BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001B01

Length=771
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773397.1|  PREDICTED: probable apyrase 6                      241   8e-72   Nicotiana sylvestris
ref|XP_009616750.1|  PREDICTED: probable apyrase 6                      239   3e-71   Nicotiana tomentosiformis
ref|XP_004238804.1|  PREDICTED: probable apyrase 6                      234   2e-69   Solanum lycopersicum
ref|XP_006355131.1|  PREDICTED: probable apyrase 6-like                 234   2e-69   Solanum tuberosum [potatoes]
ref|XP_008352982.1|  PREDICTED: probable apyrase 6                      214   8e-65   
emb|CBI31953.3|  unnamed protein product                                215   1e-63   Vitis vinifera
ref|XP_011075504.1|  PREDICTED: probable apyrase 6                      219   2e-63   Sesamum indicum [beniseed]
ref|XP_002522436.1|  adenosine diphosphatase, putative                  218   4e-63   
ref|XP_002273709.1|  PREDICTED: probable apyrase 6 isoform X2           215   3e-62   Vitis vinifera
ref|XP_010652003.1|  PREDICTED: probable apyrase 6 isoform X1           215   4e-62   Vitis vinifera
ref|XP_009360337.1|  PREDICTED: probable apyrase 6 isoform X1           214   1e-61   Pyrus x bretschneideri [bai li]
gb|KDO82926.1|  hypothetical protein CISIN_1g009360mg                   213   2e-61   Citrus sinensis [apfelsine]
ref|XP_008361885.1|  PREDICTED: probable apyrase 6                      213   2e-61   
ref|XP_008221615.1|  PREDICTED: probable apyrase 6 isoform X1           213   2e-61   Prunus mume [ume]
ref|XP_002312246.1|  nucleoside phosphatase family protein              212   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_007223149.1|  hypothetical protein PRUPE_ppa003785mg             212   6e-61   Prunus persica
ref|XP_008389467.1|  PREDICTED: probable apyrase 6 isoform X1           211   1e-60   Malus domestica [apple tree]
emb|CDP00335.1|  unnamed protein product                                211   2e-60   Coffea canephora [robusta coffee]
ref|XP_006483153.1|  PREDICTED: probable apyrase 6-like                 210   3e-60   Citrus sinensis [apfelsine]
ref|XP_006438694.1|  hypothetical protein CICLE_v10031190mg             210   4e-60   Citrus clementina [clementine]
ref|XP_011017112.1|  PREDICTED: probable apyrase 6 isoform X2           207   4e-59   Populus euphratica
gb|EYU28756.1|  hypothetical protein MIMGU_mgv1a004089mg                207   6e-59   Erythranthe guttata [common monkey flower]
ref|XP_011017105.1|  PREDICTED: probable apyrase 6 isoform X1           207   6e-59   Populus euphratica
gb|KHG17053.1|  Ectonucleoside triphosphate diphosphohydrolase 1        206   2e-58   Gossypium arboreum [tree cotton]
gb|KJB80188.1|  hypothetical protein B456_013G085700                    205   3e-58   Gossypium raimondii
gb|KDP41200.1|  hypothetical protein JCGZ_15607                         204   3e-58   Jatropha curcas
ref|XP_010257480.1|  PREDICTED: probable apyrase 6                      205   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_004297300.1|  PREDICTED: probable apyrase 6 isoform X1           204   6e-58   Fragaria vesca subsp. vesca
gb|KJB50646.1|  hypothetical protein B456_008G180900                    203   8e-58   Gossypium raimondii
gb|KJB50643.1|  hypothetical protein B456_008G180900                    203   2e-57   Gossypium raimondii
gb|KGN61378.1|  hypothetical protein Csa_2G100840                       194   3e-57   
ref|XP_007157620.1|  hypothetical protein PHAVU_002G084900g             200   1e-56   Phaseolus vulgaris [French bean]
ref|XP_010097613.1|  Ectonucleoside triphosphate diphosphohydrola...    200   3e-56   Morus notabilis
ref|XP_007046094.1|  GDA1/CD39 nucleoside phosphatase family prot...    199   3e-56   
ref|XP_003517975.1|  PREDICTED: probable apyrase 6-like isoformX1       198   9e-56   Glycine max [soybeans]
ref|XP_002876854.1|  nucleoside phosphatase family protein              198   1e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010683184.1|  PREDICTED: probable apyrase 6                      197   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008802602.1|  PREDICTED: probable apyrase 6 isoform X2           197   3e-55   Phoenix dactylifera
ref|XP_010939489.1|  PREDICTED: probable apyrase 6 isoform X1           197   3e-55   
ref|NP_565293.1|  probable apyrase 6                                    196   6e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62457.1|AF387012_1  putative nucleoside triphosphatase            196   6e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14333.1|  Ectonucleoside triphosphate diphosphohydrolase 1        199   7e-55   Gossypium arboreum [tree cotton]
ref|XP_008802601.1|  PREDICTED: probable apyrase 6 isoform X1           197   8e-55   
ref|XP_003613774.1|  Ectonucleoside triphosphate diphosphohydrolase     196   8e-55   
emb|CDY03024.1|  BnaC07g22030D                                          195   2e-54   
ref|XP_009152223.1|  PREDICTED: probable apyrase 6                      195   2e-54   Brassica rapa
ref|XP_010502309.1|  PREDICTED: probable apyrase 6                      195   2e-54   Camelina sativa [gold-of-pleasure]
emb|CDY45187.1|  BnaA06g33910D                                          195   3e-54   Brassica napus [oilseed rape]
ref|XP_004490061.1|  PREDICTED: probable apyrase 6-like                 194   3e-54   Cicer arietinum [garbanzo]
ref|XP_004138917.1|  PREDICTED: probable apyrase 6-like                 193   1e-53   Cucumis sativus [cucumbers]
ref|XP_004159988.1|  PREDICTED: probable apyrase 6-like                 193   1e-53   
ref|XP_006395745.1|  hypothetical protein EUTSA_v10003943mg             193   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_006290845.1|  hypothetical protein CARUB_v10016956mg             193   1e-53   Capsella rubella
ref|XP_010425073.1|  PREDICTED: probable apyrase 6                      191   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008441708.1|  PREDICTED: probable apyrase 6                      190   1e-52   Cucumis melo [Oriental melon]
ref|XP_010514066.1|  PREDICTED: probable apyrase 6                      190   1e-52   Camelina sativa [gold-of-pleasure]
gb|KFK33476.1|  hypothetical protein AALP_AA5G018300                    189   3e-52   Arabis alpina [alpine rockcress]
gb|KFK33477.1|  hypothetical protein AALP_AA5G018300                    189   3e-52   Arabis alpina [alpine rockcress]
ref|XP_003518729.1|  PREDICTED: probable apyrase 6-like isoform 1       189   3e-52   Glycine max [soybeans]
gb|KHN12207.1|  Ectonucleoside triphosphate diphosphohydrolase 1        188   4e-52   Glycine soja [wild soybean]
ref|XP_002315051.2|  nucleoside phosphatase family protein              187   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010066911.1|  PREDICTED: probable apyrase 6 isoform X1           186   3e-51   Eucalyptus grandis [rose gum]
ref|XP_011013478.1|  PREDICTED: probable apyrase 6 isoform X1           183   3e-50   Populus euphratica
ref|XP_010527907.1|  PREDICTED: probable apyrase 6 isoform X1           184   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_011013486.1|  PREDICTED: probable apyrase 6 isoform X2           183   3e-50   Populus euphratica
ref|XP_010917046.1|  PREDICTED: probable apyrase 6 isoform X1           182   4e-50   Elaeis guineensis
ref|XP_010554315.1|  PREDICTED: probable apyrase 6 isoform X2           183   4e-50   Tarenaya hassleriana [spider flower]
gb|EPS67236.1|  hypothetical protein M569_07539                         182   5e-50   Genlisea aurea
ref|XP_010554314.1|  PREDICTED: probable apyrase 6 isoform X1           183   5e-50   Tarenaya hassleriana [spider flower]
ref|XP_008806007.1|  PREDICTED: probable apyrase 6                      181   3e-49   Phoenix dactylifera
gb|AAT66769.2|  Apyrase-like protein, putative                          177   2e-48   Solanum demissum
ref|XP_010246361.1|  PREDICTED: probable apyrase 6                      178   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010258343.1|  PREDICTED: probable apyrase 6 isoform X1           177   6e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009398170.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...    175   2e-47   
ref|XP_004973523.1|  PREDICTED: probable apyrase 6-like isoform X2      174   8e-47   
ref|XP_006829804.1|  hypothetical protein AMTR_s00119p00065770          167   2e-46   
tpg|DAA48967.1|  TPA: putative nucleoside phosphatase GDA1/CD39 f...    167   2e-46   
ref|XP_009416865.1|  PREDICTED: probable apyrase 6                      172   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006827247.1|  hypothetical protein AMTR_s00010p00262060          171   2e-45   
emb|CBI24350.3|  unnamed protein product                                170   2e-45   Vitis vinifera
ref|XP_008389468.1|  PREDICTED: probable apyrase 6 isoform X2           169   3e-45   
ref|NP_001147985.1|  LOC100281594                                       167   2e-44   Zea mays [maize]
ref|XP_009360338.1|  PREDICTED: probable apyrase 6 isoform X2           167   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_008675048.1|  PREDICTED: LOC100281594 isoform X1                 167   2e-44   Zea mays [maize]
ref|XP_002269993.3|  PREDICTED: probable apyrase 6 isoform X2           167   3e-44   
ref|XP_010651603.1|  PREDICTED: probable apyrase 6 isoform X1           167   3e-44   
ref|XP_008221616.1|  PREDICTED: probable apyrase 6 isoform X2           166   3e-44   Prunus mume [ume]
ref|XP_010258344.1|  PREDICTED: probable apyrase 6 isoform X2           165   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_003574554.2|  PREDICTED: probable apyrase 6 isoform X1           162   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_008231026.1|  PREDICTED: probable apyrase 6                      162   2e-42   Prunus mume [ume]
ref|XP_006573108.1|  PREDICTED: probable apyrase 6-like isoform X2      161   3e-42   Glycine max [soybeans]
ref|XP_006384734.1|  hypothetical protein POPTR_0004s20630g             160   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_004297301.1|  PREDICTED: probable apyrase 6 isoform X2           159   1e-41   Fragaria vesca subsp. vesca
ref|XP_008385640.1|  PREDICTED: probable apyrase 6                      156   2e-40   
ref|XP_002312853.2|  hypothetical protein POPTR_0009s15920g             156   3e-40   
ref|XP_008802603.1|  PREDICTED: probable apyrase 6 isoform X3           155   3e-40   Phoenix dactylifera
ref|XP_011006265.1|  PREDICTED: probable apyrase 6                      154   1e-39   Populus euphratica
ref|XP_011043729.1|  PREDICTED: probable apyrase 6                      154   2e-39   Populus euphratica
ref|XP_010922903.1|  PREDICTED: probable apyrase 6 isoform X2           150   5e-38   Elaeis guineensis
ref|XP_010922902.1|  PREDICTED: probable apyrase 6 isoform X1           150   5e-38   Elaeis guineensis
gb|KDP42912.1|  hypothetical protein JCGZ_23854                         149   8e-38   Jatropha curcas
dbj|BAH20369.1|  AT1G14230                                              145   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792490.1|  PREDICTED: probable apyrase 6 isoform X2           147   3e-37   Phoenix dactylifera
ref|XP_010458912.1|  PREDICTED: probable apyrase 4                      147   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008792489.1|  PREDICTED: probable apyrase 6 isoform X1           147   3e-37   Phoenix dactylifera
ref|XP_009410467.1|  PREDICTED: probable apyrase 6                      147   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010045146.1|  PREDICTED: probable apyrase 6 isoform X1           147   5e-37   Eucalyptus grandis [rose gum]
ref|XP_010045147.1|  PREDICTED: probable apyrase 6 isoform X2           147   5e-37   Eucalyptus grandis [rose gum]
ref|XP_010045148.1|  PREDICTED: probable apyrase 6 isoform X3           147   5e-37   Eucalyptus grandis [rose gum]
ref|XP_002971296.1|  hypothetical protein SELMODRAFT_94922              146   9e-37   
ref|XP_001756852.1|  predicted protein                                  145   1e-36   
ref|NP_563942.1|  probable apyrase 4                                    145   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAK76563.1|  putative nucleoside triphosphatase                      145   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476471.1|  PREDICTED: probable apyrase 4                      145   1e-36   Camelina sativa [gold-of-pleasure]
gb|AAD39310.1|AC007576_33  Hypothetical protein                         145   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAF43924.1|AC012188_1  Strong similarity to ecto-apyrase from ...    143   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172877.1|  probable apyrase 5                                    144   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307338.1|  hypothetical protein CARUB_v10008956mg             144   6e-36   Capsella rubella
ref|XP_002890044.1|  predicted protein                                  143   1e-35   
tpg|DAA45565.1|  TPA: putative nucleoside phosphatase GDA1/CD39 f...    137   2e-35   
gb|AFW87970.1|  putative nucleoside phosphatase GDA1/CD39 family ...    136   5e-35   
gb|AFW87969.1|  putative nucleoside phosphatase GDA1/CD39 family ...    136   1e-34   
ref|XP_004984217.1|  PREDICTED: probable apyrase 6-like                 139   2e-34   Setaria italica
ref|XP_002467786.1|  hypothetical protein SORBIDRAFT_01g034030          139   2e-34   Sorghum bicolor [broomcorn]
gb|KFK43668.1|  hypothetical protein AALP_AA1G157400                    139   3e-34   Arabis alpina [alpine rockcress]
gb|EEC75360.1|  hypothetical protein OsI_11798                          139   3e-34   Oryza sativa Indica Group [Indian rice]
gb|KFK43667.1|  hypothetical protein AALP_AA1G157400                    139   3e-34   Arabis alpina [alpine rockcress]
ref|XP_006417039.1|  hypothetical protein EUTSA_v10007159mg             139   5e-34   
ref|NP_001141138.1|  uncharacterized protein LOC100273224               138   7e-34   Zea mays [maize]
ref|NP_001050230.1|  Os03g0378000                                       137   8e-34   
gb|EEE59145.1|  hypothetical protein OsJ_11044                          137   9e-34   Oryza sativa Japonica Group [Japonica rice]
gb|ACF84812.1|  unknown                                                 135   1e-33   Zea mays [maize]
ref|XP_006659435.1|  PREDICTED: probable apyrase 6-like                 136   2e-33   
ref|XP_008658264.1|  PREDICTED: uncharacterized protein LOC100273...    135   3e-33   Zea mays [maize]
ref|XP_006651434.1|  PREDICTED: probable apyrase 6-like                 135   4e-33   
ref|NP_001141473.1|  uncharacterized protein LOC100273583               135   4e-33   Zea mays [maize]
ref|XP_002890045.1|  nucleoside phosphatase family protein              135   6e-33   
gb|EEE68754.1|  hypothetical protein OsJ_27446                          134   7e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061886.1|  Os08g0436100                                       135   7e-33   
ref|XP_007146158.1|  hypothetical protein PHAVU_006G017200g             128   1e-32   Phaseolus vulgaris [French bean]
ref|XP_009148706.1|  PREDICTED: probable apyrase 4                      134   1e-32   Brassica rapa
tpg|DAA48968.1|  TPA: putative nucleoside phosphatase GDA1/CD39 f...    130   3e-32   
dbj|BAD95196.1|  nucleoside triphosphatase like protein                 125   4e-32   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK05639.1|  predicted protein                                      132   6e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY39332.1|  BnaC05g10470D                                          132   7e-32   Brassica napus [oilseed rape]
gb|EEC83627.1|  hypothetical protein OsI_29353                          132   1e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_003557820.1|  PREDICTED: probable apyrase 6                      131   1e-31   Brachypodium distachyon [annual false brome]
ref|XP_004973524.1|  PREDICTED: probable apyrase 6-like isoform X3      131   1e-31   Setaria italica
ref|XP_004973522.1|  PREDICTED: probable apyrase 6-like isoform X1      131   1e-31   Setaria italica
ref|XP_008675061.1|  PREDICTED: LOC100281594 isoform X3                 130   2e-31   Zea mays [maize]
ref|XP_008675054.1|  PREDICTED: LOC100281594 isoform X2                 130   3e-31   Zea mays [maize]
ref|XP_009148707.1|  PREDICTED: probable apyrase 5                      130   3e-31   Brassica rapa
emb|CDY49103.1|  BnaA06g09030D                                          130   3e-31   Brassica napus [oilseed rape]
ref|XP_006417036.1|  hypothetical protein EUTSA_v10007616mg             129   5e-31   
emb|CDY39331.1|  BnaC05g10480D                                          129   6e-31   Brassica napus [oilseed rape]
gb|KFK43669.1|  hypothetical protein AALP_AA1G157600                    126   9e-31   Arabis alpina [alpine rockcress]
ref|XP_006575168.1|  PREDICTED: probable apyrase 6-like                 129   1e-30   Glycine max [soybeans]
ref|XP_010476473.1|  PREDICTED: probable apyrase 3                      128   1e-30   
ref|NP_001031045.1|  probable apyrase 3                                 127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172876.1|  probable apyrase 3                                    127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917047.1|  PREDICTED: probable apyrase 6 isoform X2           127   3e-30   
ref|XP_002444398.1|  hypothetical protein SORBIDRAFT_07g021350          127   3e-30   Sorghum bicolor [broomcorn]
ref|XP_010462697.1|  PREDICTED: probable apyrase 3                      126   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006307363.1|  hypothetical protein CARUB_v10008986mg             127   4e-30   Capsella rubella
ref|XP_006605578.1|  PREDICTED: probable apyrase 6-like isoform X2      127   4e-30   Glycine max [soybeans]
ref|XP_006417037.1|  hypothetical protein EUTSA_v10007743mg             125   2e-29   
ref|XP_010235177.1|  PREDICTED: probable apyrase 6 isoform X2           125   2e-29   Brachypodium distachyon [annual false brome]
emb|CDX81623.1|  BnaC08g39780D                                          125   2e-29   
ref|XP_006417035.1|  hypothetical protein EUTSA_v10009320mg             124   6e-29   
ref|XP_010652014.1|  PREDICTED: probable apyrase 6 isoform X3           123   6e-29   Vitis vinifera
emb|CAN81571.1|  hypothetical protein VITISV_013770                     123   2e-28   Vitis vinifera
ref|XP_006417038.1|  hypothetical protein EUTSA_v10007501mg             121   5e-28   
ref|XP_002961510.1|  hypothetical protein SELMODRAFT_63506              119   1e-27   
ref|XP_008792491.1|  PREDICTED: probable apyrase 6 isoform X3           116   3e-26   
ref|XP_006605577.1|  PREDICTED: probable apyrase 6-like isoform X1      115   1e-25   
gb|KJB50645.1|  hypothetical protein B456_008G180900                    113   2e-25   Gossypium raimondii
ref|XP_010939490.1|  PREDICTED: probable apyrase 6 isoform X2           113   3e-25   
ref|XP_008675069.1|  PREDICTED: LOC100281594 isoform X4                 112   1e-24   
ref|XP_010066912.1|  PREDICTED: probable apyrase 6 isoform X2           109   7e-24   Eucalyptus grandis [rose gum]
ref|XP_010685507.1|  PREDICTED: probable apyrase 6                      108   3e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN35441.1|  unknown                                               99.0    5e-22   Zea mays [maize]
ref|XP_007205208.1|  hypothetical protein PRUPE_ppa005867mg             102   1e-21   
ref|XP_010269618.1|  PREDICTED: probable apyrase 6 isoform X2         95.9    6e-21   Nelumbo nucifera [Indian lotus]
gb|AFK33538.1|  unknown                                               95.9    6e-21   Lotus japonicus
ref|XP_010269619.1|  PREDICTED: probable apyrase 6 isoform X3         95.1    7e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010269617.1|  PREDICTED: probable apyrase 6 isoform X1         94.7    3e-20   Nelumbo nucifera [Indian lotus]
emb|CDY33760.1|  BnaA09g45660D                                        92.0    9e-20   Brassica napus [oilseed rape]
ref|XP_010277375.1|  PREDICTED: probable apyrase 6                    90.9    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010277663.1|  PREDICTED: probable apyrase 5 isoform X2         91.7    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010277662.1|  PREDICTED: uncharacterized protein LOC104612...  91.7    9e-19   Nelumbo nucifera [Indian lotus]
gb|EMS51474.1|  Nucleoside-diphosphatase mig-23                       92.8    4e-18   Triticum urartu
gb|EMT22486.1|  Nucleoside-triphosphatase ntp-1                       90.5    5e-18   
ref|XP_002521641.1|  adenosine diphosphatase, putative                90.5    3e-17   
gb|KHN01222.1|  hypothetical protein glysoja_008124                   84.7    1e-16   Glycine soja [wild soybean]
ref|XP_001760044.1|  predicted protein                                84.0    8e-15   
ref|XP_010427113.1|  PREDICTED: probable apyrase 3                    73.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_001691989.1|  predicted protein                                73.2    3e-11   Chlamydomonas reinhardtii
ref|XP_002946739.1|  hypothetical protein VOLCADRAFT_120373           73.2    3e-11   Volvox carteri f. nagariensis
ref|XP_010503068.1|  PREDICTED: probable apyrase 3                    72.0    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002505556.1|  predicted protein                                69.3    3e-10   Micromonas commoda
ref|XP_006605579.1|  PREDICTED: probable apyrase 6-like isoform X3    68.2    8e-10   Glycine max [soybeans]
gb|AAL82534.1|AC084766_20  putative apyrase                           67.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006292202.1|  hypothetical protein CARUB_v10018407mg           64.3    2e-08   
ref|XP_001781092.1|  predicted protein                                61.6    2e-07   
ref|XP_007509972.1|  predicted protein                                60.8    3e-07   Bathycoccus prasinos
emb|CDX85159.1|  BnaC07g07470D                                        56.2    4e-07   
ref|XP_003063669.1|  predicted protein                                59.3    7e-07   Micromonas pusilla CCMP1545
ref|XP_008430362.1|  PREDICTED: ectonucleoside triphosphate dipho...  58.5    2e-06   Poecilia reticulata
emb|CDX78924.1|  BnaA01g09910D                                        55.5    2e-05   
ref|XP_009132598.1|  PREDICTED: probable apyrase 7                    55.5    2e-05   Brassica rapa
ref|XP_005772842.1|  hypothetical protein EMIHUDRAFT_208242           52.4    2e-05   Emiliania huxleyi CCMP1516
emb|CDX99396.1|  BnaC01g11560D                                        55.1    3e-05   
gb|KJB51504.1|  hypothetical protein B456_008G219700                  55.1    3e-05   Gossypium raimondii
emb|CDY01587.1|  BnaC07g35770D                                        55.1    3e-05   
gb|ADG38760.1|  AT4G19180-like protein                                53.5    3e-05   Capsella grandiflora
dbj|BAJ93718.1|  predicted protein                                    55.1    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96922.1|  predicted protein                                    54.7    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEN82492.1|  AT4G19180-like protein                                53.5    3e-05   Capsella rubella
gb|ADG38761.1|  AT4G19180-like protein                                53.5    3e-05   Capsella grandiflora
gb|KHG13526.1|  Ectonucleoside triphosphate diphosphohydrolase 1      55.1    3e-05   Gossypium arboreum [tree cotton]
ref|XP_001783110.1|  predicted protein                                54.3    4e-05   
ref|XP_001298946.1|  hypothetical protein                             54.3    4e-05   Trichomonas vaginalis G3
ref|XP_006640616.1|  PREDICTED: ectonucleoside triphosphate dipho...  54.3    4e-05   
ref|XP_006282448.1|  hypothetical protein CARUB_v10004214mg           54.7    4e-05   Capsella rubella
ref|XP_001752330.1|  predicted protein                                54.3    4e-05   
ref|XP_007254407.1|  PREDICTED: ectonucleoside triphosphate dipho...  54.3    4e-05   Astyanax mexicanus [blind cave fish]
ref|XP_006413999.1|  hypothetical protein EUTSA_v10024508mg           54.3    5e-05   Eutrema salsugineum [saltwater cress]
gb|ADG38766.1|  AT4G19180-like protein                                52.8    5e-05   Neslia paniculata [ball mustard]
ref|NP_001002379.2|  ectonucleoside triphosphate diphosphohydrola...  54.3    5e-05   Danio rerio [leopard danio]
ref|XP_010434438.1|  PREDICTED: probable apyrase 7                    54.3    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009136998.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...  54.3    5e-05   Brassica rapa
ref|XP_002867950.1|  nucleoside phosphatase family protein            54.3    5e-05   
ref|XP_010449381.1|  PREDICTED: probable apyrase 7                    53.9    6e-05   Camelina sativa [gold-of-pleasure]
emb|CAA16707.1|  putative protein                                     53.9    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003208112.1|  PREDICTED: ectonucleoside triphosphate dipho...  53.5    7e-05   Meleagris gallopavo [common turkey]
ref|XP_002978228.1|  hypothetical protein SELMODRAFT_443766           53.9    7e-05   Selaginella moellendorffii
ref|NP_567579.2|  GDA1/CD39 nucleoside phosphatase family protein     53.9    7e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010712883.1|  PREDICTED: ectonucleoside triphosphate dipho...  53.5    7e-05   Meleagris gallopavo [common turkey]
gb|EMS62472.1|  Ectonucleoside triphosphate diphosphohydrolase 8      53.5    7e-05   Triticum urartu
ref|XP_009588053.1|  PREDICTED: probable apyrase 7                    53.5    8e-05   Nicotiana tomentosiformis
ref|XP_010712882.1|  PREDICTED: ectonucleoside triphosphate dipho...  53.5    8e-05   
ref|XP_006355646.1|  PREDICTED: probable apyrase 7-like               53.5    8e-05   Solanum tuberosum [potatoes]
ref|XP_009804492.1|  PREDICTED: probable apyrase 7                    53.5    9e-05   Nicotiana sylvestris
ref|XP_004239949.1|  PREDICTED: probable apyrase 7                    53.5    9e-05   Solanum lycopersicum
ref|XP_002966332.1|  hypothetical protein SELMODRAFT_407789           53.1    9e-05   
ref|XP_010535960.1|  PREDICTED: probable apyrase 7                    53.1    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_003538924.1|  PREDICTED: probable apyrase 7-like               53.1    1e-04   Glycine max [soybeans]
gb|KHN41783.1|  Auxin-induced protein 5NG4                            53.1    1e-04   Glycine soja [wild soybean]
ref|XP_001579703.1|  hypothetical protein                             52.8    1e-04   Trichomonas vaginalis G3
ref|XP_002950854.1|  hypothetical protein VOLCADRAFT_91259            52.4    2e-04   Volvox carteri f. nagariensis
ref|XP_007158059.1|  hypothetical protein PHAVU_002G120700g           52.4    2e-04   Phaseolus vulgaris [French bean]
ref|XP_009420860.1|  PREDICTED: probable apyrase 7                    52.4    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007535478.1|  PREDICTED: ectonucleoside triphosphate dipho...  52.0    2e-04   Erinaceus europaeus [common hedgehog]
ref|XP_003517106.1|  PREDICTED: probable apyrase 7-like isoformX1     52.4    2e-04   Glycine max [soybeans]
gb|EMT02116.1|  Ectonucleoside triphosphate diphosphohydrolase 8      52.0    3e-04   
ref|XP_010054004.1|  PREDICTED: probable apyrase 7                    52.0    3e-04   
emb|CDP13976.1|  unnamed protein product                              52.0    3e-04   Coffea canephora [robusta coffee]
ref|XP_003557508.1|  PREDICTED: probable apyrase 7                    51.6    3e-04   Brachypodium distachyon [annual false brome]
ref|XP_001778140.1|  predicted protein                                51.6    3e-04   
ref|XP_007156349.1|  hypothetical protein PHAVU_003G279000g           51.6    4e-04   Phaseolus vulgaris [French bean]
ref|XP_003548590.1|  PREDICTED: probable apyrase 7-like isoform X1    51.6    4e-04   Glycine max [soybeans]
gb|KHN16963.1|  Ectonucleoside triphosphate diphosphohydrolase 1      51.6    4e-04   Glycine soja [wild soybean]
ref|XP_006038143.1|  PREDICTED: ectonucleoside triphosphate dipho...  51.2    4e-04   
ref|XP_006599123.1|  PREDICTED: probable apyrase 7-like isoform X3    51.2    4e-04   
ref|XP_005811066.1|  PREDICTED: ectonucleoside triphosphate dipho...  51.2    5e-04   Xiphophorus maculatus
ref|XP_006038142.1|  PREDICTED: ectonucleoside triphosphate dipho...  50.8    5e-04   
ref|XP_008377056.1|  PREDICTED: probable apyrase 7                    51.2    6e-04   Malus domestica [apple tree]
ref|XP_010111782.1|  Ectonucleoside triphosphate diphosphohydrola...  51.2    6e-04   Morus notabilis
emb|CDQ63880.1|  unnamed protein product                              50.8    6e-04   Oncorhynchus mykiss
ref|XP_005048502.1|  PREDICTED: ectonucleoside triphosphate dipho...  50.8    6e-04   Ficedula albicollis
ref|XP_005048501.1|  PREDICTED: ectonucleoside triphosphate dipho...  50.8    6e-04   Ficedula albicollis
ref|XP_009640383.1|  PREDICTED: ectonucleoside triphosphate dipho...  50.4    7e-04   Egretta garzetta
ref|XP_005417423.1|  PREDICTED: ectonucleoside triphosphate dipho...  50.8    7e-04   
ref|XP_002291787.1|  apyrase                                          50.4    8e-04   Thalassiosira pseudonana CCMP1335
ref|XP_009117915.1|  PREDICTED: probable apyrase 3                    47.8    8e-04   Brassica rapa
gb|KFQ81630.1|  Ectonucleoside triphosphate diphosphohydrolase 1      50.4    8e-04   Phoenicopterus ruber ruber
ref|XP_006599122.1|  PREDICTED: probable apyrase 7-like isoform X2    50.4    8e-04   
ref|XP_008939587.1|  PREDICTED: ectonucleoside triphosphate dipho...  50.1    9e-04   Merops nubicus
ref|XP_010277647.1|  PREDICTED: probable apyrase 7                    50.4    9e-04   
ref|XP_006385169.1|  nucleoside phosphatase family protein            50.4    9e-04   
ref|XP_006482408.1|  PREDICTED: probable apyrase 7-like isoform X1    50.4    0.001   
gb|KDO72274.1|  hypothetical protein CISIN_1g039222mg                 50.4    0.001   
ref|XP_008221118.1|  PREDICTED: probable apyrase 7                    50.4    0.001   
ref|XP_010936778.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...  50.4    0.001   
ref|XP_007221964.1|  hypothetical protein PRUPE_ppa001790mg           50.4    0.001   
ref|XP_006830097.1|  hypothetical protein AMTR_s00123p00080920        50.4    0.001   
ref|XP_010879360.1|  PREDICTED: ectonucleoside triphosphate dipho...  50.1    0.001   



