKEYSR
Sbjct  370  YARRPMDKQKNIVTAQGRTDPNQNTGISIHNSRVMAANDLTPVLSSFKTFLGRPWKEYSR  429

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQ+ +  ++DPAGW EW G FALNTL Y EY+N G  A TS+RVTWKGY+V+TS++E
Sbjct  430  TVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGPAAPTSRRVTWKGYRVITSATE  489

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL  T  PF+ GL
Sbjct  490  ASKFTVTNFIAGRSWLPDTGIPFTSGL  516



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   Q N+ TAQGRTDPNQNTGI +QKCR AA SDL  VQ +F T+LGRPWK+YSR
Sbjct  326  YARRPLPNQSNIYTAQGRTDPNQNTGISVQKCRGAAASDLAAVQSSFRTYLGRPWKQYSR  385

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS +  V+DPAGW  W GTFAL+TL Y EYQNTG GAGTS RV+W GY+ + S+SE
Sbjct  386  TVFIQSELDSVVDPAGWLAWDGTFALDTLYYAEYQNTGPGAGTSGRVSWMGYRGVISASE  445

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A T+T  +FI G  WL+ T+ PFS GL
Sbjct  446  ASTFTVGSFIDGDVWLAGTSIPFSGGL  472



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP +GQKN +TAQGRTDPNQNTGI I   R+ A SDLKPV  +  T+LGRPWKEYSR
Sbjct  336  YARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKTYLGRPWKEYSR  395

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS +  ++DPAGW EW G FAL TL Y EY+NTG G+ TS RV W GY V+TSSSE
Sbjct  396  TVFLQSYLDTLVDPAGWLEWDGNFALKTLYYGEYKNTGPGSSTSGRVNWGGYHVITSSSE  455

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NFIAGSSWL +T  PF+ GL
Sbjct  456  ASKFTVGNFIAGSSWLPATNVPFTAGL  482



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA +DL PV+ +F T+LGRPWKEYSR
Sbjct  413  YARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFKTYLGRPWKEYSR  472

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIM+S I D +DPAGW EW GTFAL+TL Y EY N G G+ TS RVTW GY+V+ SS+E
Sbjct  473  TVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSTE  532

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+S+  PF+LGL
Sbjct  533  ATQFTIEPFIQGNEWLNSSNIPFALGL  559



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+  SGQKNM+TAQGRTDPNQNTG  IQKC I+A+SDL+PV+ ++ ++LGRPWKEYSRT
Sbjct  407  ARKGMSGQKNMVTAQGRTDPNQNTGTSIQKCEISASSDLEPVKASYKSYLGRPWKEYSRT  466

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQSTI D+IDPAGW EW   FAL TL Y EY N G GAGTSKRV W GY V+TS SEA
Sbjct  467  VVMQSTIGDLIDPAGWAEWDKDFALKTLYYGEYANQGPGAGTSKRVNWAGYHVITSPSEA  526

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T +  I G  WL ++   ++ GL
Sbjct  527  QKFTVAELIQGGYWLKNSGVAYTEGL  552



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA +DL PV+ +F T+LGRPWKEYSR
Sbjct  413  YARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFKTYLGRPWKEYSR  472

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIM+S I D +DPAGW EW GTFAL+TL Y EY N G G+ TS RVTW GY+V+ SS+E
Sbjct  473  TVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSSTSARVTWPGYRVINSSTE  532

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+S+  PF+LGL
Sbjct  533  ATQFTIEPFIQGNEWLNSSNIPFALGL  559



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            RRP  GQ N++TAQGRTDPNQNTGI I  CR+ A+SDLKPVQ +F TFLGRPWKEYSRTV
Sbjct  384  RRPMDGQSNVVTAQGRTDPNQNTGISIHNCRVMASSDLKPVQSSFKTFLGRPWKEYSRTV  443

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
             +Q+ +  ++DPAGW EW+G FALNTL Y EY+N G  + T++RV W+GY+V+T+ SEA 
Sbjct  444  YLQTYLDTLVDPAGWMEWSGNFALNTLYYGEYRNFGPASSTARRVKWRGYRVITNPSEAS  503

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T  NFI+G SWL +T  PF+ GL
Sbjct  504  RFTVGNFISGGSWLPATGVPFNSGL  528



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN +TAQGRTDPNQNTGI I   R+ A++DL PV  +F +FLGRPWKEYSR
Sbjct  329  YARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMASADLVPVLGSFRSFLGRPWKEYSR  388

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQ+ +  ++DPAGW EW G FALNTL Y EY+NTG G+ TS+RV W+GY+V+TS++E
Sbjct  389  TVFMQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGPGSSTSRRVRWRGYRVITSAAE  448

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T  PF+ GL
Sbjct  449  AGRFTVANFIAGQSWLPATGVPFTAGL  475



>ref|XP_009590338.1| PREDICTED: pectinesterase 3-like, partial [Nicotiana tomentosiformis]
Length=244

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+PG  QKNM+TAQGRTDPNQ TG  IQ C I A+ DL+PV+  + T+LGRPWKEYSRTV
Sbjct  98   RKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTV  157

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            +M+S + D+IDPAGW EW+G FAL TL Y EY N G GAGTSKRV W GY ++T+ +EA 
Sbjct  158  VMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVKWSGYHIITNPAEAM  217

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T +  I G SWLSST   F  GL
Sbjct  218  PFTVAELIQGGSWLSSTGVTFVQGL  242