>ref|XP_009773397.1| PREDICTED: probable apyrase 6 [Nicotiana sylvestris]
Length=541

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL PKAFLS++M AGK FCEEDWS+L+++YHSL E+D+  YCFSSAYI+AL
Sbjct  378  NFFHTSKFFGLPPKAFLSDLMAAGKSFCEEDWSRLKSKYHSLQEQDLHRYCFSSAYILAL  437

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI LDD+RIGYANQ  NIPLDWALGAFILQS ++LD+E S WFA MF +D  I +
Sbjct  438  LHDSLGIGLDDDRIGYANQVENIPLDWALGAFILQSTAELDKEHSGWFANMFSEDSLILL  497

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
            L     IL++F   YV KWR PQLKTVYDLEKGKYIV RV R S
Sbjct  498  LFFAFFILVMFTAWYVSKWRKPQLKTVYDLEKGKYIVTRVGRCS  541



>ref|XP_009616750.1| PREDICTED: probable apyrase 6 [Nicotiana tomentosiformis]
Length=541

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL PKAFLS++M AGK FCEEDWS+L+++YHSL EED+  YCFSSAYI+AL
Sbjct  378  NFFHTSKFFGLPPKAFLSDLMAAGKSFCEEDWSRLKSKYHSLQEEDLHRYCFSSAYILAL  437

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI LDD+RIGYANQ  NIPLDWALGAFILQS ++ D+E S WFA MF +D  I +
Sbjct  438  LHDSLGIGLDDDRIGYANQVENIPLDWALGAFILQSTAESDKEHSGWFANMFSEDSLILL  497

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
            L     IL++F   YV KWR PQLKTVYDLEKGKYIV RV R S
Sbjct  498  LFFAFFILVMFTAWYVSKWRKPQLKTVYDLEKGKYIVTRVGRCS  541



>ref|XP_004238804.1| PREDICTED: probable apyrase 6 [Solanum lycopersicum]
Length=542

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FFGL PKAFLS++M AGK FCEEDWS L+++Y SL EED+  YCFSSAYI+AL
Sbjct  379  NFFYTSRFFGLPPKAFLSDLMAAGKSFCEEDWSSLKSKYPSLQEEDLHRYCFSSAYILAL  438

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDD+RIGYANQ  NIPLDWALGAFILQS ++LD+E S WFA MF +D  I +
Sbjct  439  LHDSLGIALDDDRIGYANQVENIPLDWALGAFILQSTAELDKEHSGWFANMFSEDSLILL  498

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
            L     IL++F   YV KWR PQLKTVYDLEKGKYIV RV R S
Sbjct  499  LFFAFFILVMFTAWYVSKWRKPQLKTVYDLEKGKYIVTRVGRCS  542



>ref|XP_006355131.1| PREDICTED: probable apyrase 6-like [Solanum tuberosum]
Length=542

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FFGL PKAFLS++M AGK FCEEDWS L+++Y SL EED+  YCFSSAYI+AL
Sbjct  379  NFFYTSRFFGLPPKAFLSDLMAAGKSFCEEDWSSLKSKYPSLQEEDLHRYCFSSAYILAL  438

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDD+RIGYANQ  NIPLDWALGAFILQS ++LD+E S WFA MF +D  I +
Sbjct  439  LHDSLGIALDDDRIGYANQVENIPLDWALGAFILQSTAELDKEHSGWFANMFSEDSLILL  498

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
            L     IL++F   YV KWR PQLKTVYDLEKGKYIV RV R S
Sbjct  499  LFFAFFILVMFTAWYVSKWRKPQLKTVYDLEKGKYIVTRVGRCS  542



>ref|XP_008352982.1| PREDICTED: probable apyrase 6 [Malus domestica]
Length=245

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL+PKA LS++M+AG++FC EDWSK++  + +L EE +LHYCFSSAY VAL
Sbjct  83   NFFYTSKFFGLAPKAXLSDLMIAGQQFCGEDWSKIKKRWPTLDEEALLHYCFSSAYAVAL  142

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ALDDERIG+ANQ  +IPLDWALGAFILQS SD D   S W   + GD     +
Sbjct  143  LHDSLGLALDDERIGFANQVGSIPLDWALGAFILQSTSDXDVGHSDWLTTIIGDGSPTLL  202

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ I  +L+F    V KWR PQLKT+YDLEKG+YIV RVS+
Sbjct  203  SIIFIFSILMFTVWXVSKWRKPQLKTIYDLEKGRYIVTRVSK  244



>emb|CBI31953.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++ VAG+ FCEEDWSKL+ +Y+S  EED+LHYCFSSAYIVA 
Sbjct  210  NFFYTSKFFGLGSRAFLSDLTVAGQHFCEEDWSKLKRKYYSFNEEDLLHYCFSSAYIVAF  269

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERIGYANQ  +IPLDWALGAFILQS ++L+ E S W   +  D+    +
Sbjct  270  LHDSLGIALDDERIGYANQVGDIPLDWALGAFILQSTTNLEAEHSDWITTVVSDESPTLL  329

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
             ++ I I+L+F    + K + PQLKT+YDLEKG+YIV R++R S
Sbjct  330  SLVVILIILMFTVWSISKCKKPQLKTIYDLEKGRYIVTRINRCS  373



>ref|XP_011075504.1| PREDICTED: probable apyrase 6 [Sesamum indicum]
Length=542

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +AFLS+++V+G++FC EDWSKL  +Y+SL EED+L YCFSSAYIVA+
Sbjct  380  NFFHTSKFFGLDQRAFLSDLVVSGQQFCAEDWSKLAQKYNSLEEEDLLRYCFSSAYIVAM  439

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDD+RIGYANQ ++IPLDWALGAFILQS ++LD  SS W A + G   S   
Sbjct  440  LHDSLGIALDDQRIGYANQVHDIPLDWALGAFILQSAAELD-ASSDWMATVIGGKSSPLP  498

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
            L+ GI ILLI V+  V KWR PQLKT+YDLEKGKYIV RV RYS
Sbjct  499  LLFGIFILLILVSWLVSKWRKPQLKTIYDLEKGKYIVTRVGRYS  542



>ref|XP_002522436.1| adenosine diphosphatase, putative [Ricinus communis]
 gb|EEF39928.1| adenosine diphosphatase, putative [Ricinus communis]
Length=532

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS +++AG++FC EDWSKLR ++HSL ++D++ YCFSSAYIVAL
Sbjct  370  NFFYTSKFFGLGKRAFLSNLIMAGEQFCGEDWSKLRKKHHSLDDDDLIRYCFSSAYIVAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERIGYAN+  N+PLDWALGAFILQS ++LD +   W A +  DD    I
Sbjct  430  LHDSLGIALDDERIGYANEVGNMPLDWALGAFILQSTAELDMQHPDWIATIINDDSPTLI  489

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ I+ILL+FV   + KWR PQLKTVYDLEKG+YIV RV R
Sbjct  490  SLIAIAILLMFVAWSISKWRKPQLKTVYDLEKGRYIVTRVGR  531



>ref|XP_002273709.1| PREDICTED: probable apyrase 6 isoform X2 [Vitis vinifera]
Length=523

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++ VAG+ FCEEDWSKL+ +Y+S  EED+LHYCFSSAYIVA 
Sbjct  360  NFFYTSKFFGLGSRAFLSDLTVAGQHFCEEDWSKLKRKYYSFNEEDLLHYCFSSAYIVAF  419

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERIGYANQ  +IPLDWALGAFILQS ++L+ E S W   +  D+    +
Sbjct  420  LHDSLGIALDDERIGYANQVGDIPLDWALGAFILQSTTNLEAEHSDWITTVVSDESPTLL  479

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
             ++ I I+L+F    + K + PQLKT+YDLEKG+YIV R++R S
Sbjct  480  SLVVILIILMFTVWSISKCKKPQLKTIYDLEKGRYIVTRINRCS  523



>ref|XP_010652003.1| PREDICTED: probable apyrase 6 isoform X1 [Vitis vinifera]
Length=529

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++ VAG+ FCEEDWSKL+ +Y+S  EED+LHYCFSSAYIVA 
Sbjct  366  NFFYTSKFFGLGSRAFLSDLTVAGQHFCEEDWSKLKRKYYSFNEEDLLHYCFSSAYIVAF  425

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERIGYANQ  +IPLDWALGAFILQS ++L+ E S W   +  D+    +
Sbjct  426  LHDSLGIALDDERIGYANQVGDIPLDWALGAFILQSTTNLEAEHSDWITTVVSDESPTLL  485

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
             ++ I I+L+F    + K + PQLKT+YDLEKG+YIV R++R S
Sbjct  486  SLVVILIILMFTVWSISKCKKPQLKTIYDLEKGRYIVTRINRCS  529



>ref|XP_009360337.1| PREDICTED: probable apyrase 6 isoform X1 [Pyrus x bretschneideri]
Length=547

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGLSP  FLS +M+AG++FC EDWSK++  Y ++ EE +LHYCFSSAY VAL
Sbjct  386  NFFYTSKFFGLSPNGFLSNLMMAGQQFCGEDWSKIKKRYPTVDEEALLHYCFSSAYAVAL  445

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERIG+ANQ  +IPLDWALGAFILQS SDLD   S W   +  D     +
Sbjct  446  LHDSLGIALDDERIGFANQVGSIPLDWALGAFILQSTSDLDVGHSDWLTAIIDDGSPTLL  505

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             V+ I  +L+F    + KWR PQLKT+YDLEKG+YIV RVSR
Sbjct  506  SVIFIFSILMFTVWSLSKWRKPQLKTIYDLEKGRYIVTRVSR  547



>gb|KDO82926.1| hypothetical protein CISIN_1g009360mg [Citrus sinensis]
Length=536

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +AFLS +++AG++FC EDWSKL+ ++ SL +ED+L YCFSSAYIVAL
Sbjct  375  NFFHTSKFFGLHQRAFLSHLLMAGEQFCGEDWSKLKKKHQSLDDEDLLRYCFSSAYIVAL  434

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+LDDERIG+ANQ  NIPLDWALGAFILQS + LDE    W + +  DD    +
Sbjct  435  LHDSLGISLDDERIGFANQVENIPLDWALGAFILQSTAVLDELHPSWISTIISDDSPTLL  494

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ +SI+L+ +   + KWR PQLKT+YDLEKG+YI+ RV+R
Sbjct  495  SLIALSIMLMVIAWSISKWRKPQLKTIYDLEKGRYIISRVNR  536



>ref|XP_008361885.1| PREDICTED: probable apyrase 6 [Malus domestica]
Length=537

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL+PKA LS++M+AG++FC EDWSK++  + +L EE +LHYCFSSAY VAL
Sbjct  375  NFFYTSKFFGLAPKAXLSDLMIAGQQFCGEDWSKIKKRWPTLDEEALLHYCFSSAYAVAL  434

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ALDDERIG+ANQ  +IPLDWALGAFILQS SD D   S W   + GD     +
Sbjct  435  LHDSLGLALDDERIGFANQVGSIPLDWALGAFILQSTSDXDVGHSDWLTTIIGDGSPTLL  494

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ I  +L+F    V KWR PQLKT+YDLEKG+YIV RVS+
Sbjct  495  SIIFIFSILMFTVWXVSKWRKPQLKTIYDLEKGRYIVTRVSK  536



>ref|XP_008221615.1| PREDICTED: probable apyrase 6 isoform X1 [Prunus mume]
Length=549

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL+ KAFLS++M+AG++FC EDWSKL+  +H L EE +LHYCFSSAY VAL
Sbjct  388  NFFHTSKFFGLASKAFLSDLMMAGQQFCGEDWSKLKKRHHRLDEEALLHYCFSSAYTVAL  447

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIA+DDERI  ANQ  +IPLDWALGAFILQS SDLD   S W + +  D     +
Sbjct  448  LHDSLGIAMDDERIRVANQVGSIPLDWALGAFILQSKSDLDVGHSDWISTVISDGSPTLL  507

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ I  +L+F    + KWR PQLKT+YDLEKG+YIV RVSR
Sbjct  508  SLIFIFAILMFTVWSLSKWRKPQLKTIYDLEKGRYIVTRVSR  549



>ref|XP_002312246.1| nucleoside phosphatase family protein [Populus trichocarpa]
 gb|EEE89613.1| nucleoside phosphatase family protein [Populus trichocarpa]
Length=536

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS +M+AG+ FC EDWS L+ ++HS  +ED++HYCFSSAYIVAL
Sbjct  374  NFFYTSKFFGLGQRAFLSNLMIAGEHFCGEDWSTLKKKHHSFKDEDLVHYCFSSAYIVAL  433

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIA+DD RI +ANQ  NIPLDWALGAFIL +N  LD E S W A +  DD    +
Sbjct  434  LHDSLGIAVDDPRIEFANQVGNIPLDWALGAFILHTNVALDMEHSDWIATIISDDSPTLL  493

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++G +IL++F+   + KWR PQLKTVYDLEKG+YIV RV +
Sbjct  494  SLIGFAILIMFIAWSISKWRKPQLKTVYDLEKGRYIVTRVGK  535



>ref|XP_007223149.1| hypothetical protein PRUPE_ppa003785mg [Prunus persica]
 gb|EMJ24348.1| hypothetical protein PRUPE_ppa003785mg [Prunus persica]
Length=549

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL+ KAFL ++M+AG++FC EDWSKL+  +H L EE +LHYCFSSAY VAL
Sbjct  388  NFFHTSKFFGLASKAFLPDLMMAGQQFCGEDWSKLKKRHHRLDEEALLHYCFSSAYTVAL  447

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIA+DDERI  ANQ  +IPLDWALGAFILQS SDLD   S W + +  D     +
Sbjct  448  LHDSLGIAMDDERIRVANQVGSIPLDWALGAFILQSTSDLDVGHSDWISTVISDGSPTLL  507

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ I  +L+F    + KWR PQLKT+YDLEKG+YIV RVSR
Sbjct  508  SLIFIFAILMFTVWSLSKWRKPQLKTIYDLEKGRYIVTRVSR  549



>ref|XP_008389467.1| PREDICTED: probable apyrase 6 isoform X1 [Malus domestica]
Length=546

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGLSPK FLS +M+AG++FC EDWSK++  Y ++ EE +LHYCFSSAY VAL
Sbjct  385  NFFYTSKFFGLSPKGFLSNLMMAGQQFCGEDWSKIKKRYPTVDEEALLHYCFSSAYAVAL  444

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERIG+ANQ  +IPLDWALGAFILQS SDLD   S     +  D     +
Sbjct  445  LHDSLGIALDDERIGFANQVGSIPLDWALGAFILQSTSDLDVGHSDRLTAIIDDGSPTLL  504

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             V+ I  +L+F    + KWR PQLKT+YDLEKG+YIV RVSR
Sbjct  505  SVIFIFSILMFTVWSLSKWRKPQLKTIYDLEKGRYIVTRVSR  546



>emb|CDP00335.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +AFLS+++VAG+RFCE+DWSKL+ +Y+SL ++D+L YCFSSAYIVAL
Sbjct  368  NFFHTSKFFGLGRQAFLSDLVVAGERFCEDDWSKLKMKYYSLDDDDLLRYCFSSAYIVAL  427

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERI YANQ  NIPLDWALGAFILQS +  D E S   A +   D    +
Sbjct  428  LHDSLGIALDDERIVYANQVENIPLDWALGAFILQSRTSTDYEHSPSVASVIAGDSFTLL  487

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
            ++ G+ ++LIF   Y  +   PQLKT+YDLEKGKYIV RVSRYS
Sbjct  488  ILFGVLVVLIFTVWYFSRCGKPQLKTIYDLEKGKYIVTRVSRYS  531



>ref|XP_006483153.1| PREDICTED: probable apyrase 6-like [Citrus sinensis]
Length=536

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +AFLS +++AG++FC EDWSKL+ ++ SL +ED+L YCFSSAYIVAL
Sbjct  375  NFFHTSKFFGLHQRAFLSHLLMAGEQFCGEDWSKLKKKHQSLDDEDLLRYCFSSAYIVAL  434

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+LDDERI +ANQ  NIPLDWALGAFILQS + LDE    W + +  DD    +
Sbjct  435  LHDSLGISLDDERIRFANQVENIPLDWALGAFILQSTAVLDELHPSWISTIISDDSPTLL  494

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ +SI+L+ +   + KWR PQLKT+YDLEKG+YI+ RV+R
Sbjct  495  SLIALSIMLMVIAWSISKWRKPQLKTIYDLEKGRYIISRVNR  536



>ref|XP_006438694.1| hypothetical protein CICLE_v10031190mg [Citrus clementina]
 gb|ESR51934.1| hypothetical protein CICLE_v10031190mg [Citrus clementina]
Length=536

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +AFLS +++AG++FC EDWSKL+ ++ SL +ED+L YCFSSAYIVAL
Sbjct  375  NFFHTSKFFGLHQRAFLSHLLMAGEQFCGEDWSKLKKKHRSLDDEDLLRYCFSSAYIVAL  434

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+LDDERI +ANQ  NIPLDWALGAFILQS + LDE    W + +  DD    +
Sbjct  435  LHDSLGISLDDERIRFANQVENIPLDWALGAFILQSTAVLDELHPSWISTIISDDSPTLL  494

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ +SI+L+ +   + KWR PQLKT+YDLEKG+YI+ RV+R
Sbjct  495  SLIALSIMLMVIAWSISKWRKPQLKTIYDLEKGRYIISRVNR  536



>ref|XP_011017112.1| PREDICTED: probable apyrase 6 isoform X2 [Populus euphratica]
Length=536

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS +++AG+ FC EDWS L+ ++HSL +ED++HYCFSSAYIVAL
Sbjct  374  NFFYTSKFFGLGQRAFLSNLVIAGEHFCGEDWSMLKKKHHSLKDEDLVHYCFSSAYIVAL  433

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIA DD RI +A+Q  NIPLDWALGAFIL +N  LD E S W A +  DD    +
Sbjct  434  LHDSLGIAFDDPRIEFASQVGNIPLDWALGAFILHTNVALDMEHSDWIATIISDDSPTLL  493

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++G +IL++ +   V KWR PQLKTVYDLEKG+YIV RV +
Sbjct  494  SLIGFAILMMVIAWSVSKWRKPQLKTVYDLEKGRYIVTRVGK  535



>gb|EYU28756.1| hypothetical protein MIMGU_mgv1a004089mg [Erythranthe guttata]
Length=544

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +A LS+++VAG++FC EDWSKL  +Y+ L EED+L YCFSSAYIVAL
Sbjct  380  NFFHTSKFFGLGQRALLSDLVVAGQQFCGEDWSKLTQKYNFLDEEDLLRYCFSSAYIVAL  439

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKW-FAFMFGDDlsis  407
            LHDSLGI+L+D+RIGYAN+ +N+PLDWALGAFIL+S +DL+ + S W    + G   S  
Sbjct  440  LHDSLGISLNDQRIGYANEVHNVPLDWALGAFILESAADLEAKHSDWRMGTIIGGKYSPW  499

Query  406  ilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRYS  272
             ++ GI ++LIF + +V KWR PQ+KT+YDLEKGKYIV R+ RYS
Sbjct  500  QILFGIFLVLIFASWFVSKWRKPQVKTIYDLEKGKYIVTRIGRYS  544



>ref|XP_011017105.1| PREDICTED: probable apyrase 6 isoform X1 [Populus euphratica]
Length=544

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS +++AG+ FC EDWS L+ ++HSL +ED++HYCFSSAYIVAL
Sbjct  382  NFFYTSKFFGLGQRAFLSNLVIAGEHFCGEDWSMLKKKHHSLKDEDLVHYCFSSAYIVAL  441

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIA DD RI +A+Q  NIPLDWALGAFIL +N  LD E S W A +  DD    +
Sbjct  442  LHDSLGIAFDDPRIEFASQVGNIPLDWALGAFILHTNVALDMEHSDWIATIISDDSPTLL  501

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++G +IL++ +   V KWR PQLKTVYDLEKG+YIV RV +
Sbjct  502  SLIGFAILMMVIAWSVSKWRKPQLKTVYDLEKGRYIVTRVGK  543



>gb|KHG17053.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Gossypium arboreum]
Length=577

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFF L  +AFLS++++AGK FCEEDWSKL+ ++ SL EED+L YCFSSAYIVAL
Sbjct  415  NFFYTSKFFRLRQRAFLSDLIMAGKHFCEEDWSKLKKKHQSLNEEDLLRYCFSSAYIVAL  474

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSL IALDDERI +ANQ N+IPLDWALGAFILQS +  D + + W   +   D S  I
Sbjct  475  LHDSLEIALDDERISFANQVNDIPLDWALGAFILQSTTISDVQQTDWITIIMSSDSSTLI  534

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  IS +L+F    + KWR PQLKTVYDLEKG+YI+ R+ R
Sbjct  535  SITAISAILMFAAWSISKWRKPQLKTVYDLEKGRYIITRIGR  576



>gb|KJB80188.1| hypothetical protein B456_013G085700 [Gossypium raimondii]
Length=545

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFF L  +AFLS +++AGK FCEEDWS L+ ++ SL EED+L YCFSSAYIVAL
Sbjct  383  NFFYTSKFFRLRQRAFLSNLIMAGKHFCEEDWSNLKKKHQSLNEEDLLRYCFSSAYIVAL  442

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSL IALDDERI +ANQ N+IPLDWALGAFILQS S  D + + W   +   D S  I
Sbjct  443  LHDSLEIALDDERISFANQVNDIPLDWALGAFILQSTSISDVQQTDWITIIMSSDSSTLI  502

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  IS +L+F    + KWR PQLKTVYDLEKG+YIV R+ R
Sbjct  503  SITAISAILMFAAWSISKWRKPQLKTVYDLEKGRYIVTRIGR  544



>gb|KDP41200.1| hypothetical protein JCGZ_15607 [Jatropha curcas]
Length=524

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL PKAFLS++++AG+ FC EDWS+L+ ++ SL ++D++ YCFSSAYIVAL
Sbjct  362  NFFYTSKFFGLGPKAFLSDLIMAGEHFCGEDWSRLKKKHQSLDDDDLMRYCFSSAYIVAL  421

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDD RIGY N   N+PLDWALG FILQ+ +  + +   W   + GDD    I
Sbjct  422  LHDSLGIALDDGRIGYVNNVGNLPLDWALGTFILQNTAASNVQHPDWITNIIGDDSPTMI  481

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ I+ LL+F+   + KWR PQLKT+YDLEKG+YIV RV R
Sbjct  482  SLIAIATLLMFIAWSISKWRKPQLKTIYDLEKGRYIVTRVGR  523



>ref|XP_010257480.1| PREDICTED: probable apyrase 6 [Nelumbo nucifera]
Length=548

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL+P A LS++M+AG++FCE+DWS L+ +Y +LAE D+  YCFSSAYIVAL
Sbjct  387  NFFYTSKFFGLAPTASLSDLMLAGQQFCEDDWSNLKKKYGALAENDLQRYCFSSAYIVAL  446

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+LDD+RIG+ NQ  +IPLDWALG FILQ+ ++LD E S W A +  DD S  I
Sbjct  447  LHDSLGISLDDKRIGFTNQVGDIPLDWALGTFILQNTANLDVELSDWIATIARDDSSALI  506

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  +  +LIF    + +WR PQLKT+YDLEKG+YIV RV+R
Sbjct  507  SLFFVLSILIFTAWSLSRWRKPQLKTIYDLEKGRYIVMRVNR  548



>ref|XP_004297300.1| PREDICTED: probable apyrase 6 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=551

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL P+A+LS +M+AG++FC EDWSKL+  Y +  +E +L YCFSSAY VAL
Sbjct  389  NFFHTSKFFGLGPRAYLSNLMIAGQQFCGEDWSKLKKRYQAFDDEALLQYCFSSAYSVAL  448

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+LGI+LDDERI  ANQ  +IPLDWALGAFILQS SDLD  ++ W + +  D     +
Sbjct  449  LHDNLGISLDDERIRVANQIGSIPLDWALGAFILQSTSDLDVGNTDWISAIISDGSPTLL  508

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             V+ I  LL+F    + KWR PQLKT+YDLEKG+YIV R++R
Sbjct  509  SVIFIFALLLFTVWSLSKWRKPQLKTIYDLEKGRYIVTRINR  550



>gb|KJB50646.1| hypothetical protein B456_008G180900 [Gossypium raimondii]
Length=509

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFF L  +A LS++M+AG+ FC EDWSKL+ ++ SL EE++L YCFSSAYIVAL
Sbjct  347  NFFHTSKFFRLHQRASLSDLMMAGQHFCGEDWSKLKKKHQSLGEEELLRYCFSSAYIVAL  406

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERI +AN   NIPLDWALGAFILQ+ + LD +   W   +  +D     
Sbjct  407  LHDSLGIALDDERISFANLVENIPLDWALGAFILQNMAKLDAQQIDWITTIISNDSPTLF  466

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ +S +L+F+  ++ KWR P+LKTVYDLEKG+YIV R+ R
Sbjct  467  SIIAVSAILMFIAWFILKWRKPELKTVYDLEKGRYIVTRIGR  508



>gb|KJB50643.1| hypothetical protein B456_008G180900 [Gossypium raimondii]
Length=545

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFF L  +A LS++M+AG+ FC EDWSKL+ ++ SL EE++L YCFSSAYIVAL
Sbjct  383  NFFHTSKFFRLHQRASLSDLMMAGQHFCGEDWSKLKKKHQSLGEEELLRYCFSSAYIVAL  442

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERI +AN   NIPLDWALGAFILQ+ + LD +   W   +  +D     
Sbjct  443  LHDSLGIALDDERISFANLVENIPLDWALGAFILQNMAKLDAQQIDWITTIISNDSPTLF  502

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ +S +L+F+  ++ KWR P+LKTVYDLEKG+YIV R+ R
Sbjct  503  SIIAVSAILMFIAWFILKWRKPELKTVYDLEKGRYIVTRIGR  544



>gb|KGN61378.1| hypothetical protein Csa_2G100840 [Cucumis sativus]
Length=223

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++MVAG+ FC +DW KL+  Y  L EED+L YCFSSAYIVAL
Sbjct  59   NFFYTSKFFGLGSRAFLSDLMVAGEEFCGQDWLKLKERYKLLEEEDLLRYCFSSAYIVAL  118

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK--WFAFMFGDDlsi  410
            LHDSLGI L+D+ I  A Q  NIPLDWALGAFILQS + ++ E  +  W   +FG +L  
Sbjct  119  LHDSLGIELEDQSITAATQVQNIPLDWALGAFILQSTAAIEAEPEQWDWIVAIFGYELPS  178

Query  409  silvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
               ++ +SILL+F+   V KWR PQLKT+YDLEKG+YIV RV++
Sbjct  179  KFSLVAVSILLLFIAWSVSKWRKPQLKTIYDLEKGRYIVTRVTK  222



>ref|XP_007157620.1| hypothetical protein PHAVU_002G084900g [Phaseolus vulgaris]
 gb|ESW29614.1| hypothetical protein PHAVU_002G084900g [Phaseolus vulgaris]
Length=530

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL P+A+LS++M AGK FC EDWS L+ +Y S  EED+L YCFSSAYIVAL
Sbjct  370  NFYHTSKFFGLRPRAYLSKLMTAGKEFCGEDWSWLKEKYVSHKEEDLLRYCFSSAYIVAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDER+  ANQ  +IPLDWALGAFI+Q+ +D D ++  W A +F D+ S ++
Sbjct  430  LHDSLGIALDDERVKVANQVGSIPLDWALGAFIMQTTADADIQNHNWIATIFSDE-SPTL  488

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
            L +    L++     + +WR PQLKT+YDLEKG+YI+ R+ R
Sbjct  489  LSIIGFFLVLLTAWSISRWRKPQLKTIYDLEKGRYIITRIGR  530



>ref|XP_010097613.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Morus notabilis]
 gb|EXB69692.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Morus notabilis]
Length=557

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTS+FFGL  K+FL ++++AG++FC +DWSKL+  Y  L EED+ HYCFSSAYIVAL
Sbjct  394  NFFHTSEFFGLGQKSFLPDLIMAGQQFCGQDWSKLKKRYDFLHEEDLRHYCFSSAYIVAL  453

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALD+ERI  A+Q  +IPLDWALGAFILQ+ + L+ E   W A +  +D +  I
Sbjct  454  LHDSLGIALDEERITVASQVEDIPLDWALGAFILQTTAILEAEHPNWIATVISEDSTTLI  513

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ +  +L+F    V KWR PQLKT+YDLEKG+YIV RV R
Sbjct  514  SLIVVFAILMFTAWSVSKWRKPQLKTIYDLEKGRYIVTRVGR  555



>ref|XP_007046094.1| GDA1/CD39 nucleoside phosphatase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY01926.1| GDA1/CD39 nucleoside phosphatase family protein, putative isoform 
1 [Theobroma cacao]
Length=546

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFF L  +AFLS++M+AG+ FC EDWSKL+ ++ SL EED+L YCFSSAYIVAL
Sbjct  384  NFFYTSKFFRLRQRAFLSDLMIAGQHFCGEDWSKLKKKHQSLDEEDLLRYCFSSAYIVAL  443

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSL IALDDERI +ANQ  NIPLDWALGAFILQS ++ D +   W   +   D    +
Sbjct  444  LHDSLEIALDDERITFANQVENIPLDWALGAFILQSTTNSDVQQPDWITTIISKDSPTLL  503

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++ IS +LIF+   + KWR PQLKTVYDLEKG+YIV R+ R
Sbjct  504  SIIAISAILIFIAWSISKWRKPQLKTVYDLEKGRYIVTRIGR  545



>ref|XP_003517975.1| PREDICTED: probable apyrase 6-like isoformX1 [Glycine max]
Length=539

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 125/166 (75%), Gaps = 9/166 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL+P+A+LS++M AGK FC +DW +L+ +Y S  EED+L YCFSSAYIVAL
Sbjct  379  NFFYTSKFFGLTPRAYLSKLMNAGKEFCGKDWLRLKKKYVSHDEEDLLRYCFSSAYIVAL  438

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDER+  ANQ  +IPLDWALGAFILQ+ +D D ++  W A +F D+     
Sbjct  439  LHDSLGIALDDERVKVANQVGSIPLDWALGAFILQTAADADIKNHNWIATIFSDE-----  493

Query  403  lvlgisillIFVTLY----VRKWRNPQLKTVYDLEKGKYIVKRVSR  278
                +SI+ IF+ L     + +WR PQLKT+YDLEKG+YI+ RV R
Sbjct  494  SHTLLSIIGIFIVLLTAWSISRWRKPQLKTIYDLEKGRYIITRVGR  539



>ref|XP_002876854.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53113.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=553

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 125/164 (76%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  KA+LS+M+ AG+RFC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  389  NFFYTSKFFGLGEKAWLSKMISAGERFCGEDWSKLRVKDPSLDEEDILRYCFSSAYIVSL  448

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK----WFAFMFGDDl  416
            LHD+ GI LDDERIG+ANQA +IPLDWALGAFILQ+ ++  + SS     WF  +F  D 
Sbjct  449  LHDTFGIPLDDERIGFANQAGDIPLDWALGAFILQTATETSQHSSSDNLHWFHALFSHDS  508

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             +   ++GI IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  509  KLLHYIIGIPILMTALVYLVTKWRKPQLKTIYDLEKGRYIVTRI  552



>ref|XP_010683184.1| PREDICTED: probable apyrase 6 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTS+FFGLSPKA LS++M AG+ FCEE+WS +R  Y SLA+ED+LHYCFSSAYIVAL
Sbjct  390  NFFHTSQFFGLSPKAVLSDIMDAGQHFCEENWSNIRKRYSSLADEDILHYCFSSAYIVAL  449

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSL IALDD  IGY N+ +N+PLDWALGAFILQ+ +  +  +  W A +   D     
Sbjct  450  LHDSLDIALDDRSIGYTNKVDNVPLDWALGAFILQTTAASNGANHGWMASL-TSDFPNVF  508

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
            L++G++ LLIF   Y   WR P LKT+YDLEKG+YIV R++R
Sbjct  509  LIVGVAFLLIFTACYASHWRKPYLKTIYDLEKGRYIVTRINR  550



>ref|XP_008802602.1| PREDICTED: probable apyrase 6 isoform X2 [Phoenix dactylifera]
Length=555

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+T+KFFGL P +FLS++M+AG++FC EDW KL++ YHS+ EED+L YCFSSAYI+AL
Sbjct  382  NFFYTAKFFGLGPTSFLSDLMLAGEQFCGEDWLKLKSIYHSVDEEDLLRYCFSSAYIMAL  441

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+LD++RIG+ANQ  NIPLDWALGAFI+Q       E S W   + G+D S  +
Sbjct  442  LHDSLGISLDEKRIGFANQVGNIPLDWALGAFIMQKMPRQSPEHSGWITAIVGND-SSIL  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             +  +  +LI     V KWR PQLKT+YDLEKG+YI+++V+
Sbjct  501  SLFVVPSVLIMAAWTVSKWRKPQLKTIYDLEKGRYIIRQVN  541



>ref|XP_010939489.1| PREDICTED: probable apyrase 6 isoform X1 [Elaeis guineensis]
Length=542

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+T+KFFGL P +FLS++M+AG++FC EDW KL+  YHS  E+D+L YCFSSAYIVAL
Sbjct  382  NFFYTAKFFGLGPTSFLSDLMLAGEQFCGEDWLKLKGNYHSTDEDDLLRYCFSSAYIVAL  441

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALD++RIG+ANQ   IPLDWALGAFI+Q       E S W   + G+D S  +
Sbjct  442  LHDSLGIALDEKRIGFANQVGGIPLDWALGAFIMQKMPKQSPEHSGWITAIVGND-SSIL  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  +  +LI     V KW+ PQLKT+YDLEKG+YI+++V+R
Sbjct  501  SLFLVPSVLIMTAWTVSKWKKPQLKTIYDLEKGRYIIRQVNR  542



>ref|NP_565293.1| probable apyrase 6 [Arabidopsis thaliana]
 sp|O80612.2|APY6_ARATH RecName: Full=Probable apyrase 6; Short=AtAPY6; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
6 [Arabidopsis thaliana]
 gb|AAC32915.2| putative nucleoside triphosphatase [Arabidopsis thaliana]
 gb|AEC05650.1| probable apyrase 6 [Arabidopsis thaliana]
 gb|AEJ38087.1| nucleoside triphosphate diphosphohydrolase 6 [Arabidopsis thaliana]
Length=555

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 123/164 (75%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  KA+LS M+ AG+RFC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  391  NFFYTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLHEEDLLRYCFSSAYIVSL  450

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK----WFAFMFGDDl  416
            LHD+LGI LDDERIGYANQA +IPLDWALGAFI Q+ ++  + ++     WF  +F +  
Sbjct  451  LHDTLGIPLDDERIGYANQAGDIPLDWALGAFIQQTATETSQHAASGNLHWFHALFSNHP  510

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                 ++GI IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  511  KTLHYLIGIPILMTVLVYLVTKWRKPQLKTIYDLEKGRYIVTRI  554



>gb|AAK62457.1|AF387012_1 putative nucleoside triphosphatase [Arabidopsis thaliana]
Length=555

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 123/164 (75%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  KA+LS M+ AG+RFC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  391  NFFYTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLHEEDLLRYCFSSAYIVSL  450

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK----WFAFMFGDDl  416
            LHD+LGI LDDERIGYANQA +IPLDWALGAFI Q+ ++  + ++     WF  +F +  
Sbjct  451  LHDTLGIPLDDERIGYANQAGDIPLDWALGAFIQQTATETSQHAASGNLHWFHALFSNHP  510

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                 ++GI IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  511  KTLHYLIGIPILMTVLVYLVTKWRKPQLKTIYDLEKGRYIVTRI  554



>gb|KHG14333.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Gossypium arboreum]
Length=814

 Score =   199 bits (505),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFF L  +A LS++M+AG+ FC EDWSKL+ ++ SL EE++L YCFSSAYIVAL
Sbjct  383  NFFHTSKFFRLHQRASLSDVMMAGQHFCGEDWSKLKKKHQSLGEEELLRYCFSSAYIVAL  442

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDERI +AN+  NIPLDWALGAFILQ+ + LD     W   +  +D     
Sbjct  443  LHDSLGIALDDERISFANRVENIPLDWALGAFILQNTAKLDAPQIDWITTIVMNDSPTLF  502

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             ++ +S +L+F+  ++ KWR P+LKTVYDLEKG+YIV ++
Sbjct  503  SIIAVSAILMFIAWFILKWRKPELKTVYDLEKGRYIVTQI  542



>ref|XP_008802601.1| PREDICTED: probable apyrase 6 isoform X1 [Phoenix dactylifera]
Length=601

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+T+KFFGL P +FLS++M+AG++FC EDW KL++ YHS+ EED+L YCFSSAYI+AL
Sbjct  382  NFFYTAKFFGLGPTSFLSDLMLAGEQFCGEDWLKLKSIYHSVDEEDLLRYCFSSAYIMAL  441

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+LD++RIG+ANQ  NIPLDWALGAFI+Q       E S W   + G+D S  +
Sbjct  442  LHDSLGISLDEKRIGFANQVGNIPLDWALGAFIMQKMPRQSPEHSGWITAIVGND-SSIL  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             +  +  +LI     V KWR PQLKT+YDLEKG+YI+++V+
Sbjct  501  SLFVVPSVLIMAAWTVSKWRKPQLKTIYDLEKGRYIIRQVN  541



>ref|XP_003613774.1| Ectonucleoside triphosphate diphosphohydrolase [Medicago truncatula]
 gb|AES96732.1| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=583

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL P+A+LS++M AG+ +C  DW KL+ +Y S  EED+L +CFSSAYIVAL
Sbjct  380  NFFHTSKFFGLGPQAYLSKLMTAGQEYCGGDWLKLKKKYVSHDEEDLLRHCFSSAYIVAL  439

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI +DDERI  ANQ  +IPLDWALGAFI+Q+ +D D ++  WFA +F ++    +
Sbjct  440  LHDSLGIDMDDERIKVANQVGSIPLDWALGAFIMQTTADADIQNHNWFASIFSNESPTLL  499

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             ++GI ++L+F    + +WR PQLKT+YDLEKG+YI  RV+
Sbjct  500  SLVGIFVILLFAAWSISRWRKPQLKTIYDLEKGRYITTRVA  540



>emb|CDY03024.1| BnaC07g22030D [Brassica napus]
Length=552

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 125/165 (76%), Gaps = 5/165 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  K++LS M+ AG+RFC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  387  NFFYTSKFFGLGEKSWLSNMISAGERFCGEDWSKLRVKDPSLEEEDLLRYCFSSAYIVSL  446

Query  583  LHDSLGIALDDERIGYANQA-NNIPLDWALGAFILQSNSDLDEESSK----WFAFMFGDD  419
            LHD+LG+ LDDER+G+ANQA ++IPLDWALGAFILQ+ +   + +S     WF  +FG D
Sbjct  447  LHDTLGVPLDDERVGFANQAGDDIPLDWALGAFILQTEASTSQHASSSHLHWFYALFGID  506

Query  418  lsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                +  +G+ IL+  +   + KWR PQLKT+YDLEKG+YIV R+
Sbjct  507  SQTLLYFIGVPILMTVLVCLISKWRKPQLKTIYDLEKGRYIVSRI  551



>ref|XP_009152223.1| PREDICTED: probable apyrase 6 [Brassica rapa]
Length=553

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 125/165 (76%), Gaps = 5/165 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  K++LS M+ AG+RFC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  388  NFFYTSKFFGLGEKSWLSNMISAGERFCGEDWSKLRVKDPSLEEEDLLRYCFSSAYIVSL  447

Query  583  LHDSLGIALDDERIGYANQA-NNIPLDWALGAFILQSNSDLDEESSK----WFAFMFGDD  419
            LHD+LG+ LDDER+G+ANQA ++IPLDWALGAFILQ+ +   + +S     WF  +FG D
Sbjct  448  LHDTLGVPLDDERVGFANQAGDDIPLDWALGAFILQTEASTSQHASSSHLHWFYALFGID  507

Query  418  lsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                +  +G+ IL+  +   + KWR PQLKT+YDLEKG+YIV R+
Sbjct  508  SQTLLYFIGVPILMTVLVCLISKWRKPQLKTIYDLEKGRYIVSRI  552



>ref|XP_010502309.1| PREDICTED: probable apyrase 6 [Camelina sativa]
Length=554

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 124/164 (76%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  KA+LS M+ AG+RFC EDWSKLR +  SL +ED+L YCFSSAYIV+L
Sbjct  390  NFFHTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSL  449

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS----KWFAFMFGDDl  416
            LHD+LGI LDDERIG+A QA +IPLDWALGAFILQ+ ++  + ++     WF  +F +D 
Sbjct  450  LHDTLGIPLDDERIGFAIQAGDIPLDWALGAFILQTATETSQHAAIGNHHWFYDLFSNDS  509

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                 V+GI ILL  +   V KWR P+LKT+YDLEKG+YIV R+
Sbjct  510  KTLRYVIGIPILLTVLVYLVSKWRKPKLKTIYDLEKGRYIVTRI  553



>emb|CDY45187.1| BnaA06g33910D [Brassica napus]
Length=592

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 125/165 (76%), Gaps = 5/165 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  K++LS M+ AG+RFC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  427  NFFYTSKFFGLGEKSWLSNMISAGERFCGEDWSKLRVKDPSLEEEDLLRYCFSSAYIVSL  486

Query  583  LHDSLGIALDDERIGYANQA-NNIPLDWALGAFILQSNSDLDEESSK----WFAFMFGDD  419
            LHD+LG+ LDDER+G+ANQA ++IPLDWALGAFILQ+ +   + +S     WF  +FG D
Sbjct  487  LHDTLGVPLDDERVGFANQAGDDIPLDWALGAFILQTEASTSQHASSSHLHWFYALFGID  546

Query  418  lsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                +  +G+ IL+  +   + KWR PQLKT+YDLEKG+YIV R+
Sbjct  547  SQTLLYFIGVPILMTVLVCLISKWRKPQLKTIYDLEKGRYIVSRI  591



>ref|XP_004490061.1| PREDICTED: probable apyrase 6-like [Cicer arietinum]
Length=541

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL P A+LS++  AG+ FC E+W +L+ +Y S  EED+L +CFSSAYIVAL
Sbjct  380  NFFHTSKFFGLGPHAYLSKLRTAGQEFCAENWLRLKKKYVSHNEEDLLRHCFSSAYIVAL  439

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI +DDERI  ANQ  +IPLDWALGAFILQ+ +D D ++  W A +F +     +
Sbjct  440  LHDSLGIEMDDERIKVANQVGSIPLDWALGAFILQTTNDADIQNHDWVATIFSNGSPTLL  499

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             ++GI ++L+F    + +WR PQLKT+YDLEKG+YI  RV R
Sbjct  500  SLVGIFMILLFTAWSISRWRKPQLKTIYDLEKGRYITTRVGR  541



>ref|XP_004138917.1| PREDICTED: probable apyrase 6-like [Cucumis sativus]
Length=545

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++MVAG+ FC +DW KL+  Y  L EED+L YCFSSAYIVAL
Sbjct  381  NFFYTSKFFGLGSRAFLSDLMVAGEEFCGQDWLKLKERYKLLEEEDLLRYCFSSAYIVAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK--WFAFMFGDDlsi  410
            LHDSLGI L+D+ I  A Q  NIPLDWALGAFILQS + ++ E  +  W   +FG +L  
Sbjct  441  LHDSLGIELEDQSITAATQVQNIPLDWALGAFILQSTAAIEAEPEQWDWIVAIFGYELPS  500

Query  409  silvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
               ++ +SILL+F+   V KWR PQLKT+YDLEKG+YIV RV++
Sbjct  501  KFSLVAVSILLLFIAWSVSKWRKPQLKTIYDLEKGRYIVTRVTK  544



>ref|XP_004159988.1| PREDICTED: probable apyrase 6-like [Cucumis sativus]
Length=545

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++MVAG+ FC +DW KL+  Y  L EED+L YCFSSAYIVAL
Sbjct  381  NFFYTSKFFGLGSRAFLSDLMVAGEEFCGQDWLKLKERYKLLEEEDLLRYCFSSAYIVAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK--WFAFMFGDDlsi  410
            LHDSLGI L+D+ I  A Q  NIPLDWALGAFILQS + ++ E  +  W   +FG +L  
Sbjct  441  LHDSLGIELEDQSITAATQVQNIPLDWALGAFILQSTAAIEAEPEQWDWIVAIFGYELPS  500

Query  409  silvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
               ++ +SILL+F+   V KWR PQLKT+YDLEKG+YIV RV++
Sbjct  501  KFSLIAVSILLLFIAWSVSKWRKPQLKTIYDLEKGRYIVTRVTK  544



>ref|XP_006395745.1| hypothetical protein EUTSA_v10003943mg [Eutrema salsugineum]
 gb|ESQ33031.1| hypothetical protein EUTSA_v10003943mg [Eutrema salsugineum]
Length=550

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  KA+LS M+ AG+RFC EDWSKLR +  SL E+D+L YCFSSAYIV+L
Sbjct  385  NFFYTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLEEDDLLRYCFSSAYIVSL  444

Query  583  LHDSLGIALDDERIGYANQA-NNIPLDWALGAFILQSNSDLDEESSK----WFAFMFGDD  419
            LHD+LGI LDDER+G+A+QA +NIPLDWALGAFILQ+ +   ++++     WF  +F +D
Sbjct  445  LHDTLGIPLDDERVGFASQAGDNIPLDWALGAFILQTETSTSQQAASSNLHWFYGVFVND  504

Query  418  lsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                  ++G+ IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  505  SKTLFYLIGVPILMTVLVCLVSKWRKPQLKTIYDLEKGRYIVSRI  549



>ref|XP_006290845.1| hypothetical protein CARUB_v10016956mg [Capsella rubella]
 gb|EOA23743.1| hypothetical protein CARUB_v10016956mg [Capsella rubella]
Length=553

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 122/164 (74%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  KA+LS M+ AG+RFC EDWSKLR +  SL +ED+L YCFSSAYIV+L
Sbjct  389  NFFHTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSL  448

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS----KWFAFMFGDDl  416
            LHD+ GI LDDERIG+A QA +IPLDWALGAFILQ+ ++  +  +     WF  +FG + 
Sbjct  449  LHDTFGIPLDDERIGFAIQAGDIPLDWALGAFILQTATETSQHEAIGNHHWFYDLFGYES  508

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                 ++GI IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  509  KTLHYLIGIPILMTVLVYLVSKWRKPQLKTIYDLEKGRYIVTRI  552



>ref|XP_010425073.1| PREDICTED: probable apyrase 6 [Camelina sativa]
Length=554

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 123/164 (75%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  KA+LS M+ AG+RFC EDWSKLR +  SL +ED+L YCFSSAYIV+L
Sbjct  390  NFFHTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSL  449

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS----KWFAFMFGDDl  416
            LHD+LGI LDDERI +A QA +IPLDWALGAFILQ+ ++  + ++     WF  +F +D 
Sbjct  450  LHDTLGIPLDDERIEFAIQAGDIPLDWALGAFILQTATETSQHAAISNHHWFYDLFSNDS  509

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                 V+GI ILL  +   V KWR P+LKT+YDLEKG+YIV R+
Sbjct  510  KTLRYVIGIPILLTVLVYLVSKWRKPKLKTIYDLEKGRYIVTRI  553



>ref|XP_008441708.1| PREDICTED: probable apyrase 6 [Cucumis melo]
Length=545

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++MVAG+ FC EDW +L+  Y  L EED+L YCFSSAYIVAL
Sbjct  381  NFFYTSKFFGLGSRAFLSDLMVAGEEFCGEDWLELKKRYKLLDEEDLLRYCFSSAYIVAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK--WFAFMFGDDlsi  410
            LHDSLGI LDD  I  A    NIPLDWA+GAFILQS + ++ E  +  W   +FG +L  
Sbjct  441  LHDSLGIGLDDTSITAATHVQNIPLDWAMGAFILQSTAAIEAEPEQWDWIVAIFGYELPT  500

Query  409  silvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
               ++ +SILL+F+   V KWR PQLKT+YDLEKG+YIV RV++
Sbjct  501  KFSLIVVSILLLFIAWSVSKWRKPQLKTIYDLEKGRYIVTRVTK  544



>ref|XP_010514066.1| PREDICTED: probable apyrase 6 [Camelina sativa]
Length=554

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 121/164 (74%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  KA+LS M+ AG+RFC EDWSKLR +  SL +ED+L YCFSSAYIV+L
Sbjct  390  NFFHTSKFFGLGEKAWLSNMISAGERFCGEDWSKLRVKDPSLRDEDLLRYCFSSAYIVSL  449

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEE----SSKWFAFMFGDDl  416
            LHD+LGI LDDERI +A Q  +IPLDWALGAFILQ+ ++  +     S  WF  +F ++ 
Sbjct  450  LHDTLGIPLDDERIQFAIQVGDIPLDWALGAFILQTATETSQHAAIGSHHWFYDLFSNNS  509

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                 V+GI ILL  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  510  KTLRYVIGIPILLTVLVYLVSKWRKPQLKTIYDLEKGRYIVTRI  553



>gb|KFK33476.1| hypothetical protein AALP_AA5G018300 [Arabis alpina]
Length=552

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 127/165 (77%), Gaps = 5/165 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  K++LS M+ AG++FC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  387  NFFYTSKFFGLGEKSWLSNMISAGEKFCGEDWSKLRVKDPSLDEEDLLRYCFSSAYIVSL  446

Query  583  LHDSLGIALDDERIGYANQA-NNIPLDWALGAFILQSNSDLDEE--SSKWFAF--MFGDD  419
            LHD+LG+ LDDER+ YANQA +NIPLDWALGAFILQ+ ++  +   SS   +F  +FG D
Sbjct  447  LHDTLGVPLDDERVKYANQAGDNIPLDWALGAFILQTAAETSQHTGSSNLHSFYALFGTD  506

Query  418  lsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             +  + ++GI IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  507  SNTLLYLIGIPILITVLVYLVSKWRKPQLKTIYDLEKGRYIVTRI  551



>gb|KFK33477.1| hypothetical protein AALP_AA5G018300 [Arabis alpina]
Length=551

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 127/165 (77%), Gaps = 5/165 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  K++LS M+ AG++FC EDWSKLR +  SL EED+L YCFSSAYIV+L
Sbjct  386  NFFYTSKFFGLGEKSWLSNMISAGEKFCGEDWSKLRVKDPSLDEEDLLRYCFSSAYIVSL  445

Query  583  LHDSLGIALDDERIGYANQA-NNIPLDWALGAFILQSNSDLDEE--SSKWFAF--MFGDD  419
            LHD+LG+ LDDER+ YANQA +NIPLDWALGAFILQ+ ++  +   SS   +F  +FG D
Sbjct  446  LHDTLGVPLDDERVKYANQAGDNIPLDWALGAFILQTAAETSQHTGSSNLHSFYALFGTD  505

Query  418  lsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             +  + ++GI IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  506  SNTLLYLIGIPILITVLVYLVSKWRKPQLKTIYDLEKGRYIVTRI  550



>ref|XP_003518729.1| PREDICTED: probable apyrase 6-like isoform 1 [Glycine max]
Length=537

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 120/166 (72%), Gaps = 9/166 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +A+LS++M  G+ FC EDW +L+ +Y S  E+D+L YCFSSAYIVAL
Sbjct  377  NFFYTSKFFGLRSRAYLSKLMSVGQEFCGEDWLRLKKKYVSHDEDDLLRYCFSSAYIVAL  436

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDER+  ANQ  +IPLDWALGAFILQ+ +D D  +  W   +F D+     
Sbjct  437  LHDSLGIALDDERVKVANQVGSIPLDWALGAFILQTAADADIPNHNWIGTIFSDE-----  491

Query  403  lvlgisillIFVTLY----VRKWRNPQLKTVYDLEKGKYIVKRVSR  278
                +SI+ IF+ L     + +WR PQLKT+YDLEKG+YI+ RV R
Sbjct  492  SHTLLSIIGIFIILLTAWSISRWRKPQLKTIYDLEKGRYIITRVGR  537



>gb|KHN12207.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Glycine soja]
Length=537

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 120/166 (72%), Gaps = 9/166 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +A+LS++M  G+ FC EDW +L+ +Y S  E+D+L YCFSSAYIVAL
Sbjct  377  NFFYTSKFFGLRSRAYLSKLMSVGQEFCGEDWLRLKKKYVSHDEDDLLRYCFSSAYIVAL  436

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIALDDER+  ANQ  +IPLDWALGAFILQ+ +D D  +  W   +F D+     
Sbjct  437  LHDSLGIALDDERVKVANQVGSIPLDWALGAFILQTAADADIPNLNWIGTIFSDE-----  491