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P +GQ NM+TAQGR DPNQNTG  IQKC I A+SDL+PV+    ++LGRPWKEYSRT
Sbjct  410  ARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRT  469

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDP+GW  W+G FAL TL Y EY N+GAGAGTSKRV W GY V+TS +EA
Sbjct  470  VVMQSKIGDHIDPSGWSIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEA  529

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            QT+T +  I G SWL ST   ++ GL
Sbjct  530  QTFTVAQLIQGGSWLKSTGVAYTEGL  555



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I   +IAA +DL P++ +F T+LGRPWKE+SR
Sbjct  413  YARKPNPNQKNIFTAQGREDPNQNTGISILNSKIAAAADLIPLKSSFKTYLGRPWKEFSR  472

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIM+S I D +DPAGW EW GTFAL+TL Y EY N GAG+ TS RVTW GY+V+ SS+E
Sbjct  473  TVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGAGSNTSARVTWPGYRVINSSTE  532

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+ST  PFSLGL
Sbjct  533  ADQFTAGAFIQGNDWLNSTDIPFSLGL  559



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN +TAQGRTDPNQNTGI I   R+ A SDLKPV  +F TFLGRPWK+YSR
Sbjct  309  YARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLKPVLSSFKTFLGRPWKQYSR  368

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  ++DPAGW EW G FALNTL Y EY+N G  + TS RV W+GY+V+TS++E
Sbjct  369  TVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRVKWRGYRVITSATE  428

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T  PFS GL
Sbjct  429  ASQFTVANFIAGRSWLPATGVPFSSGL  455



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P S QKN+ TAQGR DPNQNTGI I  C++AA +DL PV+ +F TFLGRPWKEYSR
Sbjct  411  YARKPNSNQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTFLGRPWKEYSR  470

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV ++S I D++DPAGW EW  +FAL+TL YREY N G G+ TS RVTW GY+++T+S+E
Sbjct  471  TVFLRSYIDDLVDPAGWLEWNASFALSTLYYREYMNRGPGSNTSARVTWPGYRIITNSTE  530

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G++WL+ST  P+ L L
Sbjct  531  ASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            H R+P SGQKN +TAQGRTDPN+NTGI I    + A SDLKPVQ +F T+LGRPW+EYSR
Sbjct  370  HVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQGSFETYLGRPWQEYSR  429

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M++++  +IDPAGW EW+G FAL+TL Y EY NTG GA TS+RV W GY V+TS++E
Sbjct  430  TVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGADTSQRVKWPGYHVITSAAE  489

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NF++G+SW+ +T  PF+ GL
Sbjct  490  ASKFTVGNFLSGNSWIPATEVPFTSGL  516



>dbj|BAF95866.1| pectin methylesterase isoform alpha [Vitis hybrid cultivar]
Length=234

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN+ TAQGR DPN+NTGI IQ C++AA +DL PV  +F ++LGRPWKEYSR
Sbjct  53   YARRPNENQKNVFTAQGRDDPNENTGISIQNCKVAAAADLIPVLSSFKSYLGRPWKEYSR  112

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS I D+IDPAGW EW G FAL+TL Y EY+N G G+ TS RVTW GY+V+ SSS 
Sbjct  113  TVYMQSNIGDLIDPAGWLEWDGDFALSTLYYGEYKNRGPGSNTSGRVTWPGYRVINSSSV  172

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL*SMNQFFFL  228
            A  +T   FI G  WL +T  P+   L  + +  FL
Sbjct  173  ASQFTVGAFIQGDEWLPATGIPYYSNLTIVYKVVFL  208



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P + QKNM+TAQGR DPNQNTGI IQKC I A+SDL PV+ +FP++LGRPWKEYSRT
Sbjct  408  ARKPMASQKNMVTAQGRVDPNQNTGISIQKCDIIASSDLAPVKNSFPSYLGRPWKEYSRT  467

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D I PAGW  W+G FAL TL Y EY N+G GAG SKRVTW GY V+T+S+EA
Sbjct  468  VVMQSYIGDHIAPAGWSIWSGEFALKTLYYGEYLNSGPGAGISKRVTWPGYHVITNSAEA  527

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
              +T +  I G +WL ST   ++ GL
Sbjct  528  LKFTVAELIQGGAWLKSTGVDYTEGL  553



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P   QKNM+TAQGRTDPNQNTG  IQ C I A+ DL+PV+ +FPT+LGRPWKEYSRT
Sbjct  405  ARKPMKSQKNMVTAQGRTDPNQNTGTSIQDCEIRASEDLEPVKSSFPTYLGRPWKEYSRT  464

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDP GW EW+G FAL TL Y EY N G GAGTSKRV W GY V+T+++EA
Sbjct  465  VVMQSYIGDHIDPVGWSEWSGDFALKTLYYGEYMNKGPGAGTSKRVKWAGYHVITNAAEA  524

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
              +T    I G  WL ST   ++ GL
Sbjct  525  AKFTVKELIQGVEWLGSTGVAYTEGL  550



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNTGI I   R+ A+SDL+PV  +F T+LGRPWKEYSR
Sbjct  371  YARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTYLGRPWKEYSR  430

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  ++DPAGW EW G FALNTL Y EY+N+G GA T  RV W+GY+V+TSS+E
Sbjct  431  TVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTRGRVKWRGYRVITSSTE  490

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T  PF  GL
Sbjct  491  ASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNTGI I   R+ A+SDL+PV  +F TFLGRPWK YSR
Sbjct  373  YARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTFLGRPWKAYSR  432

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  ++D AGW EW G FALNTL Y EY+N+G GA TS RV W+GY+V+TS++E
Sbjct  433  TVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWRGYRVITSATE  492

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T  PFS GL
Sbjct  493  ASRFTAANFIAGRSWLPATGVPFSSGL  519



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   Q+N+ TAQGR DPNQNTGI IQ C++AA +DL PVQ +F  +LGRPWK+YSR
Sbjct  393  YARRPNPNQRNLFTAQGRVDPNQNTGISIQNCKVAAAADLIPVQSSFKNYLGRPWKQYSR  452

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            T+ MQS I D+IDPAGW EW+G FAL+TL Y EY N G GA TS RV W GY+V+ SSSE
Sbjct  453  TIFMQSDIGDLIDPAGWFEWSGDFALSTLYYGEYMNRGPGADTSNRVKWPGYRVINSSSE  512

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T ++FI G+ WL ++   F  GL
Sbjct  513  ASQFTVASFIQGNEWLPASNVAFYAGL  539



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   197 bits (501),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNTGI I   R+ A+ DLKPV  +F T+LGRPWK+YSR
Sbjct  377  YARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLKPVLSSFKTYLGRPWKQYSR  436

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  ++DPAGW EW G FALNTL Y EY+N G  A TS RVTW+GY+V+TSS+E
Sbjct  437  TVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGPSASTSGRVTWRGYRVITSSTE  496

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +++ PF+ GL
Sbjct  497  ANRFTVANFIAGGSWLPASSVPFTSGL  523



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P S QKN+ TAQGR DPNQNTGI IQ C++AA SDL PVQ NF T+LGRPWK YSR
Sbjct  419  YARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSR  478

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ T+ RV W GY+V+ SS+E
Sbjct  479  TVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAE  538

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FI G  WL ST+ PF+ GL
Sbjct  539  ASMFTVESFIEGDQWLGSTSVPFTAGL  565



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C++ A SDL PV+ NF T+LGRPWKEYSR
Sbjct  431  YARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTYLGRPWKEYSR  490

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV ++S I D++DPAGW EW G+FAL+TL Y EY N G G+ TS RVTW GY+V+ SS E
Sbjct  491  TVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSVE  550

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI GS WL+ST  P+ LGL
Sbjct  551  ASQFTVGEFIQGSDWLNSTNIPYFLGL  577



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P S QKN+ TAQGR DPNQNTGI IQ C++AA SDL PVQ NF T+LGRPWK YSR
Sbjct  418  YARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSR  477

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ T+ RV W GY+V+ SS+E
Sbjct  478  TVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAE  537

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FI G  WL ST+ PF+ GL
Sbjct  538  ASMFTVESFIEGDQWLGSTSVPFTAGL  564



>ref|XP_004307817.2| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P SGQKN +TAQGRTDPNQNTGI I   RI A +DL PV K+  TFLGRPWK YSR
Sbjct  372  YARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAAADLAPVIKSVKTFLGRPWKTYSR  431

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS +  ++DPAGW EW G FAL TL Y EY+N G G+GTS RV W GY+V+TSSSE
Sbjct  432  TVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGPGSGTSGRVKWGGYRVITSSSE  491

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  N IAGSSWL +T  PF+ GL
Sbjct  492  ASKFTVGNLIAGSSWLPATGVPFTSGL  518



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P S QKN+ TAQGR DPNQNTGI IQ C++AA SDL PVQ NF T+LGRPWK YSR
Sbjct  419  YARKPLSNQKNVFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSR  478

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ T+ RV W GY+V+ SS+E
Sbjct  479  TVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAE  538

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FI G  WL ST+ PF+ GL
Sbjct  539  ASMFTVESFIEGDQWLGSTSVPFTAGL  565



>ref|XP_009768199.1| PREDICTED: pectinesterase 2.1-like [Nicotiana sylvestris]
Length=559

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+PG  QKNM+TAQGRTDPNQ TG  IQ C I A+ DL+PV+  + T+LGRPWKEYSRTV
Sbjct  413  RKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTV  472

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            +M+S + D+IDPAGW EW+G FAL TL Y EY N G GAGTSKRVTW GY V+T ++EA+
Sbjct  473  VMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVTWPGYHVITDAAEAR  532

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T +  I G SWLSST   F  GL
Sbjct  533  PFTVAELIQGGSWLSSTGVTFVEGL  557



>gb|AHC69829.1| pectin methylesterase PME2.1 [Nicotiana tabacum]
Length=559

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+PG  QKNM+TAQGRTDPNQ TG  IQ C I A+ DL+PV+  + T+LGRPWKEYSRTV
Sbjct  413  RKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTV  472

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            +M+S + D+IDPAGW EW+G FAL TL Y EY N G GAGTSKRVTW GY V+T ++EA+
Sbjct  473  VMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVTWPGYHVITDAAEAR  532

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T +  I G SWLSST   F  GL
Sbjct  533  PFTVAELIQGGSWLSSTGVTFVEGL  557



>ref|XP_010101474.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88457.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=556

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  RRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRTV  510
            R+  +GQKNM+TAQGRTDPNQNTG  I  C I A+ DL+PV+ +FP++LGRPWKEYSRTV
Sbjct  410  RKGMTGQKNMVTAQGRTDPNQNTGTSIHNCEIFASPDLEPVKDSFPSYLGRPWKEYSRTV  469