Query  403  lvlgisillIFVTLY----VRKWRNPQLKTVYDLEKGKYIVKRVSR  278
                +SI+ IF+ L     + +WR PQLKT+YDLEKG+YI+ RV R
Sbjct  492  SHTLLSIIGIFIILLTAWSISRWRKPQLKTIYDLEKGRYIITRVGR  537



>ref|XP_002315051.2| nucleoside phosphatase family protein [Populus trichocarpa]
 gb|EEF01222.2| nucleoside phosphatase family protein [Populus trichocarpa]
Length=530

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +AFL  +M+AG++FC EDWS+L+ ++ S  +ED+  YCFS+AYIVAL
Sbjct  367  NFFHTSKFFGLDQRAFLLNLMIAGEQFCGEDWSRLKKKHQSFKDEDLALYCFSAAYIVAL  426

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD-EESSKWFAFMFGDDlsis  407
            LHDSLGIA+DD+RIG+ANQ  NIPLDWA GAFIL +N+ LD EE S W   +  DD    
Sbjct  427  LHDSLGIAIDDQRIGFANQVGNIPLDWASGAFILYTNAALDMEEHSDWIVTIISDDPLTL  486

Query  406  ilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKR  287
            + ++GI+I+LIFV   + KW   QLKT YDLE+G YIV R
Sbjct  487  LSLIGIAIVLIFVAWPISKWGKHQLKTFYDLERGWYIVTR  526



>ref|XP_010066911.1| PREDICTED: probable apyrase 6 isoform X1 [Eucalyptus grandis]
 gb|KCW64958.1| hypothetical protein EUGRSUZ_G02502 [Eucalyptus grandis]
Length=575

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL+ KA LS++M+AG+ FC E WS L+  +H L EED+L YCFSSAYIVA 
Sbjct  413  NFFHTSKFFGLTQKAVLSDLMLAGEHFCGEYWSILKKRHHLLNEEDLLRYCFSSAYIVAF  472

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGIAL+D+RI ++NQ  ++PLDWALGAFILQ+    D E   W   +  +   I +
Sbjct  473  LHDSLGIALNDDRIAFSNQVGSVPLDWALGAFILQATGATDVEQPSWPFTVVNNHSPILL  532

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +L I I+ +F++  + KWR PQ+K +YDLEKG+Y V RV+R
Sbjct  533  SLLAILIISMFISWIISKWRKPQVKIIYDLEKGRYTVTRVNR  574



>ref|XP_011013478.1| PREDICTED: probable apyrase 6 isoform X1 [Populus euphratica]
Length=528

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFG   +AFL  +M+AG++FC EDWS+L+ ++ S  +ED+  YCFS+AYIVAL
Sbjct  365  NFFHTSKFFGPDQRAFLLNLMIAGEQFCGEDWSRLKKKHQSFKDEDLALYCFSAAYIVAL  424

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEE-SSKWFAFMFGDDlsis  407
            LHDSLGIA+DD+RIG+ANQ  NIPLDWALGAFIL +N+ LD E  S W   +  DD    
Sbjct  425  LHDSLGIAIDDQRIGFANQVGNIPLDWALGAFILHTNAALDMEVHSDWIVNIISDDSLTL  484

Query  406  ilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKR  287
            + ++GI+I+LIFV   + KW   Q KT YDLE+G YIV R
Sbjct  485  LSLIGIAIVLIFVAWPISKWGKHQFKTFYDLERGWYIVTR  524



>ref|XP_010527907.1| PREDICTED: probable apyrase 6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010527908.1| PREDICTED: probable apyrase 6 isoform X2 [Tarenaya hassleriana]
Length=550

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  KA LS+++ AG++FC EDWSKLR +  SL +ED+L YCFSSAYI AL
Sbjct  386  NFFYTSKFFGLGEKASLSDLIFAGEKFCGEDWSKLRVKNPSLEDEDLLRYCFSSAYIAAL  445

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS----KWFAFMFGDDl  416
            LHDSLGI+ DD R+ + NQA  IPLDWALGAFIL +   +   S      WF  + G D 
Sbjct  446  LHDSLGISPDDGRVIFTNQAGEIPLDWALGAFILNTAMTISHASPHHRLAWFDALIGQDS  505

Query  415  sisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
            +  + ++GI I L F    V KWR PQLKTVYDLEKG+YIV RV
Sbjct  506  TKLLYLVGIPIFLAFSVYLVSKWRKPQLKTVYDLEKGRYIVTRV  549



>ref|XP_011013486.1| PREDICTED: probable apyrase 6 isoform X2 [Populus euphratica]
Length=527

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFG   +AFL  +M+AG++FC EDWS+L+ ++ S  +ED+  YCFS+AYIVAL
Sbjct  364  NFFHTSKFFGPDQRAFLLNLMIAGEQFCGEDWSRLKKKHQSFKDEDLALYCFSAAYIVAL  423

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEE-SSKWFAFMFGDDlsis  407
            LHDSLGIA+DD+RIG+ANQ  NIPLDWALGAFIL +N+ LD E  S W   +  DD    
Sbjct  424  LHDSLGIAIDDQRIGFANQVGNIPLDWALGAFILHTNAALDMEVHSDWIVNIISDDSLTL  483

Query  406  ilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKR  287
            + ++GI+I+LIFV   + KW   Q KT YDLE+G YIV R
Sbjct  484  LSLIGIAIVLIFVAWPISKWGKHQFKTFYDLERGWYIVTR  523



>ref|XP_010917046.1| PREDICTED: probable apyrase 6 isoform X1 [Elaeis guineensis]
Length=517

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF T+KFFGLSP + LS++M+AG++FC EDWSKL+ +YH+LAEED+  YCFSSAYIVAL
Sbjct  360  NFFFTTKFFGLSPTSSLSDLMLAGEQFCGEDWSKLKEKYHTLAEEDLSRYCFSSAYIVAL  419

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI LDD RI +ANQ  NI ++WALGAFI+Q+ +     S  W   +   D    +
Sbjct  420  LHDSLGITLDDRRIEFANQVGNIQVEWALGAFIMQTMATRSYHSG-WITSVVQPD--SLV  476

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            L+   S LLIF      KWR PQLKT+YDLEKG+YIV RV+
Sbjct  477  LLFVASTLLIFAAWLASKWRRPQLKTIYDLEKGRYIVTRVN  517



>ref|XP_010554315.1| PREDICTED: probable apyrase 6 isoform X2 [Tarenaya hassleriana]
Length=530

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  KA LS+++ AG++FC EDWSKLR +  SL +ED+L YCFSSAYI AL
Sbjct  368  NFFYTSKFFGLGEKASLSDLISAGEKFCGEDWSKLRVKNPSLEDEDLLRYCFSSAYIAAL  427

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS--KWFAFMFGDDlsi  410
            LHDSLGI+ DD RI + NQA ++PLDWALGAFIL + S +   S    W   + G D + 
Sbjct  428  LHDSLGISPDDGRIMFTNQAGDMPLDWALGAFILNTASTISHASHHLAWINALIGHDSTK  487

Query  409  silvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             + ++GISI L+F   +V KWR PQLKTVYDLE G+YIV R++
Sbjct  488  LLYLIGISIFLVFSVCWVSKWRKPQLKTVYDLENGRYIVTRIN  530



>gb|EPS67236.1| hypothetical protein M569_07539, partial [Genlisea aurea]
Length=525

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 116/165 (70%), Gaps = 14/165 (8%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  +  LS+++VAG++FC E+WSKL  +Y ++ EED+LHYCFSSAYIVAL
Sbjct  370  NFFHTSKFFGLGERFLLSDLVVAGQQFCSEEWSKLARKYTTIDEEDLLHYCFSSAYIVAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD--EESSKWFAFMFGDDlsi  410
            LHDSLGIAL+D+RI Y N+  NIPLDWA+GAFILQ+ S     E S+ W+    G     
Sbjct  430  LHDSLGIALNDQRIRYVNRVENIPLDWAVGAFILQTASRHPEAESSAPWYKSSTG-----  484

Query  409  silvlgisillIFVT---LYVRKWRNPQLKTVYDLEKGKYIVKRV  284
                L +     F     L ++KWR PQLKT+YDLEKGKYIV  +
Sbjct  485  ----LLLLGASAFTAASWLGLKKWRRPQLKTIYDLEKGKYIVTHI  525



>ref|XP_010554314.1| PREDICTED: probable apyrase 6 isoform X1 [Tarenaya hassleriana]
Length=548

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  KA LS+++ AG++FC EDWSKLR +  SL +ED+L YCFSSAYI AL
Sbjct  386  NFFYTSKFFGLGEKASLSDLISAGEKFCGEDWSKLRVKNPSLEDEDLLRYCFSSAYIAAL  445

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS--KWFAFMFGDDlsi  410
            LHDSLGI+ DD RI + NQA ++PLDWALGAFIL + S +   S    W   + G D + 
Sbjct  446  LHDSLGISPDDGRIMFTNQAGDMPLDWALGAFILNTASTISHASHHLAWINALIGHDSTK  505

Query  409  silvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             + ++GISI L+F   +V KWR PQLKTVYDLE G+YIV R++
Sbjct  506  LLYLIGISIFLVFSVCWVSKWRKPQLKTVYDLENGRYIVTRIN  548



>ref|XP_008806007.1| PREDICTED: probable apyrase 6 [Phoenix dactylifera]
Length=518

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF T+KFFGLSP + LS++M+AG++ C E WSKL+ +YH+LAEED+  YCFSSAYIVAL
Sbjct  360  NFFFTTKFFGLSPTSSLSDLMLAGEQICGEYWSKLKEKYHTLAEEDLSRYCFSSAYIVAL  419

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG ALDD RI +ANQA NI ++WALGAFI+Q+ +     SS W   M     S+++
Sbjct  420  LHDSLGFALDDRRIVFANQAGNIQVEWALGAFIMQTIAARSYHSS-WITSMV-QPGSLAL  477

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            L+  +S LLIF    V KWR PQLKT+YDLEKG+YIV RV+
Sbjct  478  LLFVVSTLLIFAAWLVSKWRRPQLKTIYDLEKGRYIVTRVN  518



>gb|AAT66769.2| Apyrase-like protein, putative [Solanum demissum]
Length=466

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  748  SKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSL  569
            +KFFGL PKAFLS++M AGK FCEEDWS L+++Y SL EED+  YCFSSAYI+ALLHDSL
Sbjct  296  TKFFGLPPKAFLSDLMAAGKSFCEEDWSSLKSKYPSLQEEDLHRYCFSSAYILALLHDSL  355

Query  568  GIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDD  419
            GIALDD+RIGYANQ  NIPLDWALGAFILQS ++LD+E S WFA MF +D
Sbjct  356  GIALDDDRIGYANQVENIPLDWALGAFILQSTAELDKEHSGWFANMFSED  405



>ref|XP_010246361.1| PREDICTED: probable apyrase 6 [Nelumbo nucifera]
Length=542

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             F++TS+ FG+ P+A LSE+  AG+ +CE+DW KLR E+  + E D+L YCFSSAYIVAL
Sbjct  381  TFYYTSELFGMVPRASLSELEAAGRHYCEDDWHKLRDEHEGIDEIDLLKYCFSSAYIVAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            +HDSLGI++DD+RIG+AN   +IPLDW LGAFILQ+  +  E   +    + G+D    +
Sbjct  441  VHDSLGISMDDKRIGFANHGGSIPLDWTLGAFILQTVVEPLELEPENLGQVVGNDSVAYL  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  +  L I    YV KW+ PQLKTVYDLEKG YI+ RV R
Sbjct  501  TLFIVLFLAILAAFYVTKWQKPQLKTVYDLEKGHYIITRVPR  542



>ref|XP_010258343.1| PREDICTED: probable apyrase 6 isoform X1 [Nelumbo nucifera]
Length=549

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 118/162 (73%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFF L   AFLS +M  G++FCEED S L+ +Y SL+E+D+L YCFSS+YIVAL
Sbjct  389  NFYHTSKFFRLPETAFLSNLMXTGQQFCEEDRSALKKKYSSLSEDDLLRYCFSSSYIVAL  448

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+LGI+LDD+RI  ANQ  N+PLDWALGAFILQ+ ++   E   W      DD S+ +
Sbjct  449  LHDTLGISLDDQRILVANQVANMPLDWALGAFILQNTAESGMEVD-WIVTNVSDDSSMLV  507

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  + I++IF    + KW+ PQ KT+YDLEKG+YIV  VSR
Sbjct  508  SLFFVFIMVIFTAWSLSKWQKPQYKTIYDLEKGRYIVSCVSR  549



>ref|XP_009398170.1| PREDICTED: LOW QUALITY PROTEIN: probable apyrase 6 [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGLSP + LSEMM AG+ +CE+DWSK + +YHS  EED+  YCFS+AYIVAL
Sbjct  366  NFFYTSKFFGLSPTSSLSEMMHAGEEYCEQDWSKTKKKYHSADEEDLSRYCFSAAYIVAL  425

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDS GI LDD+RI Y NQ  ++ +DWALGA+I+QS +   E +    A + GD + + +
Sbjct  426  LHDSFGIPLDDKRIEYTNQVGDMEIDWALGAYIVQSMTKSSENAGWVTAMIHGDLVLLLL  485

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            +   + +L  ++   V KWR P++KT+YDLEKG YI+ R S
Sbjct  486  VASALLVLTAWL---VSKWRRPRMKTIYDLEKGHYIITRAS  523



>ref|XP_004973523.1| PREDICTED: probable apyrase 6-like isoform X2 [Setaria italica]
Length=534

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K+FLS++MVAG++FC  DWSK++ +Y S  E ++L +CFSSAYI+AL
Sbjct  373  NFYHTSKFFGLHSKSFLSDLMVAGEKFCHGDWSKIKKKYSSFDEGELLLFCFSSAYIIAL  432

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSL + LD +RI   NQ + +P+DWALGAFI+Q+  +  E S    +++   D S   
Sbjct  433  LHDSLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTALNRTEYSDSSVSYLNSYDSSGLA  492

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  I+ +++F    + +WR PQLKT+YD+EKG+YI+ RVSR
Sbjct  493  PLFLITAVVVFTAFSILRWRRPQLKTIYDMEKGRYIITRVSR  534



>ref|XP_006829804.1| hypothetical protein AMTR_s00119p00065770 [Amborella trichopoda]
 gb|ERM97220.1| hypothetical protein AMTR_s00119p00065770 [Amborella trichopoda]
Length=257

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 5/164 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FFHT +FFGL P+A LS+  +AG+ +C  DWSKL+ +     EED+L YCFSSAYIVAL
Sbjct  97   KFFHTPRFFGLHPRAPLSDFKMAGELYCGNDWSKLKEKNIEEDEEDLLKYCFSSAYIVAL  156

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQS--NSDLDEESSKWFAFMFGDDlsi  410
            LHD+LG+++DD+RI + NQ  N+PLDW LGAFILQS    DL +E   W   + G D   
Sbjct  157  LHDALGVSMDDQRIRFMNQVGNVPLDWRLGAFILQSILEPDLPQEKPVW---ILGKDFLT  213

Query  409  silvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
               +  I +L+I +   + KW  PQ+KT+YDLEKG YI+ R+ R
Sbjct  214  FFSLFAIFVLVIVIAFSLWKWNKPQVKTIYDLEKGHYIITRIPR  257



>tpg|DAA48967.1| TPA: putative nucleoside phosphatase GDA1/CD39 family protein 
[Zea mays]
Length=291

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 118/162 (73%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGLS K FLS++MVAG++FC  DWSK++ +Y S  +  +L +CFSSAYI+AL
Sbjct  131  NFYHTSKFFGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIAL  190

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+L + LD +RI   NQ + +P+DWALGAFI+Q+  +  E S    +++   D S  +
Sbjct  191  LHDTLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTTMNRTEYSDSSVSYLNSYD-SPGL  249

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
            + L   I+++F  L + +WR P+LKT+YD+EKG+YI+ RVS+
Sbjct  250  VPLLFIIVVVFTALSILRWRKPRLKTIYDMEKGRYIITRVSQ  291



>ref|XP_009416865.1| PREDICTED: probable apyrase 6 [Musa acuminata subsp. malaccensis]
Length=543

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 114/162 (70%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKF GL P   LS++++AG++FC EDW +L+ +Y +  EED+L +CFS+AYIVAL
Sbjct  383  NFFHTSKFLGLGPTPLLSDLIMAGEQFCGEDWLRLKRKYDTYDEEDLLRFCFSTAYIVAL  442

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+LG  +DD R+ +ANQ  NIPLDWALGAFI Q       ESS W   + GDD   + 
Sbjct  443  LHDTLGFPMDDGRVVFANQVGNIPLDWALGAFITQKALRASAESSDWIFAVLGDD-PSAF  501

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
              L +SI+LIF    V KW  P+LK +YDLE+G+YI+  V+R
Sbjct  502  FYLFVSIMLIFTAWSVLKWMKPKLKIIYDLERGRYILTPVNR  543



>ref|XP_006827247.1| hypothetical protein AMTR_s00010p00262060 [Amborella trichopoda]
 gb|ERM94484.1| hypothetical protein AMTR_s00010p00262060 [Amborella trichopoda]
Length=540

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEED-WSKLRTEYHSLAEEDMLHYCFSSAYIVA  587
            NFF+TSKFFGL PKA LS+++ AGK FCEE+ WS L+     L E+++L YCFSSAYIVA
Sbjct  380  NFFYTSKFFGLDPKASLSDLVKAGKHFCEEESWSNLKKRNRGLNEDELLKYCFSSAYIVA  439

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQ--SNSDLDEESSKWFAFMFGDDls  413
            LLHDSLGI++ D+RI + NQ  NI LDWALGAFIL   SN++L   + +      GD+  
Sbjct  440  LLHDSLGISMYDKRIDFVNQIQNISLDWALGAFILHASSNTELAHPNHQ----TSGDENL  495

Query  412  isilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
              + ++ +S L++    Y+ +WR PQLKT+YDLE G+YIV RVSR
Sbjct  496  TFLALILVSALIVVAAWYISRWRKPQLKTIYDLENGRYIVTRVSR  540



>emb|CBI24350.3| unnamed protein product [Vitis vinifera]
Length=553

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 115/172 (67%), Gaps = 2/172 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FFGL PKA LSE+ VAG+ +CE+DW  L+ ++  + + D+L +CFSSAY VAL
Sbjct  370  NFFYTSEFFGLVPKASLSELEVAGQHYCEDDWDTLKRQHSEVDDLDLLRHCFSSAYTVAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+LGI ++D RIG+ N    IPLDW LGAFILQ+  +  E  +     + G++     
Sbjct  430  LHDALGIPMNDTRIGFGNHTGGIPLDWMLGAFILQTMLEPLELETDSLVQIVGNESVTYF  489

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSRY--S*LISSF  254
             +    ++ +    +V KWR PQLKT+YDLEKG+YIV  V  +  S +ISSF
Sbjct  490  SLFAFLLIAVLAAFFVLKWRKPQLKTIYDLEKGRYIVTHVPSFESSAVISSF  541



>ref|XP_008389468.1| PREDICTED: probable apyrase 6 isoform X2 [Malus domestica]
Length=496

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGLSPK FLS +M+AG++FC EDWSK++  Y ++ EE +LHYCFSSAY VAL
Sbjct  385  NFFYTSKFFGLSPKGFLSNLMMAGQQFCGEDWSKIKKRYPTVDEEALLHYCFSSAYAVAL  444

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LHDSLGIALDDERIG+ANQ  +IPLDWALGAFILQS SDLD
Sbjct  445  LHDSLGIALDDERIGFANQVGSIPLDWALGAFILQSTSDLD  485



>ref|NP_001147985.1| LOC100281594 [Zea mays]
 gb|ACG29319.1| hydrolase [Zea mays]
 tpg|DAA48970.1| TPA: putative nucleoside phosphatase GDA1/CD39 family protein 
[Zea mays]
Length=530

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 118/162 (73%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGLS K FLS++MVAG++FC  DWSK++ +Y S  +  +L +CFSSAYI+AL
Sbjct  370  NFYHTSKFFGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+L + LD +RI   NQ + +P+DWALGAFI+Q+  +  E S    +++   D S  +
Sbjct  430  LHDTLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTTMNRTEYSDSSVSYLNSYD-SPGL  488

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
            + L   I+++F  L + +WR P+LKT+YD+EKG+YI+ RVS+
Sbjct  489  VPLLFIIVVVFTALSILRWRKPRLKTIYDMEKGRYIITRVSQ  530



>ref|XP_009360338.1| PREDICTED: probable apyrase 6 isoform X2 [Pyrus x bretschneideri]
Length=497

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGLSP  FLS +M+AG++FC EDWSK++  Y ++ EE +LHYCFSSAY VAL
Sbjct  386  NFFYTSKFFGLSPNGFLSNLMMAGQQFCGEDWSKIKKRYPTVDEEALLHYCFSSAYAVAL  445

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LHDSLGIALDDERIG+ANQ  +IPLDWALGAFILQS SDLD
Sbjct  446  LHDSLGIALDDERIGFANQVGSIPLDWALGAFILQSTSDLD  486



>ref|XP_008675048.1| PREDICTED: LOC100281594 isoform X1 [Zea mays]
Length=541

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 118/162 (73%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGLS K FLS++MVAG++FC  DWSK++ +Y S  +  +L +CFSSAYI+AL
Sbjct  381  NFYHTSKFFGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+L + LD +RI   NQ + +P+DWALGAFI+Q+  +  E S    +++   D S  +
Sbjct  441  LHDTLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTTMNRTEYSDSSVSYLNSYD-SPGL  499

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
            + L   I+++F  L + +WR P+LKT+YD+EKG+YI+ RVS+
Sbjct  500  VPLLFIIVVVFTALSILRWRKPRLKTIYDMEKGRYIITRVSQ  541



>ref|XP_002269993.3| PREDICTED: probable apyrase 6 isoform X2 [Vitis vinifera]
Length=533

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 0/160 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FFGL PKA LSE+ VAG+ +CE+DW  L+ ++  + + D+L +CFSSAY VAL
Sbjct  370  NFFYTSEFFGLVPKASLSELEVAGQHYCEDDWDTLKRQHSEVDDLDLLRHCFSSAYTVAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+LGI ++D RIG+ N    IPLDW LGAFILQ+  +  E  +     + G++     
Sbjct  430  LHDALGIPMNDTRIGFGNHTGGIPLDWMLGAFILQTMLEPLELETDSLVQIVGNESVTYF  489

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             +    ++ +    +V KWR PQLKT+YDLEKG+YIV  V
Sbjct  490  SLFAFLLIAVLAAFFVLKWRKPQLKTIYDLEKGRYIVTHV  529



>ref|XP_010651603.1| PREDICTED: probable apyrase 6 isoform X1 [Vitis vinifera]
Length=537

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 0/160 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FFGL PKA LSE+ VAG+ +CE+DW  L+ ++  + + D+L +CFSSAY VAL
Sbjct  374  NFFYTSEFFGLVPKASLSELEVAGQHYCEDDWDTLKRQHSEVDDLDLLRHCFSSAYTVAL  433

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+LGI ++D RIG+ N    IPLDW LGAFILQ+  +  E  +     + G++     
Sbjct  434  LHDALGIPMNDTRIGFGNHTGGIPLDWMLGAFILQTMLEPLELETDSLVQIVGNESVTYF  493

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             +    ++ +    +V KWR PQLKT+YDLEKG+YIV  V
Sbjct  494  SLFAFLLIAVLAAFFVLKWRKPQLKTIYDLEKGRYIVTHV  533



>ref|XP_008221616.1| PREDICTED: probable apyrase 6 isoform X2 [Prunus mume]
Length=499

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL+ KAFLS++M+AG++FC EDWSKL+  +H L EE +LHYCFSSAY VAL
Sbjct  388  NFFHTSKFFGLASKAFLSDLMMAGQQFCGEDWSKLKKRHHRLDEEALLHYCFSSAYTVAL  447

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LHDSLGIA+DDERI  ANQ  +IPLDWALGAFILQS SDLD
Sbjct  448  LHDSLGIAMDDERIRVANQVGSIPLDWALGAFILQSKSDLD  488



>ref|XP_010258344.1| PREDICTED: probable apyrase 6 isoform X2 [Nelumbo nucifera]
Length=518

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 32/162 (20%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFF L   AFLS +M  G++FCEED S L+ +Y SL+E+D+L YCFSS+YIVAL
Sbjct  389  NFYHTSKFFRLPETAFLSNLMXTGQQFCEEDRSALKKKYSSLSEDDLLRYCFSSSYIVAL  448

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+LGI+LDD+RI  ANQ  N+PLDWALGAFILQ+ ++     S W             
Sbjct  449  LHDTLGISLDDQRILVANQVANMPLDWALGAFILQNTAE-----SAW-------------  490

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
                           + KW+ PQ KT+YDLEKG+YIV  VSR
Sbjct  491  --------------SLSKWQKPQYKTIYDLEKGRYIVSCVSR  518



>ref|XP_003574554.2| PREDICTED: probable apyrase 6 isoform X1 [Brachypodium distachyon]
Length=588

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 112/162 (69%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K+FLS++M+AG++FC  DWS ++ +Y S  E ++L +CFSSAYIVAL
Sbjct  428  NFYHTSKFFGLRSKSFLSDLMLAGEQFCHGDWSNIKKKYRSFNEGELLLFCFSSAYIVAL  487

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD+L + +D + I   NQ   +P+DWALGAFI+Q   +  E S    +++   D S  +
Sbjct  488  LHDTLKVPMDHKSIDVTNQIGGVPVDWALGAFIVQKTPNRTEYSDPSVSYLNNYD-SSGL  546

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
              L    +++F    + KWR P+LKT+YD+EKG+YI+ RV+R
Sbjct  547  APLIFIAMVVFTVFSILKWRRPRLKTIYDMEKGRYIITRVNR  588



>ref|XP_008231026.1| PREDICTED: probable apyrase 6 [Prunus mume]
Length=518

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 109/162 (67%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF  TS+ FGL P A L E+  AG+R+CE+DW K + ++HS+ + D+L YCFSSAY+VAL
Sbjct  357  NFLFTSELFGLVPTASLFELEAAGQRYCEDDWDKQKNQHHSIVDSDLLKYCFSSAYMVAL  416

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI +D++R+G+AN+  NI LDW LGAF++++  +  E        + G++     
Sbjct  417  LHDSLGIPMDEKRVGFANKTGNILLDWTLGAFLVETMLEPLEWELDNMGQIVGNESVTYF  476

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
                  ++ +F   +V + R PQLKT+YDLEKG+YI+ RV R
Sbjct  477  SFFAFLLIALFAVFFVLQSRKPQLKTIYDLEKGRYIITRVPR  518



>ref|XP_006573108.1| PREDICTED: probable apyrase 6-like isoform X2 [Glycine max]
Length=496

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL+P+A+LS++M AGK FC +DW +L+ +Y S  EED+L YCFSSAYIVAL
Sbjct  379  NFFYTSKFFGLTPRAYLSKLMNAGKEFCGKDWLRLKKKYVSHDEEDLLRYCFSSAYIVAL  438

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMF  428
            LHDSLGIALDDER+  ANQ  +IPLDWALGAFILQ+ +D D ++  W A +F
Sbjct  439  LHDSLGIALDDERVKVANQVGSIPLDWALGAFILQTAADADIKNHNWIATIF  490



>ref|XP_006384734.1| hypothetical protein POPTR_0004s20630g [Populus trichocarpa]
 gb|ERP62531.1| hypothetical protein POPTR_0004s20630g [Populus trichocarpa]
Length=542

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            N F+ S+FFGL P+  L E+  AGK +CE+DW KL+ ++HS+ + D+L YCFSSAY VAL
Sbjct  381  NVFYASEFFGLVPRVSLFELEAAGKHYCEDDWDKLKDQHHSIDDLDLLRYCFSSAYTVAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG++++D+RIG+AN   ++P DW LGA I QS  +  E        + GD+     
Sbjct  441  LHDSLGVSMNDKRIGFANNTESVPFDWTLGALIFQSMLEPLESEINNLDEIVGDESVTYF  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  + ++ +    +V + R PQLKT+YDLEKG+YIV RV R
Sbjct  501  SLFAVLLIALLAAFFVLQLRKPQLKTIYDLEKGRYIVTRVPR  542



>ref|XP_004297301.1| PREDICTED: probable apyrase 6 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=500

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL P+A+LS +M+AG++FC EDWSKL+  Y +  +E +L YCFSSAY VAL
Sbjct  389  NFFHTSKFFGLGPRAYLSNLMIAGQQFCGEDWSKLKKRYQAFDDEALLQYCFSSAYSVAL  448

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LHD+LGI+LDDERI  ANQ  +IPLDWALGAFILQS SDLD
Sbjct  449  LHDNLGISLDDERIRVANQIGSIPLDWALGAFILQSTSDLD  489



>ref|XP_008385640.1| PREDICTED: probable apyrase 6 [Malus domestica]
Length=528

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF  TS+ FGL P A L E+  AG+ +CE+DW K + ++HS+ + D+L YCFSSAY+VAL
Sbjct  367  NFLFTSELFGLVPTASLFELEAAGQHYCEDDWEKQKKQHHSIVDSDLLKYCFSSAYMVAL  426

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGI +D++R+GY N+  NI LDW LGAF++++  +  E        + G++     
Sbjct  427  LHDRLGIPMDEKRVGYXNETGNILLDWTLGAFLVETMLEPLEWELDNMGQIVGNESVTYF  486

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
                  ++ +F   +V + R PQ+KT+YDLEKG+YI+ RV R
Sbjct  487  SFFAFLLIAVFAVFFVLQSRKPQIKTIYDLEKGRYIITRVPR  528



>ref|XP_002312853.2| hypothetical protein POPTR_0009s15920g [Populus trichocarpa]
 gb|EEE86808.2| hypothetical protein POPTR_0009s15920g [Populus trichocarpa]
Length=543

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            N F  S+FFGL P+  L E+  AGK +CE+DW KL+ ++H + + D+L YCFSSAY VAL
Sbjct  382  NLFFASEFFGLVPRVSLFELEAAGKHYCEDDWDKLKDQHHGIDDLDLLRYCFSSAYTVAL  441

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+++D+RIG+AN   ++P DW LGAFI QS  +  E        + G++     
Sbjct  442  LHDSLGISMNDKRIGFANHTGSVPFDWTLGAFIFQSMLEPLESEINNPDEIVGNESVTYF  501

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  I ++ +    +V + R PQLKT+YDLEKG+YIV R+ R
Sbjct  502  SLFAILLIALLAAFFVLQLRKPQLKTIYDLEKGRYIVTRLPR  543



>ref|XP_008802603.1| PREDICTED: probable apyrase 6 isoform X3 [Phoenix dactylifera]
Length=491

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+T+KFFGL P +FLS++M+AG++FC EDW KL++ YHS+ EED+L YCFSSAYI+AL
Sbjct  382  NFFYTAKFFGLGPTSFLSDLMLAGEQFCGEDWLKLKSIYHSVDEEDLLRYCFSSAYIMAL  441

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS  449
            LHDSLGI+LD++RIG+ANQ  NIPLDWALGAFI+Q       E S
Sbjct  442  LHDSLGISLDEKRIGFANQVGNIPLDWALGAFIMQKMPRQSPEHS  486



>ref|XP_011006265.1| PREDICTED: probable apyrase 6 [Populus euphratica]
Length=542

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            N F+ S+FFGL P+  L E+  AGK +CE+DW KL+ +++ + + D+L YCFSSAY++AL
Sbjct  381  NVFYASEFFGLVPRVSLFELEAAGKHYCEDDWDKLKDQHNGIDDLDLLRYCFSSAYMLAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG++++D+RIG+AN   ++P DW LGA I QS  +  E        + GD+     
Sbjct  441  LHDSLGVSMNDKRIGFANNTESVPFDWTLGALIFQSMLEPLESEINNLDEIVGDESVTYF  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  + ++ +    +V + R PQLKT+YDLEKG+YIV RV R
Sbjct  501  SLFAVLLIALLAAFFVLQLRKPQLKTIYDLEKGRYIVTRVPR  542



>ref|XP_011043729.1| PREDICTED: probable apyrase 6 [Populus euphratica]
Length=542

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            N F  S+FFGL P+  L E+  AGK +CE+DW KL+ +++ + + D+L YCFSSAY VAL
Sbjct  381  NLFFASEFFGLVPRVSLFELEAAGKHYCEDDWDKLKDQHNGIDDLDLLRYCFSSAYTVAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI+++D+RIG+AN   ++P DW LGAFI QS  +  E        + GD+     
Sbjct  441  LHDSLGISMNDKRIGFANHTGSVPFDWTLGAFIFQSMLEPLESEINNPDEIVGDESVTYF  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  + ++ +    +V + R PQLKT+YDLEKG+Y+V R+ R
Sbjct  501  SLFAVLLIALLAAFFVLQLRKPQLKTIYDLEKGRYLVTRLPR  542



>ref|XP_010922903.1| PREDICTED: probable apyrase 6 isoform X2 [Elaeis guineensis]
Length=546

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 105/162 (65%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+ S+ FG++P+A L  +  AG+ +CE+ W +L+ E+  + E D+  YCFSSAYIVAL
Sbjct  386  NFFYISELFGMAPRASLLNVEAAGRHYCEDPWVRLKEEHFGIDEMDLFKYCFSSAYIVAL  445

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGI +D +RIG+A+   + P DW LGAFIL +  + + E ++    + G+D    I
Sbjct  446  LHDGLGIPMDVKRIGFADPIVSAPFDWTLGAFILHTVVEPELE-TEIVTQIVGNDAITYI  504

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  I  + I   L++  WR P+ KTVYDLEKG YIV RV R
Sbjct  505  ELFAILFMAILAALFLSNWRKPRFKTVYDLEKGHYIVTRVPR  546



>ref|XP_010922902.1| PREDICTED: probable apyrase 6 isoform X1 [Elaeis guineensis]
Length=548

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 105/162 (65%), Gaps = 1/162 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+ S+ FG++P+A L  +  AG+ +CE+ W +L+ E+  + E D+  YCFSSAYIVAL
Sbjct  388  NFFYISELFGMAPRASLLNVEAAGRHYCEDPWVRLKEEHFGIDEMDLFKYCFSSAYIVAL  447

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGI +D +RIG+A+   + P DW LGAFIL +  + + E ++    + G+D    I
Sbjct  448  LHDGLGIPMDVKRIGFADPIVSAPFDWTLGAFILHTVVEPELE-TEIVTQIVGNDAITYI  506

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  I  + I   L++  WR P+ KTVYDLEKG YIV RV R
Sbjct  507  ELFAILFMAILAALFLSNWRKPRFKTVYDLEKGHYIVTRVPR  548



>gb|KDP42912.1| hypothetical protein JCGZ_23854 [Jatropha curcas]
Length=542

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
              F+TS+FFGL P+  LSE+  AG+ +CE DW+ L+ ++  + + D+L YCFSSAY+VAL
Sbjct  382  TLFYTSEFFGLVPRTTLSELESAGQHYCEGDWNNLKNQHLGMDDLDLLRYCFSSAYMVAL  441

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI +DD+RIG+AN  ++  LDW LGAFIL+S  +  +        + G++     
Sbjct  442  LHDSLGIPMDDKRIGFANHTSSH-LDWTLGAFILESTLEPLDTEIDNLDQIVGNEWVTYF  500

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             +L   ++ +    +V +WR PQLKT+YDLEKG YIV RV
Sbjct  501  SLLAFLLIALLAVFFVLQWRKPQLKTIYDLEKGHYIVTRV  540



>dbj|BAH20369.1| AT1G14230 [Arabidopsis thaliana]
Length=305

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AGKRFC E+WSKL+ +Y +  +E++L YCFSSAYI+++
Sbjct  183  NFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIISM  242

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQS  476
            LHDSLG+ALDDERI YA++A   +IPLDWALGAFIL +
Sbjct  243  LHDSLGVALDDERIKYASKAGEEDIPLDWALGAFILNT  280



>ref|XP_008792490.1| PREDICTED: probable apyrase 6 isoform X2 [Phoenix dactylifera]
Length=546

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 105/161 (65%), Gaps = 1/161 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF+ S+ FG++P+A L ++  AG+ +CE+ W++L+ E+  + E D+L YCFSSAYIVAL
Sbjct  386  KFFYISELFGMAPRASLLKVEAAGRHYCEDHWARLKEEHFGVDEMDLLKYCFSSAYIVAL  445

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGI +D +RIG+A+   + P DW LGAFILQ+  +   E ++    + G+D    I
Sbjct  446  LHDGLGIPMDGKRIGFADPTVSSPFDWTLGAFILQTVVEPKLE-TEIVTQIVGNDAITYI  504

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             +  I  + I    ++  WR P+ KTVYDLEKG YIV RV 
Sbjct  505  ELFAILFMAILAAFFLSNWRKPRFKTVYDLEKGHYIVTRVP  545



>ref|XP_010458912.1| PREDICTED: probable apyrase 4 [Camelina sativa]
Length=508

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 85/97 (88%), Gaps = 1/97 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AGKRFC E+WSKL+ +Y +  +E++L YCFSSAYIV++
Sbjct  384  NFFHTSKFFGLGEKDWLSEMILAGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIVSM  443

Query  583  LHDSLGIALDDERIGYANQAN-NIPLDWALGAFILQS  476
            LHDSLG+ALDDERIG+A++A  +IPLDWALGAFIL +
Sbjct  444  LHDSLGVALDDERIGFASKAGQDIPLDWALGAFILNT  480



>ref|XP_008792489.1| PREDICTED: probable apyrase 6 isoform X1 [Phoenix dactylifera]
Length=548

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 105/161 (65%), Gaps = 1/161 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF+ S+ FG++P+A L ++  AG+ +CE+ W++L+ E+  + E D+L YCFSSAYIVAL
Sbjct  388  KFFYISELFGMAPRASLLKVEAAGRHYCEDHWARLKEEHFGVDEMDLLKYCFSSAYIVAL  447

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGI +D +RIG+A+   + P DW LGAFILQ+  +   E ++    + G+D    I
Sbjct  448  LHDGLGIPMDGKRIGFADPTVSSPFDWTLGAFILQTVVEPKLE-TEIVTQIVGNDAITYI  506

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             +  I  + I    ++  WR P+ KTVYDLEKG YIV RV 
Sbjct  507  ELFAILFMAILAAFFLSNWRKPRFKTVYDLEKGHYIVTRVP  547



>ref|XP_009410467.1| PREDICTED: probable apyrase 6 [Musa acuminata subsp. malaccensis]
Length=535

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 106/160 (66%), Gaps = 1/160 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF+ S+ FG++PKA LS++  AG+ +CE+ W  L+ E+  + E D+  YCFSSA++V+L
Sbjct  375  KFFYISELFGMTPKASLSDVEAAGRHYCEDHWVSLKEEHFGIDEMDLKKYCFSSAFMVSL  434

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGI ++++RIG+A    + PLDW LGAFILQ+  +  E  ++    + G D    I
Sbjct  435  LHDGLGIPMEEKRIGFAVPTGSSPLDWTLGAFILQTVVE-TESGAETITNIAGSDTLTFI  493

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
             +  I +L+    LYV  WR P+LKT+YDLEKG YIV R+
Sbjct  494  SLFAILLLVTLSVLYVWNWRRPRLKTIYDLEKGHYIVTRM  533



>ref|XP_010045146.1| PREDICTED: probable apyrase 6 isoform X1 [Eucalyptus grandis]
 gb|KCW87297.1| hypothetical protein EUGRSUZ_B03790 [Eucalyptus grandis]
Length=558

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 108/162 (67%), Gaps = 1/162 (1%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFC-EEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            F++TS+FFG+  +  L ++ +AG+R+C ++DW KLR + +S+ + D+  YCFSSAY+VAL
Sbjct  397  FYYTSEFFGMFSREGLFDLKLAGERYCADDDWGKLRNKQNSMEDLDLSRYCFSSAYVVAL  456

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI  DD+R+  AN+  +IP DW LGA+++ +  D     S  F  + G++     
Sbjct  457  LHDSLGIPFDDKRVHSANRTGSIPFDWTLGAYVVLTMQDAVAHESDNFGEIVGNESVTYF  516

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  + ++++     + +W+ PQLKT+YDLEKG YIV RV R
Sbjct  517  SLFAVLLIVVLAAFLISQWQKPQLKTIYDLEKGHYIVTRVPR  558



>ref|XP_010045147.1| PREDICTED: probable apyrase 6 isoform X2 [Eucalyptus grandis]
Length=548

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 108/162 (67%), Gaps = 1/162 (1%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFC-EEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            F++TS+FFG+  +  L ++ +AG+R+C ++DW KLR + +S+ + D+  YCFSSAY+VAL
Sbjct  387  FYYTSEFFGMFSREGLFDLKLAGERYCADDDWGKLRNKQNSMEDLDLSRYCFSSAYVVAL  446

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI  DD+R+  AN+  +IP DW LGA+++ +  D     S  F  + G++     
Sbjct  447  LHDSLGIPFDDKRVHSANRTGSIPFDWTLGAYVVLTMQDAVAHESDNFGEIVGNESVTYF  506

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  + ++++     + +W+ PQLKT+YDLEKG YIV RV R
Sbjct  507  SLFAVLLIVVLAAFLISQWQKPQLKTIYDLEKGHYIVTRVPR  548



>ref|XP_010045148.1| PREDICTED: probable apyrase 6 isoform X3 [Eucalyptus grandis]
Length=522

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 108/162 (67%), Gaps = 1/162 (1%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFC-EEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            F++TS+FFG+  +  L ++ +AG+R+C ++DW KLR + +S+ + D+  YCFSSAY+VAL
Sbjct  361  FYYTSEFFGMFSREGLFDLKLAGERYCADDDWGKLRNKQNSMEDLDLSRYCFSSAYVVAL  420

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLGI  DD+R+  AN+  +IP DW LGA+++ +  D     S  F  + G++     
Sbjct  421  LHDSLGIPFDDKRVHSANRTGSIPFDWTLGAYVVLTMQDAVAHESDNFGEIVGNESVTYF  480

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +  + ++++     + +W+ PQLKT+YDLEKG YIV RV R
Sbjct  481  SLFAVLLIVVLAAFLISQWQKPQLKTIYDLEKGHYIVTRVPR  522



>ref|XP_002971296.1| hypothetical protein SELMODRAFT_94922 [Selaginella moellendorffii]
 gb|EFJ27894.1| hypothetical protein SELMODRAFT_94922 [Selaginella moellendorffii]
Length=541

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 106/157 (68%), Gaps = 4/157 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FFGL     L+++  AG  +C E W+KL+ ++  + EED+L YCFS+AYIVAL
Sbjct  383  NFFYTSEFFGLPATTSLADVEAAGDFYCGEQWTKLKDKHVGIQEEDLLKYCFSTAYIVAL  442

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGIA+ DER+ + N+  N+PLDWALGA +++   ++ EE S+W    FGDD    +
Sbjct  443  LHDRLGIAMHDERVRFTNKVGNVPLDWALGALMVKLADNI-EERSEW---SFGDDWVTIL  498

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIV  293
               G   L+  +   V + R P+LKT+YDLEKG+YI 
Sbjct  499  SFFGSFGLVFVLVWLVLRCRKPRLKTIYDLEKGRYIT  535



>ref|XP_001756852.1| predicted protein [Physcomitrella patens]
 gb|EDQ78449.1| predicted protein, partial [Physcomitrella patens]
Length=455

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FF L  K  L+ +M AG+ +C E+W+ LR ++  + E+D+L YCFS+AYIVAL
Sbjct  305  NFFYTSEFFKLPAKTSLANLMDAGEHYCGENWANLRVKHKEVEEKDLLKYCFSTAYIVAL  364

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            +HDSLGI++ D+R+ + N+ +++PLDWALGA I++ + D ++ S  W   +F       +
Sbjct  365  MHDSLGISMHDDRVRFTNKVHDVPLDWALGALIVKLSEDEEQVSHVW---LFSSGYVKVL  421

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGK  302
             +L +  + I V  ++ +WR PQ+ T+YDLEKG+
Sbjct  422  SLLVLLSVGILVIWFIARWRRPQVTTIYDLEKGR  455



>ref|NP_563942.1| probable apyrase 4 [Arabidopsis thaliana]
 sp|Q8H1D8.1|APY4_ARATH RecName: Full=Probable apyrase 4; Short=AtAPY4; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
4 [Arabidopsis thaliana]
 gb|AAN13015.1| putative nucleoside triphosphatase [Arabidopsis thaliana]
 gb|AEE29126.1| probable apyrase 4 [Arabidopsis thaliana]
 gb|AEJ38085.1| nucleoside triphosphate diphosphohydrolase 4 [Arabidopsis thaliana]
Length=503

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AGKRFC E+WSKL+ +Y +  +E++L YCFSSAYI+++
Sbjct  381  NFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIISM  440

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQS  476
            LHDSLG+ALDDERI YA++A   +IPLDWALGAFIL +
Sbjct  441  LHDSLGVALDDERIKYASKAGEEDIPLDWALGAFILNT  478



>gb|AAK76563.1| putative nucleoside triphosphatase [Arabidopsis thaliana]
Length=503

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AGKRFC E+WSKL+ +Y +  +E++L YCFSSAYI+++
Sbjct  381  NFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIISM  440

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQS  476
            LHDSLG+ALDDERI YA++A   +IPLDWALGAFIL +
Sbjct  441  LHDSLGVALDDERIKYASKAGEEDIPLDWALGAFILNT  478



>ref|XP_010476471.1| PREDICTED: probable apyrase 4 [Camelina sativa]
Length=506

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 85/97 (88%), Gaps = 1/97 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSE+++AGKR+C E+WSKL+ +Y +  +E++L YCFSSAYIV++
Sbjct  382  NFFHTSKFFGLGEKHWLSELILAGKRYCGEEWSKLKVKYPTFKDENLLRYCFSSAYIVSM  441

Query  583  LHDSLGIALDDERIGYANQAN-NIPLDWALGAFILQS  476
            LHDSLGIALDDERIG+A++A  +IPLDWALGAFIL +
Sbjct  442  LHDSLGIALDDERIGFASKAGQDIPLDWALGAFILNT  478



>gb|AAD39310.1|AC007576_33 Hypothetical protein [Arabidopsis thaliana]
Length=508

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AGKRFC E+WSKL+ +Y +  +E++L YCFSSAYI+++
Sbjct  355  NFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKVKYPTFKDENLLRYCFSSAYIISM  414

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQS  476
            LHDSLG+ALDDERI YA++A   +IPLDWALGAFIL +
Sbjct  415  LHDSLGVALDDERIKYASKAGEEDIPLDWALGAFILNT  452



>gb|AAF43924.1|AC012188_1 Strong similarity to ecto-apyrase from Rattus norvegicus gb|U81295 
and is a member of the GDA1/CD39 (nucleoside phosphatase) 
PF|01150 family. This gene is cut off at the 5' end, partial 
[Arabidopsis thaliana]
Length=405

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 90/115 (78%), Gaps = 5/115 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AGKRFC E+WSKL+ +Y +  ++ +  YCFSSAYI+++
Sbjct  290  NFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKEKYPTTKDKYLHRYCFSSAYIISM  349

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSN---SDLDEESSKWFAF  434
            LHDSLG+ALDDERI YA++A   NIPLDWALGAFIL ++   SD + +S K   F
Sbjct  350  LHDSLGVALDDERIKYASKAGKENIPLDWALGAFILNTDTPTSDYNGKSRKMIGF  404



>ref|NP_172877.1| probable apyrase 5 [Arabidopsis thaliana]
 sp|Q6NQA8.1|APY5_ARATH RecName: Full=Probable apyrase 5; Short=AtAPY5; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
5 [Arabidopsis thaliana]
 gb|AAQ65173.1| At1g14250 [Arabidopsis thaliana]
 dbj|BAD42898.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43282.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29131.1| probable apyrase 5 [Arabidopsis thaliana]
 gb|AEJ38086.1| nucleoside triphosphate diphosphohydrolase 5 [Arabidopsis thaliana]
Length=488

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 90/115 (78%), Gaps = 5/115 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AGKRFC E+WSKL+ +Y +  ++ +  YCFSSAYI+++
Sbjct  373  NFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKEKYPTTKDKYLHRYCFSSAYIISM  432

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSN---SDLDEESSKWFAF  434
            LHDSLG+ALDDERI YA++A   NIPLDWALGAFIL ++   SD + +S K   F
Sbjct  433  LHDSLGVALDDERIKYASKAGKENIPLDWALGAFILNTDTPTSDYNGKSRKMIGF  487



>ref|XP_006307338.1| hypothetical protein CARUB_v10008956mg [Capsella rubella]
 gb|EOA40236.1| hypothetical protein CARUB_v10008956mg [Capsella rubella]
Length=493

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM+ AGKRFC E+WSKL+ +Y +  +E++L YCFSSAYIV++
Sbjct  369  NFFHTSKFFGLGEKNWLSEMISAGKRFCGEEWSKLKMKYPTFKDENLLRYCFSSAYIVSM  428

Query  583  LHDSLGIALDDERIGYANQAN-NIPLDWALGAFILQS  476
            LHDSLG+AL DERIG+A +A  +IPLDWALGAFIL +
Sbjct  429  LHDSLGVALHDERIGFAGKAGQDIPLDWALGAFILNT  465



>ref|XP_002890044.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66303.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LSEM++AG RFC EDWSKL+ +Y +  +E++L YCFSSAYI+++
Sbjct  382  NFFHTSKFFGLGEKDWLSEMILAGNRFCGEDWSKLKVKYPTFKDENLLRYCFSSAYIISM  441

Query  583  LHDSLGIALDDERIGYANQA--NNIPLDWALGAFILQS  476
            LHDSLG+ALDD+RI YA++A  ++IPLDWALGAFIL +
Sbjct  442  LHDSLGVALDDKRIKYASKAGDDDIPLDWALGAFILNT  479



>tpg|DAA45565.1| TPA: putative nucleoside phosphatase GDA1/CD39 family protein 
[Zea mays]
Length=243

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 104/167 (62%), Gaps = 16/167 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            N + TSKFFGL   + LS+ M AG++FC +  S LR  + + ++ED   YCFS AYIVAL
Sbjct  87   NLYFTSKFFGLKKSSSLSDFMFAGEQFCNQHLSSLRKRHPNRSDEDFSRYCFSMAYIVAL  146

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFI-LQSNSDLDE-----ESSKWFAFMFGD  422
            LHDSLG+ LDD+RI Y+NQ  +I ++WALGAFI L  N+ L       ES+     +F  
Sbjct  147  LHDSLGVPLDDKRIEYSNQVGDIQVEWALGAFITLMQNTSLKPLHTTAESTHSNRPLFA-  205

Query  421  DlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
                      + + L+   L+V +WR P+ K +YDLEKG+YI+ R+S
Sbjct  206  ---------VLGMFLLCGVLFVSRWRKPKTKIIYDLEKGRYIITRIS  243



>gb|AFW87970.1| putative nucleoside phosphatase GDA1/CD39 family protein [Zea 
mays]
Length=223

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ M AG++FC +D S LR ++ + ++ED   YCFS AYIVAL
Sbjct  67   NFYFTSKFFGLKKSSSLSDFMFAGEQFCNQDLSTLRKKHPNRSDEDFSRYCFSMAYIVAL  126

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG++LDD+RI Y+NQ  +I ++WALGAFI    + +   S K          S   
Sbjct  127  LHDSLGVSLDDKRIEYSNQVGDIQVEWALGAFI----TLIQNASLKPLHTAVESTHSNRP  182

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            L   + + L+   L+V +WR  + K +YDLEKG+YI+  +S
Sbjct  183  LFAVLGMFLLCGVLFVSRWRKHKTKVIYDLEKGRYIITHIS  223



>gb|AFW87969.1| putative nucleoside phosphatase GDA1/CD39 family protein [Zea 
mays]
Length=250

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ M AG++FC +D S LR ++ + ++ED   YCFS AYIVAL
Sbjct  94   NFYFTSKFFGLKKSSSLSDFMFAGEQFCNQDLSTLRKKHPNRSDEDFSRYCFSMAYIVAL  153

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG++LDD+RI Y+NQ  +I ++WALGAFI    + +   S K          S   
Sbjct  154  LHDSLGVSLDDKRIEYSNQVGDIQVEWALGAFI----TLIQNASLKPLHTAVESTHSNRP  209

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            L   + + L+   L+V +WR  + K +YDLEKG+YI+  +S
Sbjct  210  LFAVLGMFLLCGVLFVSRWRKHKTKVIYDLEKGRYIITHIS  250



>ref|XP_004984217.1| PREDICTED: probable apyrase 6-like [Setaria italica]
Length=502

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 104/161 (65%), Gaps = 4/161 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ ++AG++ C +D S LR +Y + ++ED   YCFSSAYIVAL
Sbjct  346  NFYFTSKFFGLKKSSSLSDFVLAGEQVCNQDLSTLRKKYPNRSDEDFSRYCFSSAYIVAL  405

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ LDD+RI Y+NQ  +I ++WALGAFI      L  + S   A     +  +  
Sbjct  406  LHDSLGVPLDDKRIEYSNQVGDIQVEWALGAFITLMQ-HLSLKPSHTAAASTHSNRPLFA  464

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            +V    +   F+   V +WR P+ K +YDLEKG+YI+ R+S
Sbjct  465  VVGMFLLCGAFL---VSRWRKPKTKIIYDLEKGRYIITRIS  502



>ref|XP_002467786.1| hypothetical protein SORBIDRAFT_01g034030 [Sorghum bicolor]
 gb|EER94784.1| hypothetical protein SORBIDRAFT_01g034030 [Sorghum bicolor]
Length=507

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 105/170 (62%), Gaps = 22/170 (13%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ M AG++ C +D S LR +Y + ++ED   YCFS AYIVAL
Sbjct  351  NFYFTSKFFGLKKSSSLSDFMFAGEQSCNQDLSTLRKKYPNRSDEDFSRYCFSMAYIVAL  410

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFI-LQSNSDLDE--------ESSKWFAFM  431
            LHDSLG+ LDD+RI Y+NQ  ++ ++WALGAFI L  N+ L           S++    +
Sbjct  411  LHDSLGVPLDDKRIEYSNQVGDVQVEWALGAFITLMQNTSLKPLHTAAEPIHSNRPLFAV  470

Query  430  FGDDlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             G             + L+   L+V +WR P+ K +YDLEKG+YI+ R+S
Sbjct  471  LG-------------MFLLCGVLFVSRWRKPKTKIIYDLEKGRYIITRIS  507



>gb|KFK43668.1| hypothetical protein AALP_AA1G157400 [Arabis alpina]
Length=497

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF HTSKFFGL  K +LSEM+ AGK FC +DWSKL+ +Y +  +E++L YCFSSAYI+++
Sbjct  376  NFVHTSKFFGLGEKDWLSEMIKAGKSFCGDDWSKLKVKYPTFKDENLLRYCFSSAYILSM  435

Query  583  LHDSLGIALDDERIGYANQAN-NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLG A+DDERIG+A++A  +IPLDWALGAFIL + +   + S K
Sbjct  436  LHDSLGFAIDDERIGFADKAGEDIPLDWALGAFILNTVTTTSDYSGK  482



>gb|EEC75360.1| hypothetical protein OsI_11798 [Oryza sativa Indica Group]
Length=508

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   A LS+ ++AG++FC +D S LR  Y + +++D   YCFSSAYIVAL
Sbjct  352  NFYFTSKFFGLKQSASLSDFVLAGEQFCNKDLSTLRQMYPNRSDDDFSRYCFSSAYIVAL  411

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ LDD+RI Y+NQ  +  ++WALGAFI      + E S+       G     S 
Sbjct  412  LHDSLGVPLDDKRIEYSNQVGDTQVEWALGAFISNIKGVIVEPSAT------GRSAHRSR  465