Query  509  IMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEAQ  330
            +MQS I D+IDPAGW EW G FALNTL Y EY N G GAGTSKRV W GY V+TS  EAQ
Sbjct  470  VMQSYIGDLIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWVGYHVITSPDEAQ  529

Query  329  TYTPSNFIAGSSWLSSTTFPFSLGL  255
             +T    I G  WL ST   ++ GL
Sbjct  530  KFTVVELIQGGPWLESTGVDYTEGL  554



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   Q+N+ TAQGR DPNQNTGI I  C+I A SDL PV  +F T+LGRPWKEYSR
Sbjct  411  YARKPNPDQENVFTAQGRADPNQNTGISILNCKIRADSDLIPVISSFKTYLGRPWKEYSR  470

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TVIM+S I D++DPAGW EW G FALNTL Y E+ N G G+ TS+RVTW GY+V+TS ++
Sbjct  471  TVIMRSYIDDLVDPAGWLEWNGNFALNTLYYGEFLNRGPGSDTSRRVTWPGYRVITSFAD  530

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+ST  PF+LGL
Sbjct  531  ANQFTVGAFIQGNQWLNSTDIPFNLGL  557



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTD NQNTGI I   R+ A+SDL+PV  +F TFLGRPWKEYSR
Sbjct  374  YARRPMDKQKNVVTAQGRTDANQNTGISIHNSRVMASSDLRPVLSSFKTFLGRPWKEYSR  433

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  ++D AGW EW G FALNTL Y EY+N+G GA TS RV W+GY+V+TS++E
Sbjct  434  TVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWRGYRVITSATE  493

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T  PFS GL
Sbjct  494  ASRFTVANFIAGRSWLPATGVPFSSGL  520



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN++TAQGR DPNQNTGI I  C++AA +DL PV+ +F T+LGRPWKEYSR
Sbjct  283  YARQPNENQKNIVTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFKTYLGRPWKEYSR  342

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV + S I D+IDPAGW EW G FAL TL Y EY N G G+ TS RVTW GY+V+ +S+E
Sbjct  343  TVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGPGSNTSGRVTWPGYRVINNSAE  402

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +    FI GS WL++T  PFSLGL
Sbjct  403  ASQFAVEPFIQGSEWLNATGVPFSLGL  429



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P +GQ NM+TAQGR DPNQNTG  IQKC I A+SDL+PV+    ++LGRPWKEYSRT
Sbjct  410  ARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRT  469

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDP GW  W+G FAL TL Y EY N+GAGAGTSKRV W GY V+TS +EA
Sbjct  470  VVMQSKIGDHIDPTGWSIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEA  529

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T +  I G SWL ST   ++ GL
Sbjct  530  QNFTVAQLIQGGSWLKSTGVAYTEGL  555



>ref|XP_010088582.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB36723.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=658

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            +R+   GQKNM+TAQGRTDPNQNTG  I  C I A+ DL+PV+ +FP++LGRPWKEYSRT
Sbjct  511  SRKGMRGQKNMVTAQGRTDPNQNTGTSIHNCEIFASPDLEPVKDSFPSYLGRPWKEYSRT  570

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D+IDPAGW EW G FALNTL Y EY N G GAGTSKRV W GY V+TS  EA
Sbjct  571  VVMQSYIGDLIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWAGYHVITSPDEA  630

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T +  I G  WL ST   ++ GL
Sbjct  631  QKFTVAELIQGGPWLESTGVDYTEGL  656



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP S QKN +TAQGRTDPNQNTGI I   R+ A +DLKPV  +F T+LGRPWK+YSR
Sbjct  377  YARRPMSKQKNTITAQGRTDPNQNTGISIHNSRVMAAADLKPVLSSFKTYLGRPWKQYSR  436

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQ+ +  ++DPAGW EW G FALNTL Y EY+N G  A TS+RV W GY+V+TSSSE
Sbjct  437  TVFMQTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNLGPAASTSRRVKWSGYRVITSSSE  496

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T   F+ GL
Sbjct  497  ASQFTVANFIAGQSWLPATGVRFTAGL  523



>ref|XP_010534985.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=589

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR PG G++NM+TAQGRTD NQ+TGIVIQ CRI ATSDL PV   +P++LGRPW+EYSRT
Sbjct  443  ARIPGRGKQNMVTAQGRTDKNQDTGIVIQNCRINATSDLWPVMDEYPSYLGRPWQEYSRT  502

Query  512  VIMQSTISDVIDPAGWHEW-TGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            V+MQS+IS+VI+P GW  W +  F L+TLTYREY N G GA T  RV WKG+KV+T   E
Sbjct  503  VVMQSSISEVINPKGWRPWNSSNFYLDTLTYREYSNRGPGANTKYRVKWKGFKVITDPKE  562

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A+ YT   FI GSSW+  T FP+  GL
Sbjct  563  AEPYTADEFIDGSSWVPETGFPYQPGL  589



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P SGQKN +TAQGRTDPNQNTGI I   R+ A  D K    +  TFLGRPWKEYSR
Sbjct  373  YARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTFLGRPWKEYSR  432

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  ++DPAGW EW+G FAL TL Y EY+N G GA TS+RV W GY+V+TSSSE
Sbjct  433  TVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSRRVKWGGYRVITSSSE  492

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAGSSWL +T  PF+ GL
Sbjct  493  ASKFTVNNFIAGSSWLPATNVPFTAGL  519



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN+ TAQGR DPNQNTGI IQ C++AA +DL PVQ NF ++LGRPWK YSR
Sbjct  432  YARRPDPNQKNVFTAQGREDPNQNTGIAIQGCKVAAAADLVPVQANFSSYLGRPWKTYSR  491

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS I  +I P GW EW G+FAL+TL Y EY N G GA TS RV+W GY V+T++++
Sbjct  492  TVFLQSKIDSLIHPRGWLEWNGSFALDTLYYAEYMNRGDGADTSARVSWPGYHVLTNATD  551

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NF+ G  WL+S++FP+ LGL
Sbjct  552  AANFTVLNFVQGDLWLNSSSFPYILGL  578



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN+ TAQGR DPNQNTGI IQ C++AA +DL PVQ NF ++LGRPWK YSR
Sbjct  432  YARRPDPNQKNVFTAQGREDPNQNTGIAIQGCKVAAAADLVPVQANFSSYLGRPWKTYSR  491

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS I  +I P GW EW G+FAL+TL Y EY N G GA TS RV+W GY V+T++++
Sbjct  492  TVFLQSKIDSLIHPRGWLEWNGSFALDTLYYAEYMNRGDGADTSARVSWPGYHVLTNATD  551

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NF+ G  WL+S++FP+ LGL
Sbjct  552  AANFTVLNFVQGDLWLNSSSFPYILGL  578



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   Q N+ TAQGR DPNQNTGI IQ+C++AA SDL   + +  T+LGRPWK+YSR
Sbjct  282  YARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAASDLAGQESSTKTYLGRPWKQYSR  341

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS +  +IDPAGW EW G+FAL+TL Y EY NTGAGAGT+ RV WKGY+V+TS++E
Sbjct  342  TVFLQSELDSLIDPAGWLEWNGSFALDTLYYGEYMNTGAGAGTAGRVKWKGYRVITSAAE  401

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FI G  WL+ T+ PF+ GL
Sbjct  402  ASAFTVGSFIDGDVWLAGTSIPFTTGL  428



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   Q+N+ TAQGR DPNQNTGI IQ+C++AA +DL PVQ NF T+LGRPWKEYSR
Sbjct  420  YARKPLPNQQNIFTAQGREDPNQNTGISIQRCKVAAAADLIPVQANFSTYLGRPWKEYSR  479

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  +I PAGW EW G+FAL+TL Y EY N G G+ TS RV W G++V+  ++E
Sbjct  480  TVFMQSYLDSLISPAGWLEWNGSFALSTLYYGEYMNRGPGSNTSSRVAWPGFRVIGDAAE  539

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T + F+ G  WL ST+ PFSLGL
Sbjct  540  ASNFTAAAFVQGDQWLGSTSVPFSLGL  566



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP +GQKN +TAQGRTDPNQNTGI I   R+ A SDLKPV  +  T+LGRPWKEYSR
Sbjct  371  YARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKTYLGRPWKEYSR  430

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS +  ++D AGW EW G FAL TL Y EY+NTG G+ T  RV W GY V+TSSSE
Sbjct  431  TVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGPGSSTRGRVNWGGYHVITSSSE  490

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NFIAGSSWL +T  PF+ GL
Sbjct  491  ASKFTVGNFIAGSSWLPATNVPFTAGL  517



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P S Q NM+TAQGRTDPNQNTG  IQKC + A+SDL+PV+ +  ++LGRPWKEYSRT
Sbjct  411  ARKPMSKQSNMVTAQGRTDPNQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRT  470

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDPAGW EW+G FAL TL Y EY N G GAGTSKRV W GY V+T   EA
Sbjct  471  VVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEA  530

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            + +T +  I G SWL ST   ++ GL
Sbjct  531  KKFTVAELIGGGSWLKSTGVAYTEGL  556



>ref|XP_008371117.1| PREDICTED: pectinesterase [Malus domestica]
Length=558

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P +GQ NM+TAQGR DPNQNTG  IQKC + A+SDL+PV+    ++LGRPWKEYSRT
Sbjct  413  ARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDVVASSDLEPVKGTIRSYLGRPWKEYSRT  472

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDPAGW  W+G FAL TL Y EY N+G GAGTSKRV W GY V+TS  +A
Sbjct  473  VVMQSKIGDHIDPAGWSIWSGDFALKTLYYGEYANSGPGAGTSKRVKWAGYHVITSPKKA  532

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T +N I G SWL ST   ++ GL
Sbjct  533  QPFTVANLIQGGSWLKSTGVTYTEGL  558



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   188 bits (477),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNTGI I   R+ A +DLKPV  +F T+LGRPWKEYSR
Sbjct  114  YARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATDLKPVLSSFKTYLGRPWKEYSR  173

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV + + +  ++D AGW EW G FALNTL Y EY+N G G+ TS RV W+GY+V+TS++E
Sbjct  174  TVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWRGYRVITSATE  233

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  ++ +NFIAG SWL +T  PF  GL
Sbjct  234  ASKFSVANFIAGQSWLPATGVPFRSGL  260



>gb|AAF16637.1|AC011661_15 T23J18.24 [Arabidopsis thaliana]
Length=223

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR PG+GQKNMLTAQGR D NQNT I IQKC+I A+SDL PV+ +  TFLGRPWK YSRT
Sbjct  78   ARNPGAGQKNMLTAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRT  137