Query  403  lvlgisillIFV--TLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             +L + + +  +   L + +WR P+ K +YDLEKG+YI+ R+S
Sbjct  466  PLLAVLLGVFLLGGALCLARWRKPKTKIIYDLEKGRYIITRIS  508



>gb|KFK43667.1| hypothetical protein AALP_AA1G157400 [Arabis alpina]
Length=515

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF HTSKFFGL  K +LSEM+ AGK FC +DWSKL+ +Y +  +E++L YCFSSAYI+++
Sbjct  394  NFVHTSKFFGLGEKDWLSEMIKAGKSFCGDDWSKLKVKYPTFKDENLLRYCFSSAYILSM  453

Query  583  LHDSLGIALDDERIGYANQAN-NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLG A+DDERIG+A++A  +IPLDWALGAFIL + +   + S K
Sbjct  454  LHDSLGFAIDDERIGFADKAGEDIPLDWALGAFILNTVTTTSDYSGK  500



>ref|XP_006417039.1| hypothetical protein EUTSA_v10007159mg [Eutrema salsugineum]
 gb|ESQ35392.1| hypothetical protein EUTSA_v10007159mg [Eutrema salsugineum]
Length=589

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF HTSKFFGL  K +L+EM++AGKRFC +DW KL+ ++ +  +E +L YCFSSAYIV++
Sbjct  468  NFVHTSKFFGLGEKDWLTEMILAGKRFCGDDWLKLKVKHPTFKDESLLRYCFSSAYIVSM  527

Query  583  LHDSLGIALDDERIGYANQAN-NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLG ALDD+RIG+A++A  +IPLDWALGAFIL + +   + S K
Sbjct  528  LHDSLGFALDDQRIGFADKAGEDIPLDWALGAFILNTATTTSDYSGK  574



>ref|NP_001141138.1| uncharacterized protein LOC100273224 [Zea mays]
 gb|ACF85501.1| unknown [Zea mays]
Length=494

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 104/167 (62%), Gaps = 16/167 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            N + TSKFFGL   + LS+ M AG++FC +  S LR  + + ++ED   YCFS AYIVAL
Sbjct  338  NLYFTSKFFGLKKSSSLSDFMFAGEQFCNQHLSSLRKRHPNRSDEDFSRYCFSMAYIVAL  397

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFI-LQSNSDLDE-----ESSKWFAFMFGD  422
            LHDSLG+ LDD+RI Y+NQ  +I ++WALGAFI L  N+ L       ES+     +F  
Sbjct  398  LHDSLGVPLDDKRIEYSNQVGDIQVEWALGAFITLMQNTSLKPLHTTAESTHSNRPLFA-  456

Query  421  DlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
                      + + L+   L+V +WR P+ K +YDLEKG+YI+ R+S
Sbjct  457  ---------VLGMFLLCGVLFVSRWRKPKTKIIYDLEKGRYIITRIS  494



>ref|NP_001050230.1| Os03g0378000 [Oryza sativa Japonica Group]
 gb|ABF96240.1| GDA1/CD39 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12144.1| Os03g0378000 [Oryza sativa Japonica Group]
 dbj|BAG94302.1| unnamed protein product [Oryza sativa Japonica Group]
Length=508

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ ++AG++FC +D S LR  Y + +++D   YCFSSAYIVAL
Sbjct  352  NFYFTSKFFGLKQSSSLSDFVLAGEQFCNKDLSTLRKMYPNRSDDDFSRYCFSSAYIVAL  411

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ LDD+RI Y+NQ  +  ++WALGAFI      + E S+       G     S 
Sbjct  412  LHDSLGVPLDDKRIEYSNQVGDTQVEWALGAFISNIKGVIVEPSAT------GRSAHRSR  465

Query  403  lvlgisillIFV--TLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             +L + + +  +   L + +WR P+ K +YDLEKG+YI+ R+S
Sbjct  466  PLLAVLLGVFLLGGALCLARWRKPKTKIIYDLEKGRYIITRIS  508



>gb|EEE59145.1| hypothetical protein OsJ_11044 [Oryza sativa Japonica Group]
Length=508

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ ++AG++FC +D S LR  Y + +++D   YCFSSAYIVAL
Sbjct  352  NFYFTSKFFGLKQSSSLSDFVLAGEQFCNKDLSTLRKMYPNRSDDDFSRYCFSSAYIVAL  411

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ LDD+RI Y+NQ  +  ++WALGAFI      + E S+       G     S 
Sbjct  412  LHDSLGVPLDDKRIEYSNQVGDTQVEWALGAFISNIKGVIVEPSAT------GRSAHRSR  465

Query  403  lvlgisillIFV--TLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             +L + + +  +   L + +WR P+ K +YDLEKG+YI+ R+S
Sbjct  466  PLLAVLLGVFLLGGALCLARWRKPKTKIIYDLEKGRYIITRIS  508



>gb|ACF84812.1| unknown [Zea mays]
Length=374

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ M AG++FC +D S LR ++ + ++ED   YCFS AYIVAL
Sbjct  218  NFYFTSKFFGLKKSSSLSDFMFAGEQFCNQDLSTLRKKHPNRSDEDFSRYCFSMAYIVAL  277

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG++LDD+RI Y+NQ  +I ++WALGAFI    + +   S K          S   
Sbjct  278  LHDSLGVSLDDKRIEYSNQVGDIQVEWALGAFI----TLIQNASLKPLHTAVESTHSNRP  333

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            L   + + L+   L+V +WR  + K +YDLEKG+YI+  +S
Sbjct  334  LFAVLGMFLLCGVLFVSRWRKHKTKVIYDLEKGRYIITHIS  374



>ref|XP_006659435.1| PREDICTED: probable apyrase 6-like, partial [Oryza brachyantha]
Length=430

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K+FLS +M+AG++FC  DWSK++ EY S  E ++L +CFSSAYIVAL
Sbjct  272  NFYHTSKFFGLRSKSFLSALMLAGEQFCHGDWSKIKKEYRSFNEGELLLFCFSSAYIVAL  331

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSD  467
            LHD+L + LDD+RI  ANQ   +P+DWALGAFI+Q  S+
Sbjct  332  LHDTLKVPLDDKRIDVANQIGGMPVDWALGAFIVQKASN  370



>ref|XP_008658264.1| PREDICTED: uncharacterized protein LOC100273583 isoform X1 [Zea 
mays]
Length=442

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 106/167 (63%), Gaps = 16/167 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ M AG++FC +D S LR ++ + ++ED   YCFS AYIVAL
Sbjct  286  NFYFTSKFFGLKKSSSLSDFMFAGEQFCNQDLSTLRKKHPNRSDEDFSRYCFSMAYIVAL  345

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFI-LQSNSDLDE-----ESSKWFAFMFGD  422
            LHDSLG++LDD+RI Y+NQ  +I ++WALGAFI L  N+ L       ES+     +F  
Sbjct  346  LHDSLGVSLDDKRIEYSNQVGDIQVEWALGAFITLIQNASLKPLHTAVESTHSNRPLFA-  404

Query  421  DlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
                      + + L+   L+V +WR  + K +YDLEKG+YI+  +S
Sbjct  405  ---------VLGMFLLCGVLFVSRWRKHKTKVIYDLEKGRYIITHIS  442



>ref|XP_006651434.1| PREDICTED: probable apyrase 6-like, partial [Oryza brachyantha]
Length=421

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 103/170 (61%), Gaps = 22/170 (13%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TS FFGL   + LS+ ++AG++ C +D S LR +Y + +++D   YCFSSAYIVAL
Sbjct  265  NFYFTSMFFGLKQSSSLSDFVLAGEQLCSKDMSTLRQKYPNQSDDDFSRYCFSSAYIVAL  324

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDE---------ESSKWFAFM  431
            LHDSLG+ LDD+RI Y+NQ  +  ++WALGAFI      + E         +S    A +
Sbjct  325  LHDSLGVPLDDKRIEYSNQVGDTQVEWALGAFISNIKDTILESPGTGRSARKSRSLLAVL  384

Query  430  FGDDlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
             G             + L+   L++ +WR P+ K +YDLEKG+YI+ RVS
Sbjct  385  LG-------------VFLLGGALWLARWRKPKTKIIYDLEKGRYIITRVS  421



>ref|NP_001141473.1| uncharacterized protein LOC100273583 [Zea mays]
 gb|ACF86444.1| unknown [Zea mays]
Length=504

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 106/167 (63%), Gaps = 16/167 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ M AG++FC +D S LR ++ + ++ED   YCFS AYIVAL
Sbjct  348  NFYFTSKFFGLKKSSSLSDFMFAGEQFCNQDLSTLRKKHPNRSDEDFSRYCFSMAYIVAL  407

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFI-LQSNSDLDE-----ESSKWFAFMFGD  422
            LHDSLG++LDD+RI Y+NQ  +I ++WALGAFI L  N+ L       ES+     +F  
Sbjct  408  LHDSLGVSLDDKRIEYSNQVGDIQVEWALGAFITLIQNASLKPLHTAVESTHSNRPLFA-  466

Query  421  DlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
                      + + L+   L+V +WR  + K +YDLEKG+YI+  +S
Sbjct  467  ---------VLGMFLLCGVLFVSRWRKHKTKVIYDLEKGRYIITHIS  504



>ref|XP_002890045.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66304.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++T+KFF L  K +LSE++ AGKR+C E+WSKL  EY +  EE +  YCFSSAYI+++
Sbjct  371  NFYYTAKFFELEEKGWLSELIPAGKRYCGEEWSKLILEYPTTDEEYLRGYCFSSAYIISM  430

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQS---NSDLDEESSKWFAF  434
            LHDSLGIALDDERI YAN+A   +IPLDWALGAFIL +    SD   +S K+  F
Sbjct  431  LHDSLGIALDDERITYANEAGEKHIPLDWALGAFILDAVTPTSDYSGKSRKYLGF  485



>gb|EEE68754.1| hypothetical protein OsJ_27446 [Oryza sativa Japonica Group]
Length=447

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFF L  K+FLS++M+AG++FC  DWSK++ EY S  E ++L +CFSSAYIVAL
Sbjct  291  NFYHTSKFFRLRSKSFLSDLMLAGEKFCRGDWSKIKKEYRSFNEGELLLFCFSSAYIVAL  350

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSD  467
            LHD+L + LDD+RI  ANQ   +P+DWALGAFI+Q  S+
Sbjct  351  LHDTLKVPLDDKRIDVANQIGGVPVDWALGAFIVQKASN  389



>ref|NP_001061886.1| Os08g0436100 [Oryza sativa Japonica Group]
 dbj|BAD10140.1| putative ectonucleoside triphosphate diphosphohydrolase [Oryza 
sativa Japonica Group]
 dbj|BAF23800.1| Os08g0436100 [Oryza sativa Japonica Group]
 dbj|BAG89345.1| unnamed protein product [Oryza sativa Japonica Group]
Length=537

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFF L  K+FLS++M+AG++FC  DWSK++ EY S  E ++L +CFSSAYIVAL
Sbjct  381  NFYHTSKFFRLRSKSFLSDLMLAGEKFCRGDWSKIKKEYRSFNEGELLLFCFSSAYIVAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSD  467
            LHD+L + LDD+RI  ANQ   +P+DWALGAFI+Q  S+
Sbjct  441  LHDTLKVPLDDKRIDVANQIGGVPVDWALGAFIVQKASN  479



>ref|XP_007146158.1| hypothetical protein PHAVU_006G017200g, partial [Phaseolus vulgaris]
 gb|ESW18152.1| hypothetical protein PHAVU_006G017200g, partial [Phaseolus vulgaris]
Length=155

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 96/152 (63%), Gaps = 0/152 (0%)
 Frame = -3

Query  733  LSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALD  554
            ++P+  L ++  AG+ +CE+ W  L+ +++ +   D+L YCFSSAY++ALLHD LGIA++
Sbjct  4    MAPRTSLFQLEEAGRHYCEDHWDTLKDQHNEIDYVDLLQYCFSSAYMLALLHDVLGIAME  63

Query  553  DERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisilvlgisillI  374
            ++ +G+ NQ  N  +DW LG+FI+++  +  E        + G++      +     L+I
Sbjct  64   EKSVGFGNQKINSHVDWTLGSFIVETMGEPLELEHIDTGMIVGNESVTYFSLFAFFFLII  123

Query  373  FVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
                +V +WR PQLKTVYDLEKG YIV R+ R
Sbjct  124  LAAFFVMQWRKPQLKTVYDLEKGHYIVTRIRR  155



>ref|XP_009148706.1| PREDICTED: probable apyrase 4 [Brassica rapa]
 emb|CDY49104.1| BnaA06g09020D [Brassica napus]
Length=490

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL  K +LS M+ AG+ FC +DWSKL+ ++ +  +E +L YCFSSAYIV++
Sbjct  376  NFFHTSKFFGLREKDWLSAMISAGESFCGDDWSKLKVKHPTFKDESLLRYCFSSAYIVSM  435

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLG+ALDD+R+ +A++A    IPLDWALGAFIL + + + + S K
Sbjct  436  LHDSLGVALDDQRVEFASEAGEKGIPLDWALGAFILNTATAISDNSGK  483



>tpg|DAA48968.1| TPA: putative nucleoside phosphatase GDA1/CD39 family protein 
[Zea mays]
Length=287

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGLS K FLS++MVAG++FC  DWSK++ +Y S  +  +L +CFSSAYI+AL
Sbjct  131  NFYHTSKFFGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIAL  190

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LHD+L + LD +RI   NQ + +P+DWALGAFI+Q+ 
Sbjct  191  LHDTLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTT  227



>dbj|BAD95196.1| nucleoside triphosphatase like protein [Arabidopsis thaliana]
Length=114

 Score =   125 bits (313),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -3

Query  610  FSSAYIVALLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK----W  443
            FSSAYIV+LLHD+LGI LDDERIGYANQA +IPLDWALGAFI Q+ ++  + ++     W
Sbjct  1    FSSAYIVSLLHDTLGIPLDDERIGYANQAGDIPLDWALGAFIQQTATETSQHAASGNLHW  60

Query  442  FAFMFGDDlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRV  284
            F  +F +       ++GI IL+  +   V KWR PQLKT+YDLEKG+YIV R+
Sbjct  61   FHALFSNHPKTLHYLIGIPILMTVLVYLVTKWRKPQLKTIYDLEKGRYIVTRI  113



>dbj|BAK05639.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 102/161 (63%), Gaps = 4/161 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ +VAG++ C ++ S LR +Y + ++ED   YCFSSAYIVAL
Sbjct  346  NFYFTSKFFGLDRSSSLSDFVVAGEQLCNKELSTLRQKYLNHSDEDFSRYCFSSAYIVAL  405

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ LDD+RI Y+NQ  +  ++WALGAFI  +   +   S    A        +  
Sbjct  406  LHDSLGVPLDDKRIEYSNQVGDTHIEWALGAFIANTKHTILGASGAAAAPAH-KHRPLLA  464

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            ++       +F+ L   +WR P+ + +YDLEKG+YI+ R+S
Sbjct  465  VLGAFLACGVFLVL---RWRKPKTRIIYDLEKGRYIITRIS  502



>emb|CDY39332.1| BnaC05g10470D [Brassica napus]
Length=490

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFF L  K +LS M+ AG+ FC +DWSKL+ ++ +  +E +L YCFSSAYIV++
Sbjct  376  NFFHTSKFFALREKDWLSAMISAGESFCGDDWSKLKVKHPTFKDESLLRYCFSSAYIVSM  435

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLG+ALDD+R+ +A++A    IPLDWALGAFIL + + + + S K
Sbjct  436  LHDSLGVALDDQRVEFASEAGEKGIPLDWALGAFILNTATAISDNSGK  483



>gb|EEC83627.1| hypothetical protein OsI_29353 [Oryza sativa Indica Group]
Length=503

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFF L  K+FLS++M+AG++FC  DWSK++ EY S  E ++L +CFSSAYIVAL
Sbjct  347  NFYHTSKFFRLRSKSFLSDLMLAGEKFCRGDWSKIKKEYRSFNEGELLLFCFSSAYIVAL  406

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSD  467
            LHD+L + LDD+ I  ANQ   +P+DWALGAFI+Q  S+
Sbjct  407  LHDTLKVPLDDKMIDVANQIGGVPVDWALGAFIVQKASN  445



>ref|XP_003557820.1| PREDICTED: probable apyrase 6 [Brachypodium distachyon]
Length=499

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 7/161 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKF GL   + LS+   AG++FC +D S LR +Y + ++ED   YCFSSAYIVAL
Sbjct  346  NFYFTSKFLGLKQSSSLSDFAHAGEQFCNKDLSTLRQKYINQSDEDFSRYCFSSAYIVAL  405

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHDSLG+ L+D RI ++NQ  +  ++WALGAFI      +   ++           +   
Sbjct  406  LHDSLGVPLEDNRIEFSNQVRDTQVEWALGAFITNMKGTIPGAAAASV-------HNHIP  458

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            L+  +   L     +V +WR P+ K +YDLEKG+YI+ R+S
Sbjct  459  LLAVLGAFLACGVFFVSRWRKPKTKIIYDLEKGRYIITRIS  499



>ref|XP_004973524.1| PREDICTED: probable apyrase 6-like isoform X3 [Setaria italica]
Length=529

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K+FLS++MVAG++FC  DWSK++ +Y S  E ++L +CFSSAYI+AL
Sbjct  373  NFYHTSKFFGLHSKSFLSDLMVAGEKFCHGDWSKIKKKYSSFDEGELLLFCFSSAYIIAL  432

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQS  476
            LHDSL + LD +RI   NQ + +P+DWALGAFI+Q+
Sbjct  433  LHDSLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQT  468



>ref|XP_004973522.1| PREDICTED: probable apyrase 6-like isoform X1 [Setaria italica]
Length=535

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K+FLS++MVAG++FC  DWSK++ +Y S  E ++L +CFSSAYI+AL
Sbjct  373  NFYHTSKFFGLHSKSFLSDLMVAGEKFCHGDWSKIKKKYSSFDEGELLLFCFSSAYIIAL  432

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQS  476
            LHDSL + LD +RI   NQ + +P+DWALGAFI+Q+
Sbjct  433  LHDSLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQT  468



>ref|XP_008675061.1| PREDICTED: LOC100281594 isoform X3 [Zea mays]
Length=526

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGLS K FLS++MVAG++FC  DWSK++ +Y S  +  +L +CFSSAYI+AL
Sbjct  370  NFYHTSKFFGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LHD+L + LD +RI   NQ + +P+DWALGAFI+Q+ 
Sbjct  430  LHDTLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTT  466



>ref|XP_008675054.1| PREDICTED: LOC100281594 isoform X2 [Zea mays]
Length=537

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGLS K FLS++MVAG++FC  DWSK++ +Y S  +  +L +CFSSAYI+AL
Sbjct  381  NFYHTSKFFGLSSKPFLSDLMVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIAL  440

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LHD+L + LD +RI   NQ + +P+DWALGAFI+Q+ 
Sbjct  441  LHDTLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTT  477



>ref|XP_009148707.1| PREDICTED: probable apyrase 5 [Brassica rapa]
 ref|XP_009148708.1| PREDICTED: probable apyrase 5 [Brassica rapa]
Length=472

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K +LSEM+ AGK FC E+WSKL+ +Y +  E+ +  YCFSSAYI++L
Sbjct  359  NFYHTSKFFGLDEKDWLSEMISAGKSFCGEEWSKLKEKYPTTKEKYLDGYCFSSAYIISL  418

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDL  464
            LHDSLG ALDDERI +AN+A    I LDWALGAFIL +++ +
Sbjct  419  LHDSLGFALDDERIEFANKAGEKGIALDWALGAFILNTDTTI  460



>emb|CDY49103.1| BnaA06g09030D [Brassica napus]
Length=471

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K +LSEM+ AGK FC E+WSKL+ +Y +  E+ +  YCFSSAYI++L
Sbjct  358  NFYHTSKFFGLDEKDWLSEMISAGKSFCGEEWSKLKEKYPTTKEKYLDGYCFSSAYIISL  417

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDL  464
            LHDSLG ALDDERI +AN+A    I LDWALGAFIL +++ +
Sbjct  418  LHDSLGFALDDERIEFANKAGEKGIALDWALGAFILNTDTTI  459



>ref|XP_006417036.1| hypothetical protein EUTSA_v10007616mg [Eutrema salsugineum]
 gb|ESQ35389.1| hypothetical protein EUTSA_v10007616mg [Eutrema salsugineum]
Length=450

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +F++TSKFF L  K +LSEM+ AGKRFC+E+WSKL+ +Y +  EE +L YCFSSAYI+++
Sbjct  341  SFYYTSKFFELHEKGWLSEMIPAGKRFCKEEWSKLKDKYPTTNEEYLLGYCFSSAYIISM  400

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDLDEESSKWFA  437
            LHDSLG ALDD RI +A++A   +IPLDWALGAFIL++ SD   +S K   
Sbjct  401  LHDSLGFALDDGRIEFASKAGAKDIPLDWALGAFILKT-SDYSGKSRKMLG  450



>emb|CDY39331.1| BnaC05g10480D [Brassica napus]
Length=470

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K +LSEM+ AGK FC E+WSKL+ +Y +  E+ +  YCFSSAYI+++
Sbjct  357  NFYHTSKFFGLDEKDWLSEMIKAGKSFCGEEWSKLKEKYPTTKEKYLDGYCFSSAYIISM  416

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDL  464
            LHDSLG ALDDERI +AN+A    I LDWALGAFIL +++ +
Sbjct  417  LHDSLGFALDDERIEFANKAGEKGIALDWALGAFILNTDTTI  458



>gb|KFK43669.1| hypothetical protein AALP_AA1G157600, partial [Arabis alpina]
Length=299

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++TS FF L  K +L+EM+ AGKR+C+E+WSKL+  Y +  EE ++ YCFSSAYI+++
Sbjct  177  NFYYTSTFFELHEKDWLAEMIPAGKRYCKEEWSKLKETYPTTKEEYLVGYCFSSAYIISM  236

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLG AL+D RI +A++A    IPLDWALGAFILQ++ +  + S K
Sbjct  237  LHDSLGFALNDGRIEFASKAGEKKIPLDWALGAFILQTSREFSDNSGK  284



>ref|XP_006575168.1| PREDICTED: probable apyrase 6-like [Glycine max]
Length=547

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 101/162 (62%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +F +TS+   ++P+  L ++   G+ +CE+ W  L+  ++ +   D+L YCFSSAY++AL
Sbjct  376  SFLYTSEILRMAPRTSLFQLEAEGRHYCEDHWDALKDLHNEVDYMDLLKYCFSSAYMLAL  435

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGIA++++R+G+ N+  N  +DW LG+FI ++ ++  E        + G++     
Sbjct  436  LHDVLGIAMEEKRVGFGNRKINSDVDWTLGSFITETMAEPLELEHLDTGMIVGNESVTYF  495

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +     L +    +V +WR PQLKTVYDLEKG+YIV R+ R
Sbjct  496  SLFAFLFLFMLAAFFVLQWRKPQLKTVYDLEKGRYIVTRIPR  537



>ref|XP_010476473.1| PREDICTED: probable apyrase 3 [Camelina sativa]
Length=488

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++T++FF L  K +LSE++ AGK++C E+WSKL+ EY +  EE +  YCFSSAYI+A+
Sbjct  373  NFYYTAEFFELREKGWLSELIPAGKKYCGEEWSKLKLEYPTTEEEFLRGYCFSSAYIIAM  432

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLGIALDDERI YA+ A   +IPLDWALGAFIL + +    +  K
Sbjct  433  LHDSLGIALDDERIKYASNAGEKHIPLDWALGAFILDTVTPTSYKGGK  480



>ref|NP_001031045.1| probable apyrase 3 [Arabidopsis thaliana]
 gb|AEE29129.1| probable apyrase 3 [Arabidopsis thaliana]
Length=479

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +F++T+KFF L  K +LSE++ AGKR+C E+WSKL  EY +  EE +  YCFS+AY +++
Sbjct  365  SFYYTAKFFELEEKGWLSELIPAGKRYCGEEWSKLILEYPTTDEEYLRGYCFSAAYTISM  424

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFIL---QSNSDLDEESSKWFAF  434
            LHDSLGIALDDE I YA++A   +IPLDWALGAFIL     NSD + +S K+  F
Sbjct  425  LHDSLGIALDDESITYASKAGEKHIPLDWALGAFILDVVTPNSDYNGKSRKYLGF  479



>ref|NP_172876.1| probable apyrase 3 [Arabidopsis thaliana]
 ref|NP_973822.2| probable apyrase 3 [Arabidopsis thaliana]
 ref|NP_001117284.1| probable apyrase 3 [Arabidopsis thaliana]
 sp|Q9XI62.1|APY3_ARATH RecName: Full=Probable apyrase 3; Short=AtAPY3; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
3 [Arabidopsis thaliana]
 gb|AAD39311.1|AC007576_34 Similar to nucleoside phosphatases [Arabidopsis thaliana]
 gb|AAO64935.1| At1g14240 [Arabidopsis thaliana]
 dbj|BAE99403.1| putative nucleoside triphosphatase [Arabidopsis thaliana]
 dbj|BAH20006.1| AT1G14240 [Arabidopsis thaliana]
 gb|AEE29127.1| probable apyrase 3 [Arabidopsis thaliana]
 gb|AEE29128.1| probable apyrase 3 [Arabidopsis thaliana]
 gb|AEE29130.1| probable apyrase 3 [Arabidopsis thaliana]
 gb|AEJ38084.1| nucleoside triphosphate diphosphohydrolase 3 [Arabidopsis thaliana]
Length=483

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +F++T+KFF L  K +LSE++ AGKR+C E+WSKL  EY +  EE +  YCFS+AY +++
Sbjct  369  SFYYTAKFFELEEKGWLSELIPAGKRYCGEEWSKLILEYPTTDEEYLRGYCFSAAYTISM  428

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFIL---QSNSDLDEESSKWFAF  434
            LHDSLGIALDDE I YA++A   +IPLDWALGAFIL     NSD + +S K+  F
Sbjct  429  LHDSLGIALDDESITYASKAGEKHIPLDWALGAFILDVVTPNSDYNGKSRKYLGF  483



>ref|XP_010917047.1| PREDICTED: probable apyrase 6 isoform X2 [Elaeis guineensis]
Length=493

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 97/161 (60%), Gaps = 27/161 (17%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF T+KFFGLSP + LS++M+AG++FC EDWSKL+ +YH+LAEED+             
Sbjct  360  NFFFTTKFFGLSPTSSLSDLMLAGEQFCGEDWSKLKEKYHTLAEEDL-------------  406

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
                        RI +ANQ  NI ++WALGAFI+Q+ +     S  W   +   D    +
Sbjct  407  -----------SRIEFANQVGNIQVEWALGAFIMQTMATRSYHSG-WITSVVQPD--SLV  452

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVS  281
            L+   S LLIF      KWR PQLKT+YDLEKG+YIV RV+
Sbjct  453  LLFVASTLLIFAAWLASKWRRPQLKTIYDLEKGRYIVTRVN  493



>ref|XP_002444398.1| hypothetical protein SORBIDRAFT_07g021350 [Sorghum bicolor]
 gb|EES13893.1| hypothetical protein SORBIDRAFT_07g021350 [Sorghum bicolor]
Length=526

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K+FLS++M AG++FC  DWSK++ +Y S  +  +L +CFSSAYI+AL
Sbjct  370  NFYHTSKFFGLHSKSFLSDLMAAGEKFCHGDWSKIKKKYSSFDDGQLLLFCFSSAYIIAL  429

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LHD+L + LD +RI   NQ + +P+DWALGAFI+Q+ 
Sbjct  430  LHDTLKMPLDHKRIDVVNQIHGVPVDWALGAFIVQTT  466



>ref|XP_010462697.1| PREDICTED: probable apyrase 3 [Camelina sativa]
Length=376

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+++++FF L  K +LSE++ AGK++C E+WSKL+ EY +  EE +  YCFSSAYI+++
Sbjct  260  NFYYSAEFFELKAKGWLSELIPAGKKYCGEEWSKLKLEYPTTEEEFLRGYCFSSAYIISM  319

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQS  476
            LHDSLGIALDDERI YA+ A   +IPLDWALGAFIL +
Sbjct  320  LHDSLGIALDDERIAYASNAGEKHIPLDWALGAFILDT  357



>ref|XP_006307363.1| hypothetical protein CARUB_v10008986mg [Capsella rubella]
 gb|EOA40261.1| hypothetical protein CARUB_v10008986mg [Capsella rubella]
Length=485

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++T+KFF L  K +LSE++ AG ++C E+WSKL++EY +  EE +  YCFSSAY +++
Sbjct  370  NFYYTAKFFELEEKGWLSELIPAGTKYCGEEWSKLKSEYPTTEEEYLRGYCFSSAYTISM  429

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQS  476
            LHDSLGIALDDERI YA++A   +IPLDWALGAFIL +
Sbjct  430  LHDSLGIALDDERITYASKAGAKHIPLDWALGAFILDT  467



>ref|XP_006605578.1| PREDICTED: probable apyrase 6-like isoform X2 [Glycine max]
Length=540

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 102/162 (63%), Gaps = 0/162 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +F +TS+   ++P+  L ++    + +CE+ W  L+ +++ +   D+L YCFSSAY++AL
Sbjct  379  SFLYTSEILRMAPRTSLFQLEAESQHYCEDHWDALKNQHNEVDYLDLLKYCFSSAYMLAL  438

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
            LHD LGIA++++R+G+ +Q  N  +DW LG+FI+++ ++  E        + G++     
Sbjct  439  LHDVLGIAMEEKRVGFGDQKINSHVDWTLGSFIIETMAEPLELEHIDTGMIVGNESLTYF  498

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +     L I    +V +WR PQLKTVYDLEKG+YIV R+ +
Sbjct  499  SLFAFLFLFILAAFFVMQWRKPQLKTVYDLEKGRYIVTRLPK  540



>ref|XP_006417037.1| hypothetical protein EUTSA_v10007743mg [Eutrema salsugineum]
 gb|ESQ35390.1| hypothetical protein EUTSA_v10007743mg [Eutrema salsugineum]
Length=417

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++TS+FFGL  K +LS M +AG  FC+E+WSKL+ +Y    E+ +  YCFSSAYI+++
Sbjct  304  NFYYTSEFFGLKEKNWLSRMTLAGNSFCKEEWSKLKVKYPKTKEKYLHGYCFSSAYIISM  363

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNSDLDEESSK  446
            LHDSLG ALDDERI +AN+A    I LDWALGAFIL++++   + S K
Sbjct  364  LHDSLGFALDDERIEFANKAGEKGISLDWALGAFILKTSTATSDYSGK  411



>ref|XP_010235177.1| PREDICTED: probable apyrase 6 isoform X2 [Brachypodium distachyon]
Length=584

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGL  K+FLS++M+AG++FC  DWS ++ +Y S  E ++L +CFSSAYIVAL
Sbjct  428  NFYHTSKFFGLRSKSFLSDLMLAGEQFCHGDWSNIKKKYRSFNEGELLLFCFSSAYIVAL  487

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSD  467
            LHD+L + +D + I   NQ   +P+DWALGAFI+Q   +
Sbjct  488  LHDTLKVPMDHKSIDVTNQIGGVPVDWALGAFIVQKTPN  526



>emb|CDX81623.1| BnaC08g39780D [Brassica napus]
Length=484

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++TSKFF L  K +L+EM+ AGKR+C+E WS+L+ E+ +  EE +L YCFSSAYI+++
Sbjct  371  NFYYTSKFFELDEKDWLAEMIPAGKRYCKEKWSELKAEHPTTKEEYLLGYCFSSAYIISM  430

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNS  470
            LHDSLG ALDD RI +A++A   +IPL+WALGAFIL+++S
Sbjct  431  LHDSLGFALDDGRIEFASKAGEKDIPLEWALGAFILKTSS  470



>ref|XP_006417035.1| hypothetical protein EUTSA_v10009320mg [Eutrema salsugineum]
 gb|ESQ35388.1| hypothetical protein EUTSA_v10009320mg [Eutrema salsugineum]
Length=470

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +F++TSKFF L  K +LSEM+ AGKRFC E+WS+L+ +Y +  ++ +L+YCFSSAYI+++
Sbjct  357  SFYYTSKFFELHEKDWLSEMIPAGKRFCGENWSELKVQYPTEQDKHLLNYCFSSAYIISM  416

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSN  473
            LHDSLG ALDD RI +A++A   +IPLDWALGAFIL+++
Sbjct  417  LHDSLGFALDDGRIEFASKAGAKDIPLDWALGAFILETS  455



>ref|XP_010652014.1| PREDICTED: probable apyrase 6 isoform X3 [Vitis vinifera]
Length=438

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++ VAG+ FCEEDWSKL+ +Y+S  EED+LHYCFSSAYIVA 
Sbjct  366  NFFYTSKFFGLGSRAFLSDLTVAGQHFCEEDWSKLKRKYYSFNEEDLLHYCFSSAYIVAF  425

Query  583  LHDSLGIALDDER  545
            LHDSLGIALDDER
Sbjct  426  LHDSLGIALDDER  438



>emb|CAN81571.1| hypothetical protein VITISV_013770 [Vitis vinifera]
Length=553

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TSKFFGL  +AFLS++ VAG+ FCEEDWSKL+ +Y+S  EED+LHYCFSSAYIVA 
Sbjct  373  NFFYTSKFFGLGSRAFLSDLTVAGQHFCEEDWSKLKRKYYSFNEEDLLHYCFSSAYIVAF  432

Query  583  LHDSLGIALDDER  545
            LHDSLGIALDDER
Sbjct  433  LHDSLGIALDDER  445



>ref|XP_006417038.1| hypothetical protein EUTSA_v10007501mg [Eutrema salsugineum]
 gb|ESQ35391.1| hypothetical protein EUTSA_v10007501mg [Eutrema salsugineum]
Length=483

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++TSKF GL  K +LSEM+ AGK FC E+WS L+ +Y    E+ +  YCFSSAYI+++
Sbjct  370  NFYYTSKFLGLEEKNWLSEMISAGKSFCGEEWSTLKAKYPKTKEKYLRGYCFSSAYIISM  429

Query  583  LHDSLGIALDDERIGYANQAN--NIPLDWALGAFILQSNS  470
            LHDSLG ALDD+RI +AN+A    I LDWALGAFIL + +
Sbjct  430  LHDSLGFALDDQRIKFANKAGEKGISLDWALGAFILNTPT  469



>ref|XP_002961510.1| hypothetical protein SELMODRAFT_63506, partial [Selaginella moellendorffii]
 gb|EFJ36770.1| hypothetical protein SELMODRAFT_63506, partial [Selaginella moellendorffii]
Length=417

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+TS+FFGL     L+++  AG  +C E W+KL+ ++  + EED+L YCFS+AYIVAL
Sbjct  321  NFFYTSEFFGLPATTSLADVEAAGDFYCGEQWTKLKNKHVGIQEEDLLKYCFSTAYIVAL  380

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQ  479
            LHD LGIA+ DER+ + N+  N+PLDWALGA +++
Sbjct  381  LHDRLGIAMHDERVRFTNKVGNVPLDWALGALMVK  415



>ref|XP_008792491.1| PREDICTED: probable apyrase 6 isoform X3 [Phoenix dactylifera]
Length=507

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF+ S+ FG++P+A L ++  AG+ +CE+ W++L+ E+  + E D+L YCFSSAYIVAL
Sbjct  388  KFFYISELFGMAPRASLLKVEAAGRHYCEDHWARLKEEHFGVDEMDLLKYCFSSAYIVAL  447

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQS  476
            LHD LGI +D +RIG+A+   + P DW LGAFILQ+
Sbjct  448  LHDGLGIPMDGKRIGFADPTVSSPFDWTLGAFILQT  483



>ref|XP_006605577.1| PREDICTED: probable apyrase 6-like isoform X1 [Glycine max]
Length=589

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = -3

Query  691  KRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDDERIGYANQANNIP  512
            + +CE+ W  L+ +++ +   D+L YCFSSAY++ALLHD LGIA++++R+G+ +Q  N  
Sbjct  452  QHYCEDHWDALKNQHNEVDYLDLLKYCFSSAYMLALLHDVLGIAMEEKRVGFGDQKINSH  511

Query  511  LDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisilvlgisillIFVTLYVRKWRNPQL  332
            +DW LG+FI+++ ++  E        + G++      +     L I    +V +WR PQL
Sbjct  512  VDWTLGSFIIETMAEPLELEHIDTGMIVGNESLTYFSLFAFLFLFILAAFFVMQWRKPQL  571

Query  331  KTVYDLEKGKYIVKRVSR  278
            KTVYDLEKG+YIV R+ +
Sbjct  572  KTVYDLEKGRYIVTRLPK  589



>gb|KJB50645.1| hypothetical protein B456_008G180900 [Gossypium raimondii]
Length=456

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFF L  +A LS++M+AG+ FC EDWSKL+ ++ SL EE++L YCFSSAYIVAL
Sbjct  383  NFFHTSKFFRLHQRASLSDLMMAGQHFCGEDWSKLKKKHQSLGEEELLRYCFSSAYIVAL  442

Query  583  LHDSLGIALDDERI  542
            LHDSLGIALDDE +
Sbjct  443  LHDSLGIALDDESL  456



>ref|XP_010939490.1| PREDICTED: probable apyrase 6 isoform X2 [Elaeis guineensis]
Length=479

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+T+KFFGL P +FLS++M+AG++FC EDW KL+  YHS  E+D+L YCFSSAYIVAL
Sbjct  382  NFFYTAKFFGLGPTSFLSDLMLAGEQFCGEDWLKLKGNYHSTDEDDLLRYCFSSAYIVAL  441

Query  583  LHDSLGIALDDE  548
            LHDSLGIALD++
Sbjct  442  LHDSLGIALDEK  453



>ref|XP_008675069.1| PREDICTED: LOC100281594 isoform X4 [Zea mays]
Length=506

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 91/162 (56%), Gaps = 36/162 (22%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+HTSKFFGLS K FLS++MVAG++FC  DWSK++                        
Sbjct  381  NFYHTSKFFGLSSKPFLSDLMVAGEKFCHGDWSKIK------------------------  416

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
                        +I   NQ + +P+DWALGAFI+Q+  +  E S    +++   D    +
Sbjct  417  -----------NKIDVVNQIHGVPVDWALGAFIVQTTMNRTEYSDSSVSYLNSYDSPGLV  465

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
             +L I +++ F  L + +WR P+LKT+YD+EKG+YI+ RVS+
Sbjct  466  PLLFIIVVV-FTALSILRWRKPRLKTIYDMEKGRYIITRVSQ  506



>ref|XP_010066912.1| PREDICTED: probable apyrase 6 isoform X2 [Eucalyptus grandis]
 gb|KCW64959.1| hypothetical protein EUGRSUZ_G02502 [Eucalyptus grandis]
Length=485

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFFHTSKFFGL+ KA LS++M+AG+ FC E WS L+  +H L EED+L YCFSSAYIVA 
Sbjct  413  NFFHTSKFFGLTQKAVLSDLMLAGEHFCGEYWSILKKRHHLLNEEDLLRYCFSSAYIVAF  472

Query  583  LHDSLGIALDDER  545
            LHDSLGIAL+D+R
Sbjct  473  LHDSLGIALNDDR  485



>ref|XP_010685507.1| PREDICTED: probable apyrase 6 [Beta vulgaris subsp. vulgaris]
Length=520

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 98/175 (56%), Gaps = 27/175 (15%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +FF +S+F GL PKA +SE+   G+  CE+D   L++ Y    + D    CFS A++  L
Sbjct  360  SFFLSSQFRGLVPKASISELESIGRYICEDDQENLKSRYGK-DDGDRSRNCFSHAFMAIL  418

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSD-------------LDEESSKW  443
            L++S GI  D++R+ +A  A + P+DW LGAFI Q+  D             ++ ES   
Sbjct  419  LNNSFGIPFDEKRVEFA--AGSTPVDWRLGAFISQTIMDPFDKITEHHDAHIIENESVTH  476

Query  442  FAFMFGDDlsisilvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKYIVKRVSR  278
            F F+FG           + ++++    +V K R PQLKT+YDLEKG YIV RV R
Sbjct  477  F-FLFG----------VLIVIVLLAAFFVMKLRKPQLKTIYDLEKGCYIVTRVPR  520



>gb|ACN35441.1| unknown [Zea mays]
Length=137

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -3

Query  703  MVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDDERIGYANQA  524
            MVAG++FC  DWSK++ +Y S  +  +L +CFSSAYI+ALLHD+L + LD +RI   NQ 
Sbjct  1    MVAGEKFCHGDWSKIKNKYSSFDDGQLLLFCFSSAYIIALLHDTLKMPLDHKRIDVVNQI  60

Query  523  NNIPLDWALGAFILQSN  473
            + +P+DWALGAFI+Q+ 
Sbjct  61   HGVPVDWALGAFIVQTT  77



>ref|XP_007205208.1| hypothetical protein PRUPE_ppa005867mg [Prunus persica]
 gb|EMJ06407.1| hypothetical protein PRUPE_ppa005867mg [Prunus persica]
Length=440

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF  TS+ FGL P A L E+  AG+R+CE+DW K + ++HS+ + D+L YCFSSAY+VAL
Sbjct  357  NFLFTSELFGLVPTASLFELEAAGQRYCEDDWDKQKNQHHSIVDSDLLKYCFSSAYMVAL  416

Query  583  LHDSLGIALDDERIGYANQ  527
            LHDSLGI +D++R+G   +
Sbjct  417  LHDSLGIPMDEKRVGLPTR  435



>ref|XP_010269618.1| PREDICTED: probable apyrase 6 isoform X2 [Nelumbo nucifera]
Length=122

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  751  TSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDS  572
            +++FF L   AFL  +M+ G++FCEEDWS L+ +Y SL+E+D++ YCFSS YIVALLHD+
Sbjct  49   SAEFFRLPEIAFLCNLMLTGQQFCEEDWSTLKKKYSSLSEDDLVRYCFSSFYIVALLHDT  108

Query  571  LGIALDDERI  542
            LGI+LDDER+
Sbjct  109  LGISLDDERL  118



>gb|AFK33538.1| unknown [Lotus japonicus]
Length=130

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF +TSK   ++ +  L E+  AG+ +CEE W  LR +++ +   D+L YCFSSAY+VAL
Sbjct  34   NFLYTSKVLRIASRTSLFELEAAGRNYCEEHWDALRDQHNEIDYLDLLKYCFSSAYMVAL  93

Query  583  LHDSLGIALDDERIGYANQ-ANNIPLDWALGAFILQS  476
            LHD LGI ++++R G  NQ  N   +DW LG+FI+++
Sbjct  94   LHDVLGIPMEEKRFGLGNQMMNGSHVDWTLGSFIIET  130



>ref|XP_010269619.1| PREDICTED: probable apyrase 6 isoform X3 [Nelumbo nucifera]
Length=110

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -3

Query  748  SKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSL  569
            +KFF L   AFL  +M+ G++FCEEDWS L+ +Y SL+E+D++ YCFSS YIVALLHD+L
Sbjct  3    NKFFRLPEIAFLCNLMLTGQQFCEEDWSTLKKKYSSLSEDDLVRYCFSSFYIVALLHDTL  62

Query  568  GIALDDER  545
            GI+LDDER
Sbjct  63   GISLDDER  70



>ref|XP_010269617.1| PREDICTED: probable apyrase 6 isoform X1 [Nelumbo nucifera]
Length=157

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  751  TSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDS  572
            +++FF L   AFL  +M+ G++FCEEDWS L+ +Y SL+E+D++ YCFSS YIVALLHD+
Sbjct  49   SAEFFRLPEIAFLCNLMLTGQQFCEEDWSTLKKKYSSLSEDDLVRYCFSSFYIVALLHDT  108

Query  571  LGIALDDER  545
            LGI+LDDER
Sbjct  109  LGISLDDER  117



>emb|CDY33760.1| BnaA09g45660D [Brassica napus]
Length=105

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF++TSKFF L  K +L+EM+ AGKR+C+E WS+L+ E+ +  EE +L YCFSSAYI+++
Sbjct  33   NFYYTSKFFELDEKDWLAEMIPAGKRYCKEKWSELKAEHPTTKEEYLLGYCFSSAYIISM  92

Query  583  LHDSLGIALDDER  545
            LHDSLG ALD  R
Sbjct  93   LHDSLGFALDYGR  105



>ref|XP_010277375.1| PREDICTED: probable apyrase 6 [Nelumbo nucifera]
Length=87

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -3

Query  745  KFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLG  566
            +FF L     LS +M+ G++FCEE WS L+ +Y SL E+D++ YCFSS+YIVALLHD+LG
Sbjct  19   RFFRLPETTLLSNLMLIGQQFCEEGWSALKKKYSSLYEDDLVRYCFSSSYIVALLHDTLG  78

Query  565  IALDDERI  542
            I+LDD+R+
Sbjct  79   ISLDDQRL  86



>ref|XP_010277663.1| PREDICTED: probable apyrase 5 isoform X2 [Nelumbo nucifera]
 ref|XP_010277664.1| PREDICTED: probable apyrase 5 isoform X2 [Nelumbo nucifera]
 ref|XP_010277665.1| PREDICTED: probable apyrase 5 isoform X2 [Nelumbo nucifera]
Length=157

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  718  FLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDDERIG  539
            FLS +M+ G++FCEEDWS L+ +Y SL+E+ +L YCFSS+YIVALLHD+LGI+LDD+R+ 
Sbjct  77   FLSNLMLTGQQFCEEDWSALKKKYSSLSEDYLLRYCFSSSYIVALLHDTLGISLDDQRLM  136

Query  538  YANQANNIPLDWALGAFI  485
            +     ++ L   L   I
Sbjct  137  WMEMEQSVMLKLLLQPCI  154



>ref|XP_010277662.1| PREDICTED: uncharacterized protein LOC104612050 isoform X1 [Nelumbo 
nucifera]
Length=196

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  718  FLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDDERIG  539
            FLS +M+ G++FCEEDWS L+ +Y SL+E+ +L YCFSS+YIVALLHD+LGI+LDD+R+ 
Sbjct  116  FLSNLMLTGQQFCEEDWSALKKKYSSLSEDYLLRYCFSSSYIVALLHDTLGISLDDQRLM  175

Query  538  YANQANNIPLDWALGAFI  485
            +     ++ L   L   I
Sbjct  176  WMEMEQSVMLKLLLQPCI  193



>gb|EMS51474.1| Nucleoside-diphosphatase mig-23 [Triticum urartu]
Length=457

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ +VAG++ C +D S LR +Y + ++ED   YCFSSAYIVAL
Sbjct  368  NFYFTSKFFGLDRSSSLSDFVVAGEQLCNKDLSTLRQKYLNHSDEDFSRYCFSSAYIVAL  427

Query  583  LHDSLGIALDDERIGY  536
            LHDSLG+ LDD+R  Y
Sbjct  428  LHDSLGVPLDDKRQAY  443



>gb|EMT22486.1| Nucleoside-triphosphatase ntp-1 [Aegilops tauschii]
Length=245

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ +VAG++ C +D S LR  Y + ++ED   YCFSSAYIVAL
Sbjct  156  NFYFTSKFFGLDRSSSLSDFVVAGEQLCNKDLSTLRQTYLNHSDEDFSRYCFSSAYIVAL  215

Query  583  LHDSLGIALDDERIGY  536
            LHD+LG+ LDD+R  Y
Sbjct  216  LHDNLGVPLDDKRQAY  231



>ref|XP_002521641.1| adenosine diphosphatase, putative [Ricinus communis]
 gb|EEF40748.1| adenosine diphosphatase, putative [Ricinus communis]
Length=480

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            + F+TS+FFGL P   L E+  AGK FCE DW  L++E+H + + D++ YCFSSAY+VAL
Sbjct  378  SLFYTSEFFGLVPST-LFELEAAGKHFCEGDWDNLKSEHHGIDDSDLMKYCFSSAYVVAL  436

Query  583  LHDSLGIALDDE  548
            LHDSLGI+++D+
Sbjct  437  LHDSLGISMNDK  448



>gb|KHN01222.1| hypothetical protein glysoja_008124 [Glycine soja]
Length=172

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = -3

Query  544  IGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisilvlgisillIFVT  365
            +  ANQ  +IPLDWALGAFILQ+ +D D ++  W A +F D+         +SI+ IF+ 
Sbjct  85   VKVANQVGSIPLDWALGAFILQTAADADIKNHNWIATIFSDE-----SHTLLSIIGIFIV  139

Query  364  LY----VRKWRNPQLKTVYDLEKGKYIVKRVSR  278
            L     + +WR PQLKT+YDLEKG+YI+ RV R
Sbjct  140  LLTAWSISRWRKPQLKTIYDLEKGRYIITRVGR  172



>ref|XP_001760044.1| predicted protein [Physcomitrella patens]
 gb|EDQ75169.1| predicted protein [Physcomitrella patens]
Length=650

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 84/155 (54%), Gaps = 19/155 (12%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALL  581
            F+ TSK   L     L+E++VAG+R+C            S  +    + CFS+AYIVA L
Sbjct  506  FYQTSKL--LEATGSLAELVVAGERYC------------SAGQNSKRNICFSAAYIVAFL  551

Query  580  HDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAF-MFGDDlsisi  404
            HDSLG+     ++ + +  N++P++W LG FI    S L E+ + +    +F     I +
Sbjct  552  HDSLGLPDHGNKVLFTDSVNSVPVEWTLGFFI----SRLSEDKAAYSPLILFEGFFGIVL  607

Query  403  lvlgisillIFVTLYVRKWRNPQLKTVYDLEKGKY  299
            L LG+      +  +V + R PQ KT+YDLEKG+Y
Sbjct  608  LFLGLLATGSLIFWFVTRLRRPQHKTIYDLEKGRY  642



>ref|XP_010427113.1| PREDICTED: probable apyrase 3 [Camelina sativa]
 ref|XP_010427114.1| PREDICTED: probable apyrase 3 [Camelina sativa]
Length=490

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSL---AEEDMLHYCFSSAYI  593
            NF +TS+FF L+   ++S++   G+ FC++ W  L  EY      +EE +  YCFSSAYI
Sbjct  366  NFAYTSEFFHLNELNWMSDLRQKGEEFCQKTWEALELEYRGTLNYSEEYLRGYCFSSAYI  425

Query  592  VALLHDSLGIALDDERIGYANQANNIPLDWALGAFI  485
            +A+L + LG   D+  I ++N+ +   LDWALGAFI
Sbjct  426  IAML-ERLGFN-DESTIEFSNEVHGTSLDWALGAFI  459



>ref|XP_001691989.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP04479.1| predicted protein [Chlamydomonas reinhardtii]
Length=823

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 53/95 (56%), Gaps = 1/95 (1%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHS-LAEEDMLHYCFSSAYIVA  587
            NF  T++  GL  ++ L E+   G R+C   WS L  E+   + ++ ++ YCF +AYI+A
Sbjct  380  NFAWTARALGLPSRSTLRELREHGNRYCSRHWSSLHAEFSGHIPDQFLVRYCFGAAYILA  439

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFIL  482
            LLH  LG  LDD R+ + N   + P     G+ +L
Sbjct  440  LLHTGLGFGLDDSRLTWTNTVPHAPSGEQAGSTVL  474



>ref|XP_002946739.1| hypothetical protein VOLCADRAFT_120373 [Volvox carteri f. nagariensis]
 gb|EFJ51965.1| hypothetical protein VOLCADRAFT_120373 [Volvox carteri f. nagariensis]
Length=1051

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 7/103 (7%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHS-LAEEDMLHYCFSSAYIVA  587
            NF  T++  GL   A L ++  +G  +C + WS L  E+   + ++ ++ YCF +AYI+A
Sbjct  442  NFAWTARALGLHENATLRQLRESGHHYCAKHWSSLHAEFSGHIPDQFLVRYCFGAAYILA  501

Query  586  LLHDSLGIALDDERIGYAN------QANNIPLDWALGAFILQS  476
            LLH   G+ LDD R+ + N      +   + L+W LGA ++ +
Sbjct  502  LLHSGFGLGLDDGRLWWTNTVREAGEGAEVGLNWVLGAAVVDA  544



>ref|XP_010503068.1| PREDICTED: probable apyrase 3 [Camelina sativa]
Length=482

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSL---AEEDMLHYCFSSAYI  593
            NF +TS+FF L  + ++S++   G+ FC++ W  L+ +Y      +EE +  YCFSSAYI
Sbjct  362  NFAYTSEFFHLDEQNWMSDLRQKGEAFCQKTWEALKVKYRRTPHYSEEYLRGYCFSSAYI  421

Query  592  VALLHDSLGIALDDERIGYANQANNIPLDWALGAFI  485
            +A+L + LG   D+  I ++N+ +   LDWA GAFI
Sbjct  422  IAML-ERLGFN-DESTIEFSNEVHGTSLDWASGAFI  455



>ref|XP_002505556.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66814.1| predicted protein [Micromonas sp. RCC299]
Length=446

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NFF+T++F GL  +A +++M  AG+R C  +W  L   +    E  +  YCFSSA IVA 
Sbjct  257  NFFYTARFLGLPEQATIAQMAGAGERVCGAEWRSLDETFEE-DESSLARYCFSSALIVAA  315

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGD  422
            L   L +     +I ++N      +DWA+GA I  + S ++ E  +W     G+
Sbjct  316  LVHGLKLPA-QAKIRFSNSVGGKAVDWAMGAAIAFTASAVERE-EEWLLGSMGN  367



>ref|XP_006605579.1| PREDICTED: probable apyrase 6-like isoform X3 [Glycine max]
Length=454

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            +F +TS+   ++P+  L ++    + +CE+ W  L+ +++ +   D+L YCFSSAY++AL
Sbjct  379  SFLYTSEILRMAPRTSLFQLEAESQHYCEDHWDALKNQHNEVDYLDLLKYCFSSAYMLAL  438

Query  583  LHDSLGIALDDERI  542
            LHD LGIA++++ I
Sbjct  439  LHDVLGIAMEEKSI  452



>gb|AAL82534.1|AC084766_20 putative apyrase [Oryza sativa Japonica Group]
Length=635

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 75/163 (46%), Gaps = 43/163 (26%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            NF+ TSKFFGL   + LS+ ++AG++FC +D S LR  Y                     
Sbjct  352  NFYFTSKFFGLKQSSSLSDFVLAGEQFCNKDLSTLRKMY---------------------  390

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFGDDlsisi  404
                        RI Y+NQ  +  ++WALGAFI      + E S+       G     S 
Sbjct  391  ----------PNRIEYSNQVGDTQVEWALGAFISNIKGVIVEPSAT------GRSAHRSR  434

Query  403  lvlgisillIFV--TLYVRKWRNPQLKTVYDLEKGK----YIV  293
             +L + + +  +   L + +WR P+ K +YDLEKG+    YIV
Sbjct  435  PLLAVLLGVFLLGGALCLARWRKPKTKIIYDLEKGRCLRCYIV  477



>ref|XP_006292202.1| hypothetical protein CARUB_v10018407mg [Capsella rubella]
 gb|EOA25100.1| hypothetical protein CARUB_v10018407mg [Capsella rubella]
Length=476

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = -3

Query  712  SEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDDERIGYA  533
            S++   G  FC +DW +L  EY     E +  YCFSSAYI+++        L   R+ ++
Sbjct  376  SDLRHKGDAFCRKDWDELVKEYEGTDLEYLRGYCFSSAYIISMFE-----RLGTPRVIFS  430