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS I + IDPAGW  W G FAL+TL Y EY NTG GA TSKRV WKG+KV+  S EA
Sbjct  138  VIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEA  197

Query  332  QTYTPSNFIAGSSWLSSTTFPF  267
            + +T +  I G  WL  T   F
Sbjct  198  EQFTVAKLIQGGLWLKPTGVTF  219



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P S Q+N+ TAQGR DPNQNTGI I  C++AA +DL PV+ +F TFLGRPWKEYSR
Sbjct  411  YARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTFLGRPWKEYSR  470

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV ++S I D++DPAGW EW  +FAL+TL Y EY N G G+ TS RVTW GY+V+T+S+E
Sbjct  471  TVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSARVTWPGYRVITNSTE  530

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G++WL+ST  P+ L L
Sbjct  531  ASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P S Q NM+TAQGRTDPNQNTG  IQKC + A+SDL+PV+ +  ++LGRPWKEYSRT
Sbjct  411  ARKPMSKQSNMVTAQGRTDPNQNTGTSIQKCDVIASSDLEPVKGSIRSYLGRPWKEYSRT  470

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDPAGW EW+G FAL TL Y EY N G GAGTSKRV W GY V+T   EA
Sbjct  471  VVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEA  530

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            + +T +  I G SWL ST   ++ GL
Sbjct  531  KKFTVAELIGGGSWLKSTGVAYTEGL  556



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P S Q+N+ TAQGR DPNQNTGI I  C++AA +DL PV+ +F TFLGRPWKEYSR
Sbjct  411  YARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTFLGRPWKEYSR  470

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV ++S I D++DPAGW EW  +FAL+TL Y EY N G G+ TS RVTW GY+V+T+S+E
Sbjct  471  TVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSARVTWPGYRVITNSTE  530

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G++WL+ST  P+ L L
Sbjct  531  ASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKNM TAQGR DPNQNTGI I  C++AA SDL PV+  F T+LGRPWKEYSR
Sbjct  414  YARKPNENQKNMFTAQGREDPNQNTGISILNCKVAAASDLVPVKSTFKTYLGRPWKEYSR  473

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M+S I D++ PAGW EW GTFAL+TL Y EY N G G+ TS RV W GY+V+ SS E
Sbjct  474  TVYMKSYIDDLVQPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVKWPGYRVINSSDE  533

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+ST  P+ +GL
Sbjct  534  ANQFTVGPFIQGNEWLNSTNIPYFIGL  560



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P  GQKN+ TAQGR DPNQNTGI I  C++ A SDL PV+  F T+LGRPWKEYSR
Sbjct  420  YARKPNDGQKNIFTAQGREDPNQNTGISILNCKVTAASDLIPVKSTFKTYLGRPWKEYSR  479

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV ++S I D +DPAGW EW GTFAL+TL Y EY N G G+GT+ RVTW GY+V+ +S+E
Sbjct  480  TVYLRSNIDDTVDPAGWLEWNGTFALSTLYYGEYLNRGNGSGTTARVTWPGYRVINNSTE  539

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+ST  P+  GL
Sbjct  540  ASQFTVGAFIQGNEWLNSTGIPYFAGL  566



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR P   + N +TAQGRTDPNQNTGI I   R+ A SDLKPVQ +  T+LGRPWKEYSR
Sbjct  114  YARNP-PNKTNTITAQGRTDPNQNTGISILNSRVTAASDLKPVQSSVKTYLGRPWKEYSR  172

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M++ +  +I+PAGW  W+G FALNTL Y EY NTG G+ T+KRV WKGY V+TS++E
Sbjct  173  TVFMKTFLDGLINPAGWMPWSGNFALNTLYYGEYANTGPGSSTAKRVNWKGYHVITSATE  232

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NFIAGSSWL +T  PF+ GL
Sbjct  233  ASKFTVGNFIAGSSWLPATNVPFTSGL  259



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP SGQKN +TAQGRTDPNQNTGI I   R+ A  DLKPV  +F ++LGRPWK+YSR
Sbjct  373  YARRPMSGQKNTITAQGRTDPNQNTGISIHNSRVMAAPDLKPVLSSFKSYLGRPWKQYSR  432

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  +IDPAGW EW G FAL+TL Y EY+N G  A TS RV W GY+V+TSSSE
Sbjct  433  TVYLQTYLDTLIDPAGWLEWDGNFALSTLYYGEYKNLGPAAWTSGRVKWPGYRVITSSSE  492

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL ST  PF+ GL
Sbjct  493  ASKFTVANFIAGQSWLPSTGVPFTPGL  519



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P SGQKN +TAQGRTDPNQNTGI I   R+ A  D K    +  TFLGRPWKEYSR
Sbjct  373  YARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTFLGRPWKEYSR  432

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQS +  ++DPAGW EW+G FAL TL Y EY+N G GA TS RV W GY+V+TSSSE
Sbjct  433  TVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSGRVKWGGYRVITSSSE  492

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAGSSWL +T  PF+ GL
Sbjct  493  ASKFTVNNFIAGSSWLPATNVPFTAGL  519



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA +DL PVQ  F ++LGRPWK+YSR
Sbjct  410  YARKPDPKQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVQSTFKSYLGRPWKKYSR  469

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV + S I ++IDPAGW EW GTFAL+TL Y EY+N G G+ TS RVTW GYKV+T+++E
Sbjct  470  TVYLNSFIDNLIDPAGWLEWNGTFALDTLFYGEYKNRGPGSNTSARVTWPGYKVITNATE  529

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+ST  PF L L
Sbjct  530  ASQFTVRQFIQGNEWLNSTGVPFFLDL  556



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P +GQKN +TAQGRTDPNQNTGI I   R+ AT DLKPV+    T+LGRPWKEYSR
Sbjct  380  YARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSR  439

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M++ I  ++DPAGW EW G FALNTL Y EY N G G+  S+RV WKGY V+T+ +E
Sbjct  440  TVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVITNLTE  499

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NFIAG SWL  T  PF+ GL
Sbjct  500  ASEFTVQNFIAGQSWLPDTEVPFTPGL  526



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN +TAQGRTDPNQNTGI I   R+ A SDL+PV  +F T+LGRPWK+YSR
Sbjct  377  YARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLRPVLSSFKTYLGRPWKQYSR  436

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  ++DPAGW EW G FA NTL Y EY+N+G G+ TS+RV W+GY V+T+ +E
Sbjct  437  TVFIQTYLDSLVDPAGWLEWDGNFAFNTLYYGEYKNSGPGSSTSRRVKWRGYHVITNPTE  496

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T  PF+ GL
Sbjct  497  ASRFTVANFIAGRSWLPATNVPFAAGL  523



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P +GQKN +TAQGRTDPNQNTGI I   R+ AT DLKPV+    T+LGRPWKEYSR
Sbjct  425  YARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSR  484

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M++ I  ++DPAGW EW G FALNTL Y EY N G G+  S+RV WKGY V+T+ +E
Sbjct  485  TVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVITNLTE  544

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NFIAG SWL  T  PF+ GL
Sbjct  545  ASEFTVQNFIAGQSWLPDTEVPFTPGL  571



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNT I I   R+ A+SDL+PV  +F T+LGRPWKEYSR
Sbjct  371  YARRPMDKQKNVVTAQGRTDPNQNTPISIHNSRVMASSDLRPVLSSFKTYLGRPWKEYSR  430

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +Q+ +  ++DPAGW EW G FALNTL Y EY+N G GA T  RV W+GY+V+TSS+E
Sbjct  431  TVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNFGPGASTRGRVKWRGYRVITSSTE  490

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFIAG SWL +T  PF  GL
Sbjct  491  ASRFTVANFIAGRSWLPATGVPFYPGL  517



>pir||S00629 pectinesterase (EC 3.1.1.11) precursor (clone PE1) - tomato
 emb|CAA30746.1| unnamed protein product [Solanum lycopersicum]
Length=389

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+PG  Q+NM+TAQGRTDPNQ TG  IQ C I A+ DLKPV K FPT+LGRPWK+YSRT
Sbjct  227  ARKPGKYQQNMVTAQGRTDPNQATGTSIQFCDIIASPDLKPVVKEFPTYLGRPWKKYSRT  286

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+M+S++  +IDP+GW EW G FAL TL Y E+ N G GAGTSKRV W GY V+T  +EA
Sbjct  287  VVMESSLGGLIDPSGWAEWHGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAEA  346

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
             ++T +  I G SWL ST   +  GL
Sbjct  347  MSFTVAKLIQGGSWLRSTDVAYVDGL  372



>gb|AAF35897.1|AF229849_1 pectin methylesterase isoform alpha [Vigna radiata]
Length=277

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   Q+N+ TAQGR DPNQ+TGI I  C++AA +DL PV+  F  +LGRPWK YSR
Sbjct  130  YARKPNKNQRNLFTAQGREDPNQSTGISIINCKVAAAADLIPVKSEFRNYLGRPWKMYSR  189

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV + S + D+I+PAGW EW GTFAL+TL Y EY N G GA TS RVTW GY+V+T+S+E
Sbjct  190  TVFLNSLMEDLIEPAGWLEWNGTFALDTLYYGEYNNRGPGANTSGRVTWPGYRVITNSTE  249

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  NFI G+ WL+S   PF  GL
Sbjct  250  ASQFTVQNFIQGNEWLNSYGIPFFSGL  276



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNTGI I   R+ A  DL PV   F TFLGRPWKEYSR
Sbjct  372  YARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSR  431

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQ+ +  ++DPAGW EW+G FALNTL Y EY+N G  A TS RV W+GY+V+TS++E
Sbjct  432  TVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYRVITSATE  491

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FIAG+SWL +T  PF  GL
Sbjct  492  ASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P  GQ+ ++TAQGRTDPNQNTGI I   R+ AT DLKPV K+  T+LGRPWKEYSR
Sbjct  285  YARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSR  344

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV +QS +  +++PAGW EW+G FALNTL Y E++N+G G+ T+ RV WKGY+V+TS+SE
Sbjct  345  TVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGLGSSTANRVKWKGYRVITSASE  404

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FI+G+SWL  T  PF+ GL
Sbjct  405  AAKFTVGSFISGNSWLPGTGVPFTAGL  431



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P   QK  +TAQGRTDPNQNTGI I   R+ A SDL+PV   F T+LGRPWK+YSRT
Sbjct  376  ARQPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVLNTFKTYLGRPWKQYSRT  435