Query  532  NQANNIPLDWALGAFI  485
            N+  N PL+WALGAFI
Sbjct  431  NKVKNTPLNWALGAFI  446



>ref|XP_001781092.1| predicted protein [Physcomitrella patens]
 gb|EDQ54118.1| predicted protein [Physcomitrella patens]
Length=454

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             F+ TSK+F L   A +++++ AG+++C ++W    ++      + +   CFS+AYIVA 
Sbjct  382  KFYQTSKYFSLPATATIADLVSAGEKYCNQEWGVGVSKDPYPEYKAVQKPCFSAAYIVAF  441

Query  583  LHDSLGIALDDER  545
            LHDSLG+ L D +
Sbjct  442  LHDSLGLPLSDNK  454



>ref|XP_007509972.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19087.1| predicted protein [Bathycoccus prasinos]
Length=595

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWS-----KLRTEYHSLAEEDMLHYCFSSA  599
            NF +T++FF L     + +   AG++ C E W      + R +     E D+  YCFS+A
Sbjct  407  NFHYTAEFFKLGKTTTIRDFQRAGEKLCAESWGDVVKKRFRKDQKKWEEIDLSKYCFSAA  466

Query  598  YIVALLHDSLGIALDDERIGYANQANNIPLDWALGAFI  485
            +IVA+L D + +  +D +    N      +DWA+GA I
Sbjct  467  FIVAMLKDGM-LLPEDLKFTVGNNVGRYNVDWAMGAAI  503



>emb|CDX85159.1| BnaC07g07470D [Brassica napus]
Length=57

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 5/56 (9%)
 Frame = -3

Query  586  LLHDSLGIALDDERIGYANQAN--NIPLDWALGAFIL---QSNSDLDEESSKWFAF  434
            +LHDSLG ALDDERI +A++A   N PLDWALGAFIL   ++  D   +S K   F
Sbjct  1    MLHDSLGFALDDERIRFADKAGAKNTPLDWALGAFILNNAKARYDYSGKSRKILGF  56



>ref|XP_003063669.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52042.1| predicted protein [Micromonas pusilla CCMP1545]
Length=350

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKL-RTEYHSLAEEDMLH-YCFSSAYIV  590
            NF HT++F GL  KA ++++  AG+  C  DW  L RT       ED L  YCFS+A+I 
Sbjct  117  NFHHTARFLGLPEKASVADVASAGEEICAADWDTLVRTRSSGKDGEDELRKYCFSAAFIA  176

Query  589  ALLHDSLGI  563
            A L D++G+
Sbjct  177  AALGDAVGL  185



>ref|XP_008430362.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 3 [Poecilia 
reticulata]
Length=500

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 5/102 (5%)
 Frame = -3

Query  769  Y*NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIV  590
            Y  FF  ++   LS K+ L E  +A   FC  DW++L+ +   ++EE +  YCF+S Y++
Sbjct  357  YAGFFFIARALELSGKSDLDEFKIAVGNFCNSDWAELKVQKRRISEEYLKTYCFASHYVL  416

Query  589  ALLHDSLGIALDDE---RIGYANQANNIPLDWALGAFILQSN  473
             LL D  G   D+E    I +  +     + W+LG  +  SN
Sbjct  417  TLLAD--GYKFDNETWKNIHFEQKIKETSIGWSLGYMLSMSN  456



>emb|CDX78924.1| BnaA01g09910D [Brassica napus]
Length=735

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  472  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  528

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG  +      + W LG  IL++   L 
Sbjct  529  LLREGLYITDKQIIIGSGS------ITWTLGVAILEAGKALS  564



>ref|XP_009132598.1| PREDICTED: probable apyrase 7 [Brassica rapa]
Length=734

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  471  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  527

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG  +      + W LG  IL++   L 
Sbjct  528  LLREGLYITDKQIIIGSGS------ITWTLGVAILEAGKALS  563



>ref|XP_005772842.1| hypothetical protein EMIHUDRAFT_208242 [Emiliania huxleyi CCMP1516]
 gb|EOD20413.1| hypothetical protein EMIHUDRAFT_208242 [Emiliania huxleyi CCMP1516]
Length=126

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = -3

Query  709  EMMVAGKRFCEEDWSKLR-TEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDDERIGYA  533
            +++ AG  FC  +WS +  T+Y + +++   +YCF+SAYI A+L D+ GI  D + + YA
Sbjct  29   QIVSAGSDFCSTEWSAIGVTKYRNDSKKYSKNYCFASAYIPAML-DAYGIDPDTDTVTYA  87

Query  532  NQANNIPLDWALGA  491
            +      L+W LG 
Sbjct  88   SSVGGEALEWPLGC  101



>emb|CDX99396.1| BnaC01g11560D [Brassica napus]
Length=617

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  354  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  410

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG  +      + W LG  +L++   L 
Sbjct  411  LLREGLYITDKQIIIGSGS------ITWTLGVAVLEAGKALS  446



>gb|KJB51504.1| hypothetical protein B456_008G219700 [Gossypium raimondii]
 gb|KJB51506.1| hypothetical protein B456_008G219700 [Gossypium raimondii]
 gb|KJB51507.1| hypothetical protein B456_008G219700 [Gossypium raimondii]
Length=742

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 52/98 (53%), Gaps = 10/98 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LSP+A L +++  G+ FCE+ W   +    S+A +  +  YCF + YIV+
Sbjct  470  GFFVVYRFFNLSPEAALDDVLEKGREFCEKPWEVAK---KSVAPQPFIEQYCFRAPYIVS  526

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LL + L I+     +G  +      + W +G  +L++ 
Sbjct  527  LLREGLHISDSQLVVGSGS------ITWTMGVALLEAG  558



>emb|CDY01587.1| BnaC07g35770D [Brassica napus]
Length=691

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 57/105 (54%), Gaps = 10/105 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  428  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  484

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEES  452
            LL +  G+ + D++I   + +    + W LG  +L++   L   +
Sbjct  485  LLRE--GLYITDKQIVIGSGS----ITWTLGVALLEAGKALSSST  523



>gb|ADG38760.1| AT4G19180-like protein, partial [Capsella grandiflora]
 gb|ADG38762.1| AT4G19180-like protein, partial [Capsella grandiflora]
 gb|ADG38763.1| AT4G19180-like protein, partial [Capsella grandiflora]
 gb|ADG38764.1| AT4G19180-like protein, partial [Capsella grandiflora]
 gb|ADG38765.1| AT4G19180-like protein, partial [Capsella grandiflora]
Length=207

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 51/97 (53%), Gaps = 10/97 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  120  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  176

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQS  476
            LL + L I      IG  +      + W LG  +L++
Sbjct  177  LLREGLYITDKQIVIGSGS------ITWTLGVALLEA  207



>dbj|BAJ93718.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=701

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 10/103 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             F+   KFF L+P A L +++  G+ FCE+ W   R+   S+  +  +  YCF S YI +
Sbjct  440  GFYVVFKFFNLTPDATLVDVLKRGQEFCEKPWDVARS---SVPPQPFIEQYCFRSPYITS  496

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDE  458
            LL + L I  +   IG  +      + W LG  +L++   L +
Sbjct  497  LLREGLQIKDNQVIIGSGS------ITWTLGVALLEAGQALSK  533



>dbj|BAJ96922.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 10/103 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             F+   KFF L+P A L +++  G+ FCE+ W   R+   S+  +  +  YCF S YI +
Sbjct  179  GFYVVFKFFNLTPDATLVDVLKRGQEFCEKPWDVARS---SVPPQPFIEQYCFRSPYITS  235

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDE  458
            LL + L I  +   IG  +      + W LG  +L++   L +
Sbjct  236  LLREGLQIKDNQVIIGSGS------ITWTLGVALLEAGQALSK  272



>gb|AEN82492.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82493.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82494.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82495.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82496.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82497.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82498.1| AT4G19180-like protein, partial [Capsella rubella]
 gb|AEN82499.1| AT4G19180-like protein, partial [Capsella rubella]
Length=208

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 51/98 (52%), Gaps = 10/98 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  119  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  175

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LL + L I      IG  +      + W LG  +L++ 
Sbjct  176  LLREGLYITDKQIVIGSGS------ITWTLGVALLEAG  207



>gb|ADG38761.1| AT4G19180-like protein, partial [Capsella grandiflora]
Length=207

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 51/97 (53%), Gaps = 10/97 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  120  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  176

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQS  476
            LL + L I      IG  +      + W LG  +L++
Sbjct  177  LLREGLYITDKQIVIGSGS------ITWTLGVALLEA  207



>gb|KHG13526.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Gossypium arboreum]
Length=798

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 52/98 (53%), Gaps = 10/98 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LSP+A L +++  G+ FCE+ W   +    S+A +  +  YCF + YIV+
Sbjct  452  GFFVVYRFFNLSPEAALDDVLEKGREFCEKPWEVAK---KSVAPQPFIEQYCFRAPYIVS  508

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LL + L I+     +G  +      + W +G  +L++ 
Sbjct  509  LLREGLHISDSQLVVGSGS------ITWTMGVALLEAG  540



>ref|XP_001783110.1| predicted protein [Physcomitrella patens]
 gb|EDQ52047.1| predicted protein, partial [Physcomitrella patens]
Length=481

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 50/104 (48%), Gaps = 8/104 (8%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF   KFFGL   A L  ++  G++FCE +W + + +       D   YCF + Y+ AL
Sbjct  333  GFFVVYKFFGLKGNAPLGRLLKKGQKFCELNWKEAQAKVSPQPSID--QYCFRAPYVAAL  390

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEES  452
            L   L +  D   IG  + A      W LGA + ++ + +  +S
Sbjct  391  LRQGLHLRDDQVTIGSGDFA------WTLGAALWEAGALIPVQS  428



>ref|XP_001298946.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAX86016.1| hypothetical protein TVAG_167570 [Trichomonas vaginalis G3]
Length=434

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 2/102 (2%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAE-EDMLHYCFSSAYIVA  587
            N +  + FFGL   + + E+  AG  FC + WSK+  E       E    YC+ +AY   
Sbjct  278  NLYFVNNFFGLPESSSMEELKKAGTSFCSKQWSKIEEELKGKESLEYAPTYCYCAAYQYT  337

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL         +  I   +  N + L WA+GA +L   SD+D
Sbjct  338  LLQKGFNFKDGNNEIRKLDDINGVDLSWAIGA-MLAHVSDID  378



>ref|XP_006640616.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 8-like 
[Lepisosteus oculatus]
Length=525

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 59/123 (48%), Gaps = 13/123 (11%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
            ++F+T  F  L+P+A L+++    + FC + W+ L+ EY    E  +  YC +  YI  L
Sbjct  379  SYFYTFSFLKLTPQAPLAQVQRTVEEFCRKKWTLLKAEYPGEKERFLRDYCATGYYITTL  438

Query  583  LHDSLGIALDDE---RIGYANQANNIPLDWALGAFILQSN--------SDLDEESSKWFA  437
            L D  G   D++    I +  QA +  + W LG  +  +N        + + +   +W A
Sbjct  439  LLD--GFKFDNQSWSNIVFQKQAADTDIGWTLGYMLNLTNLIPSERPQAAVGQSPEQWAA  496

Query  436  FMF  428
             +F
Sbjct  497  AVF  499



>ref|XP_006282448.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
 ref|XP_006282449.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
 gb|EOA15346.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
 gb|EOA15347.1| hypothetical protein CARUB_v10004214mg [Capsella rubella]
Length=748

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  483  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  539

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL +  G+ + D++I   + +    + W LG  +L++   L 
Sbjct  540  LLRE--GLYITDKQIVIGSGS----ITWTLGVALLEAGKALS  575



>ref|XP_001752330.1| predicted protein [Physcomitrella patens]
 gb|EDQ83063.1| predicted protein, partial [Physcomitrella patens]
Length=485

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 50/98 (51%), Gaps = 8/98 (8%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF   KFFGL   A L  ++  G+++CE +W +++ +    A+  +  YCF + Y+ AL
Sbjct  337  GFFVVYKFFGLKGNAPLGRLLKKGQKYCELNWKEVQAKVG--AQPSIDQYCFRAPYVAAL  394

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNS  470
            L   L +  D   IG  + A      W LGA + ++ +
Sbjct  395  LRQGLHLRDDQVTIGSGDFA------WTLGAALWEAGA  426



>ref|XP_007254407.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 8-like 
[Astyanax mexicanus]
Length=502

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 50/96 (52%), Gaps = 0/96 (0%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALL  581
            +F+T  F GL+P+  L +++     FC  +W+ L + Y ++ E+ +  YC S+ YI+ +L
Sbjct  356  YFYTFDFLGLAPRTPLPQVLSTIDNFCNTNWTTLLSTYPNVKEKYLRDYCASAQYIMTIL  415

Query  580  HDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
                      ++I +  Q ++  + W LG  +  +N
Sbjct  416  VQGYKFNATWDQIYFVKQVSDTDIGWTLGYMLNLTN  451



>ref|XP_006413999.1| hypothetical protein EUTSA_v10024508mg [Eutrema salsugineum]
 gb|ESQ55452.1| hypothetical protein EUTSA_v10024508mg [Eutrema salsugineum]
Length=740

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  475  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  531

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG  +      + W LG  +L++   L 
Sbjct  532  LLREGLYITDKQIIIGSGS------ITWTLGVALLEAGKALS  567



>gb|ADG38766.1| AT4G19180-like protein, partial [Neslia paniculata]
Length=207

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 51/97 (53%), Gaps = 10/97 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  120  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  176

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQS  476
            LL + L I      IG  +      + W LG  +L++
Sbjct  177  LLREGLYITDKQIIIGSGS------ITWTLGVALLEA  207



>ref|NP_001002379.2| ectonucleoside triphosphate diphosphohydrolase 8 [Danio rerio]
Length=496

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALL  581
            +F+T  F GL+PKA L++++      C ++W+ L  E  S+  + +  YC S  YI  +L
Sbjct  355  YFYTFDFLGLTPKAPLTKVLSTIDTLCSKNWTALTAENPSIKPKYLKDYCASGHYITTIL  414

Query  580  HDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESS  449
                      ++I +  Q  +  + W LG  +  +N    E SS
Sbjct  415  LKGYKFNNTWDQISFVKQVADTDIGWTLGYMLNLTNMIPSERSS  458



>ref|XP_010434438.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010434439.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010434440.1| PREDICTED: probable apyrase 7 [Camelina sativa]
Length=748

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  483  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  539

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL +  G+ + D++I   +      + W LG  +L++   L 
Sbjct  540  LLRE--GLYITDKQIIIGSGG----ITWTLGVALLEAGKALS  575



>ref|XP_009136998.1| PREDICTED: LOW QUALITY PROTEIN: probable apyrase 7 [Brassica 
rapa]
Length=723

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  474  GFFVVYRFFNLSVEASLDDVLERGRDFCEKAWQVTRT---SVSPQPFIEQYCFRAPYIVS  530

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEES  452
            LL + L I      IG  +      + W LG  +L++   L   +
Sbjct  531  LLREGLYITDKQIVIGSGS------ITWTLGVALLEAGKALSSST  569



>ref|XP_002867950.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44209.1| nucleoside phosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=741

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  475  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  531

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG  +      + W LG  +L++   L 
Sbjct  532  LLREGLYITDKQIIIGSGS------ITWTLGVALLEAGKALS  567



>ref|XP_010449381.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010449382.1| PREDICTED: probable apyrase 7 [Camelina sativa]
 ref|XP_010449384.1| PREDICTED: probable apyrase 7 [Camelina sativa]
Length=748

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S++ +  +  YCF + YIV+
Sbjct  483  GFFVVYRFFNLSAEASLDDVLEKGREFCEKAWQVART---SVSPQPFIEQYCFRAPYIVS  539

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG         + W LG  +L++   L 
Sbjct  540  LLREGLYITDKQIIIGSGG------ITWTLGVALLEAGKALS  575



>emb|CAA16707.1| putative protein [Arabidopsis thaliana]
 emb|CAB78920.1| putative protein [Arabidopsis thaliana]
Length=1052

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 10/103 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FC++ W   RT   S++ +  +  YCF + YIV+
Sbjct  835  GFFVVYRFFNLSAEASLDDVLEKGREFCDKAWQVART---SVSPQPFIEQYCFRAPYIVS  891

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDE  458
            LL +  G+ + D++I   + +    + W LG  +L+S   L  
Sbjct  892  LLRE--GLYITDKQIIIGSGS----ITWTLGVALLESGKALSS  928



>ref|XP_003208112.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 1 isoform 
X2 [Meleagris gallopavo]
Length=512

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -3

Query  715  LSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDD-ERIG  539
            L E+  A ++FC   W +++ +YH + E+ +  YCFS AYI++LL +  G  +++ + I 
Sbjct  381  LGEVTSAIEKFCARPWHEVKLQYHQIKEKYLSEYCFSGAYILSLLENGYGFTIENWQTIH  440

Query  538  YANQANNIPLDWALGAFILQSN  473
            +  +  +    W LG  +  +N
Sbjct  441  FLGKIGSSDAGWTLGYMLNLTN  462



>ref|XP_002978228.1| hypothetical protein SELMODRAFT_443766 [Selaginella moellendorffii]
 gb|EFJ20885.1| hypothetical protein SELMODRAFT_443766 [Selaginella moellendorffii]
Length=661

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 54/106 (51%), Gaps = 10/106 (9%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF   KFFGLS KA L +++  G+ FC + W   R         D   YCF + Y+VAL
Sbjct  419  GFFVMYKFFGLSSKASLDDLLSKGQEFCGKPWPVARDSVDPQGFID--RYCFRAPYVVAL  476

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK  446
            L +  G+ L DE++          + W  GA +L++   + E+SS+
Sbjct  477  LRE--GLHLRDEQVTVGPGD----VTWTQGAALLEAG--VLEKSSR  514



>ref|NP_567579.2| GDA1/CD39 nucleoside phosphatase family protein [Arabidopsis 
thaliana]
 sp|F4JSH1.1|APY7_ARATH RecName: Full=Probable apyrase 7; Short=AtAPY7; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; AltName: 
Full=NTPDase; AltName: Full=Nucleoside triphosphate diphosphohydrolase 
7 [Arabidopsis thaliana]
 gb|AEE84155.1| GDA1/CD39 nucleoside phosphatase family protein [Arabidopsis 
thaliana]
 gb|AEJ38088.1| nucleoside triphosphate diphosphohydrolase 7 [Arabidopsis thaliana]
 gb|AFL69929.1| GDA1/CD39 nucleoside phosphatase, partial [Arabidopsis thaliana]
Length=740

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FC++ W   RT   S++ +  +  YCF + YIV+
Sbjct  475  GFFVVYRFFNLSAEASLDDVLEKGREFCDKAWQVART---SVSPQPFIEQYCFRAPYIVS  531

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG  +      + W LG  +L+S   L 
Sbjct  532  LLREGLYITDKQIIIGSGS------ITWTLGVALLESGKALS  567



>ref|XP_010712883.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 1 isoform 
X3 [Meleagris gallopavo]
 ref|XP_010712884.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 1 isoform 
X3 [Meleagris gallopavo]
 ref|XP_010712885.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 1 isoform 
X3 [Meleagris gallopavo]
Length=500

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -3

Query  715  LSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDD-ERIG  539
            L E+  A ++FC   W +++ +YH + E+ +  YCFS AYI++LL +  G  +++ + I 
Sbjct  369  LGEVTSAIEKFCARPWHEVKLQYHQIKEKYLSEYCFSGAYILSLLENGYGFTIENWQTIH  428

Query  538  YANQANNIPLDWALGAFILQSN  473
            +  +  +    W LG  +  +N
Sbjct  429  FLGKIGSSDAGWTLGYMLNLTN  450



>gb|EMS62472.1| Ectonucleoside triphosphate diphosphohydrolase 8 [Triticum urartu]
Length=706

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (50%), Gaps = 10/103 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             F+   KFF L+P A L +++  G+ FCE+ W   R+   S+  +  +  YCF + YI +
Sbjct  440  GFYVVFKFFNLTPDATLVDVLKRGQEFCEKPWDVARS---SVPPQPFIEQYCFRAPYITS  496

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDE  458
            LL + L I  +   IG  +      + W LG  +L++   L  
Sbjct  497  LLREGLQIKDNQVIIGSGS------ITWTLGVALLEAGQALSR  533



>ref|XP_009588053.1| PREDICTED: probable apyrase 7 [Nicotiana tomentosiformis]
 ref|XP_009588054.1| PREDICTED: probable apyrase 7 [Nicotiana tomentosiformis]
 ref|XP_009588055.1| PREDICTED: probable apyrase 7 [Nicotiana tomentosiformis]
Length=766

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVAL  584
            F+   +FF L+P A L +++  G+ FCE+ W   +T   S+A +  +  YCF + Y+V L
Sbjct  492  FYVVYRFFNLTPDAALDDVLEKGQEFCEKTWDVAKT---SVAPQPFIEQYCFRAPYVVFL  548

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQS  476
            L + L I      IG  +      + W LG  +L++
Sbjct  549  LREGLHITDSQVTIGSGS------ITWTLGVALLEA  578



>ref|XP_010712882.1| PREDICTED: ectonucleoside triphosphate diphosphohydrolase 1 isoform 
X1 [Meleagris gallopavo]
Length=527

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -3

Query  715  LSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVALLHDSLGIALDD-ERIG  539
            L E+  A ++FC   W +++ +YH + E+ +  YCFS AYI++LL +  G  +++ + I 
Sbjct  396  LGEVTSAIEKFCARPWHEVKLQYHQIKEKYLSEYCFSGAYILSLLENGYGFTIENWQTIH  455

Query  538  YANQANNIPLDWALGAFILQSN  473
            +  +  +    W LG  +  +N
Sbjct  456  FLGKIGSSDAGWTLGYMLNLTN  477



>ref|XP_006355646.1| PREDICTED: probable apyrase 7-like [Solanum tuberosum]
Length=766

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 10/91 (11%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVAL  584
            FF   +FF L+P A L +++  G+ FC++ W   +T   S+A +  +  YCF + YIV+L
Sbjct  492  FFVVYRFFNLTPDAALDDVLEKGREFCDKTWDVAKT---SVAPQPFIEQYCFRAPYIVSL  548

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGA  491
            L + L I      IG  +      + W LG 
Sbjct  549  LREGLHITDSQVTIGSGS------ITWTLGV  573



>ref|XP_009804492.1| PREDICTED: probable apyrase 7 [Nicotiana sylvestris]
Length=766

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 50/98 (51%), Gaps = 10/98 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             F+   +FF L+P A L +++  G+ FCE+ W   +T   S+A +  +  YCF + Y+V 
Sbjct  491  GFYVVYRFFNLTPDAALDDVLEKGQEFCEKTWDIAKT---SVAPQPFIEQYCFRAPYVVF  547

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSN  473
            LL + L I      IG  +      + W LG  +L++ 
Sbjct  548  LLREGLHITDSQVTIGSGS------ITWTLGVALLEAG  579



>ref|XP_004239949.1| PREDICTED: probable apyrase 7 [Solanum lycopersicum]
Length=766

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 10/91 (11%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVAL  584
            FF   +FF L+P A L +++  G+ FC++ W   +T   S+A +  +  YCF + YIV+L
Sbjct  492  FFVVYRFFNLTPDAALDDVLEKGREFCDKTWDVAKT---SVAPQPFIEQYCFRAPYIVSL  548

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGA  491
            L + L I      IG  +      + W LG 
Sbjct  549  LREGLHITDSQVTIGSGS------ITWTLGV  573



>ref|XP_002966332.1| hypothetical protein SELMODRAFT_407789 [Selaginella moellendorffii]
 gb|EFJ32359.1| hypothetical protein SELMODRAFT_407789 [Selaginella moellendorffii]
Length=550

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 54/106 (51%), Gaps = 10/106 (9%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLHYCFSSAYIVAL  584
             FF   KFFGLS KA L +++  G+ FC + W   R         D   YCF + Y+VAL
Sbjct  419  GFFVMYKFFGLSSKASLDDLLSKGQEFCGKPWPVARDSVDPQGFID--RYCFRAPYVVAL  476

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSK  446
            L +  G+ L DE++          + W  GA +L++   + E+SS+
Sbjct  477  LRE--GLHLRDEQVTVGPGD----VTWTQGAALLEAG--VLEKSSR  514



>ref|XP_010535960.1| PREDICTED: probable apyrase 7 [Tarenaya hassleriana]
Length=755

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 10/102 (10%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             FF   +FF LS +A L +++  G+ FCE+ W   RT   S+  +  +  YCF + YIV+
Sbjct  483  GFFVVYRFFNLSAEAALDDVLEKGRLFCEKPWEVART---SVPPQPFIEQYCFRAPYIVS  539

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD  461
            LL + L I      IG  +      + W LG  +L++   L 
Sbjct  540  LLREGLYITDKQIIIGSGS------ITWTLGVALLEAGKALS  575



>ref|XP_003538924.1| PREDICTED: probable apyrase 7-like [Glycine max]
Length=695

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 55/114 (48%), Gaps = 18/114 (16%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVA  587
             F+   +FF L+ +A L +++  GK FCE+ W   +    S+A +  +  YCF + YI +
Sbjct  419  GFYVVYRFFNLTSEATLDDVLAKGKGFCEKRWDVAK---RSVAPQPFIEQYCFRAPYIAS  475

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFG  425
            LL + L I  +   +G  N      + W LG  +L        E+ K F+  FG
Sbjct  476  LLREGLHINDNQITVGSGN------ITWTLGVALL--------EAGKAFSTRFG  515



>gb|KHN41783.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=1017

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 55/113 (49%), Gaps = 18/113 (16%)
 Frame = -3

Query  760  FFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDML-HYCFSSAYIVAL  584
            F+   +FF L+ +A L +++  GK FCE+ W   +    S+A +  +  YCF + YI +L
Sbjct  742  FYVVYRFFNLTSEATLDDVLAKGKGFCEKRWDVAK---RSVAPQPFIEQYCFRAPYIASL  798

Query  583  LHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLDEESSKWFAFMFG  425
            L + L I  +   +G  N      + W LG  +L        E+ K F+  FG
Sbjct  799  LREGLHINDNQITVGSGN------ITWTLGVALL--------EAGKAFSTRFG  837



>ref|XP_001579703.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAY18717.1| hypothetical protein TVAG_063220 [Trichomonas vaginalis G3]
Length=441

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 54/118 (46%), Gaps = 5/118 (4%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEYHSLAEEDMLH-YCFSSAYIVA  587
            N +  + FFGL   + L+++   G  +C  DW  +  E       +  H YC+ +AY   
Sbjct  295  NLYFANAFFGLPTTSSLADLKTKGTEYCARDWKDISKELQGKESLEYAHTYCYCAAYQYV  354

Query  586  LLHDSLGIALDDERIGYANQANNIPLDWALGAFILQSNSDLD---EESSKWFAFMFGD  422
            LL         +  I   +  N I L WA+GA +L   SD++   EE+  + A +F +
Sbjct  355  LLTKGFNFNDQNAEIQKLDDINGIDLSWAIGA-MLAHISDVEIVKEENIPFTALIFAN  411



>ref|XP_002950854.1| hypothetical protein VOLCADRAFT_91259 [Volvox carteri f. nagariensis]
 gb|EFJ48169.1| hypothetical protein VOLCADRAFT_91259 [Volvox carteri f. nagariensis]
Length=558

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 13/109 (12%)
 Frame = -3

Query  763  NFFHTSKFFGLSPKAFLSEMMVAGKRFCEEDWSKLRTEY---HSLAEEDMLHYCFSSAYI  593
            +F+ T    GL   A L  +  AG RFC   WS +  E      ++EE +L  CF SAYI
Sbjct  452  SFYFTMDRLGLPANASLESLRTAGTRFCSRPWSDVEQELVVGRGVSEEHILKVCFGSAYI  511

Query  592  VALLHDSLGIALDDERIGYANQAN--------NIPLDWALGAFILQSNS  470
              LL    G  +      Y   +N         + ++W LGA + Q ++
Sbjct  512  YTLLRQ--GFHMGPREAAYLRFSNAVERPDGSRVEVNWVLGALMHQRST  558



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310