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V M++ +  ++DPAGW EW G FALNTL Y EY+N+GAGA TS+RV W+GY+V+T+S+EA
Sbjct  436  VFMKTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGAGASTSRRVRWRGYRVITNSNEA  495

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
              ++  NFIAG SWL +T  PF  GL
Sbjct  496  AKFSVENFIAGRSWLPATNVPFRAGL  521



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +ARRP   QKN++TAQGRTDPNQNTGI I   R+ A  DL PV   F TFLGRPWKEYSR
Sbjct  372  YARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSR  431

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV MQ+ +  ++DPAGW EW+G FALNTL Y EY+N G  A TS RV W+GY+V+TS++E
Sbjct  432  TVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYRVITSATE  491

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  +FIAG+SWL +T  PF  GL
Sbjct  492  ASKFTVGSFIAGNSWLPATGVPFRSGL  518



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA +DL PV+ +F ++LGRPWK YSR
Sbjct  324  YARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVKSSFKSYLGRPWKMYSR  383

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV+++S + D+IDPAGW EW  TFAL+TL Y EY N G GA T+ RVTW GY+V+ SS+E
Sbjct  384  TVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANTNGRVTWPGYRVINSSTE  443

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   FI G+ WL+ST  PF  GL
Sbjct  444  ATQFTVGQFIQGNDWLNSTGIPFFSGL  470



>gb|KDO87160.1| hypothetical protein CISIN_1g015794mg [Citrus sinensis]
Length=400

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P + QKN++TAQGR DPNQNTGI I  C++AA SDL P Q  F T+LGRPWKEYSR
Sbjct  252  YARKPNANQKNIITAQGREDPNQNTGISILNCKVAAASDLIPYQTEFKTYLGRPWKEYSR  311

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M S + D+I PAGW EW GTFAL+TL Y EY+N G G+ TS RVTW GY+V+ +S+ 
Sbjct  312  TVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYRVINNSAV  371

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T   F+ GS WL+ST  PF L L
Sbjct  372  AAQFTAGPFLQGSEWLNSTGIPFYLNL  398



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 106/147 (72%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            + RRP S QKN +TAQGRTDPNQNTGI IQ CR+ A  DL+P Q +F TFLGRPWKE SR
Sbjct  314  YVRRPMSQQKNTITAQGRTDPNQNTGISIQYCRVRAAKDLRPAQSSFETFLGRPWKENSR  373

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV M++ + D+I PAGW EW+G FAL TL Y E++NTG G+ TSKRV W GY V+T  S 
Sbjct  374  TVYMETYMDDLISPAGWLEWSGGFALETLFYGEFRNTGPGSNTSKRVKWGGYHVITDPSA  433

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T  N IAG  WL ST  PF+L L
Sbjct  434  ASEFTARNLIAGEMWLPSTGVPFTLDL  460



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P +GQKNMLTAQGR DPNQNT I IQKC I  +S+L PV+++  T+LGRPWK YSRT
Sbjct  411  ARKPDAGQKNMLTAQGREDPNQNTAISIQKCNIKPSSELAPVKESVKTYLGRPWKLYSRT  470

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            VIMQS I + IDPAGW  W G FAL+TL Y EY N G GAGTSKRVTWKGY+V+  S EA
Sbjct  471  VIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANNGPGAGTSKRVTWKGYRVIKDSKEA  530

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
              +T +N I G  WL  T   F  GL
Sbjct  531  AKFTVANLIQGGLWLKPTGVAFQEGL  556



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  695  HARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSR  516
            +AR+P   QKN+ TAQGR DPNQNTGI I  C++AA +DL PV+  F  +LGRPWK+YSR
Sbjct  454  YARKPNPNQKNLFTAQGREDPNQNTGISIINCKVAAAADLIPVKSEFKNYLGRPWKKYSR  513

Query  515  TVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSE  336
            TV + S + D+IDPAGW EW G FAL+TL Y EY N G GA TS+RVTW GY+V+T+S+E
Sbjct  514  TVYLNSLMEDLIDPAGWLEWDGNFALDTLYYGEYNNRGPGANTSRRVTWPGYRVITNSTE  573

Query  335  AQTYTPSNFIAGSSWLSSTTFPFSLGL  255
            A  +T +NFI G+ WL+S   PF  GL
Sbjct  574  ASQFTVANFIQGNEWLTSLGIPFFSGL  600



>ref|XP_009364480.1| PREDICTED: pectinesterase [Pyrus x bretschneideri]
Length=558

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  692  ARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATSDLKPVQKNFPTFLGRPWKEYSRT  513
            AR+P +GQ NM+TAQGR DPNQNTG  IQKC + A+SDL+PV+    T+LGRPWKEYSRT
Sbjct  413  ARKPMTGQNNMVTAQGRIDPNQNTGTSIQKCDVVASSDLEPVKGTIRTYLGRPWKEYSRT  472

Query  512  VIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTSKRVTWKGYKVMTSSSEA  333
            V+MQS I D IDPAGW  W+G FAL TL Y EY N+G GAGT+KRV W GY V+ S  +A
Sbjct  473  VVMQSKIGDHIDPAGWSIWSGDFALKTLYYGEYANSGPGAGTNKRVKWAGYHVIKSPKKA  532

Query  332  QTYTPSNFIAGSSWLSSTTFPFSLGL  255
            Q +T +N I G SWL ST   ++ GL
Sbjct  533  QPFTVANLIQGGSWLKSTGVTYTEGL  558



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160