BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051O18

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99096.1|  unnamed protein product                                192   2e-57   Coffea canephora [robusta coffee]
ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a               188   7e-56   Sesamum indicum [beniseed]
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...    185   1e-54   Catharanthus roseus [chatas]
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein             185   1e-54   Solanum tuberosum [potatoes]
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a               183   8e-54   Solanum lycopersicum
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like          182   2e-53   Eucalyptus grandis [rose gum]
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1             181   4e-53   Vitis vinifera
gb|AFK33413.1|  unknown                                                 181   7e-53   Lotus japonicus
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a-like          180   8e-53   Cucumis sativus [cucumbers]
ref|XP_004168031.1|  PREDICTED: 40S ribosomal protein S3a-like          179   8e-53   
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a               180   9e-53   Cucumis melo [Oriental melon]
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like          180   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010090259.1|  40S ribosomal protein S3a                          179   2e-52   Morus notabilis
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a               179   2e-52   Eucalyptus grandis [rose gum]
ref|XP_007030615.1|  Ribosomal protein S3Ae                             179   3e-52   
ref|XP_004145387.1|  PREDICTED: 40S ribosomal protein S3a-like          179   3e-52   
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like          179   3e-52   Cicer arietinum [garbanzo]
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g             179   4e-52   Phaseolus vulgaris [French bean]
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like          179   4e-52   Cucumis melo [Oriental melon]
ref|NP_001239858.1|  uncharacterized protein LOC100808747               179   4e-52   Glycine max [soybeans]
gb|KHN30486.1|  40S ribosomal protein S3a                               178   4e-52   Glycine soja [wild soybean]
gb|ACU18272.1|  unknown                                                 178   5e-52   Glycine max [soybeans]
ref|NP_001241005.1|  uncharacterized protein LOC100805519               178   6e-52   Glycine max [soybeans]
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein             177   1e-51   Medicago truncatula
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like          177   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a               177   2e-51   Elaeis guineensis
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                  177   2e-51   Elaeis guineensis
gb|EPS57495.1|  hypothetical protein M569_17323                         171   3e-51   Genlisea aurea
ref|XP_002314671.2|  ribosomal protein S3a                              176   3e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like        176   3e-51   Tarenaya hassleriana [spider flower]
gb|KDP23643.1|  hypothetical protein JCGZ_23476                         176   3e-51   Jatropha curcas
ref|XP_006382773.1|  40S ribosomal protein S3A                          176   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1             176   4e-51   Nelumbo nucifera [Indian lotus]
gb|ABK93399.1|  unknown                                                 176   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006382772.1|  hypothetical protein POPTR_0005s05280g             176   6e-51   
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a               176   6e-51   Populus euphratica
ref|XP_003638197.1|  40S ribosomal protein S3a                          172   7e-51   
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a               175   8e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS71864.1|  hypothetical protein M569_02887                         175   9e-51   Genlisea aurea
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    175   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like          175   1e-50   Elaeis guineensis
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like        174   1e-50   Populus euphratica
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g             174   2e-50   Phaseolus vulgaris [French bean]
ref|XP_006848758.1|  hypothetical protein AMTR_s00026p00042160          174   2e-50   Amborella trichopoda
gb|KDO43437.1|  hypothetical protein CISIN_1g040060mg                   174   2e-50   Citrus sinensis [apfelsine]
ref|NP_001241430.1|  uncharacterized protein LOC100813273               174   2e-50   Glycine max [soybeans]
gb|AGU71407.1|  40S ribosomal protein                                   169   2e-50   Lumnitzera racemosa
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2             174   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like        174   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like        174   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like        174   3e-50   Camelina sativa [gold-of-pleasure]
gb|ABK56834.1|  RPS3                                                    174   3e-50   Cymbidium hybrid cultivar
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like          174   4e-50   Sesamum indicum [beniseed]
ref|XP_002512232.1|  40S ribosomal protein S3a, putative                173   4e-50   Ricinus communis
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a               173   5e-50   Phoenix dactylifera
gb|KDO37446.1|  hypothetical protein CISIN_1g045491mg                   172   5e-50   Citrus sinensis [apfelsine]
ref|XP_007034836.1|  Ribosomal protein S3Ae isoform 2                   172   6e-50   
gb|KHN02741.1|  40S ribosomal protein S3a                               173   7e-50   Glycine soja [wild soybean]
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                   173   7e-50   Theobroma cacao [chocolate]
ref|NP_001265990.1|  40S ribosomal protein S3a                          173   7e-50   Cicer arietinum [garbanzo]
ref|NP_001276152.1|  40S ribosomal protein S3a-like                     172   8e-50   
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg             172   8e-50   Citrus clementina [clementine]
gb|KJB72261.1|  hypothetical protein B456_011G167500                    172   8e-50   Gossypium raimondii
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    172   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2             172   1e-49   Populus euphratica
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a               172   1e-49   Solanum lycopersicum
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g             172   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_003638196.1|  40S ribosomal protein S3a                          172   1e-49   
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    172   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like        172   1e-49   Tarenaya hassleriana [spider flower]
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg                172   1e-49   Erythranthe guttata [common monkey flower]
gb|ACJ85751.1|  unknown                                                 172   1e-49   Medicago truncatula
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like        172   2e-49   Tarenaya hassleriana [spider flower]
gb|KHG05975.1|  40S ribosomal S3a                                       172   2e-49   Gossypium arboreum [tree cotton]
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    171   2e-49   Phoenix dactylifera
gb|KJB38202.1|  hypothetical protein B456_006G241700                    171   2e-49   Gossypium raimondii
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg             171   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    171   3e-49   Nicotiana tomentosiformis
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a               171   3e-49   Nicotiana sylvestris
dbj|BAH57033.1|  AT4G34670                                              167   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KHG08611.1|  40S ribosomal S3a                                       167   8e-49   Gossypium arboreum [tree cotton]
gb|KJB34507.1|  hypothetical protein B456_006G069600                    170   9e-49   Gossypium raimondii
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...    170   1e-48   Daucus carota [carrots]
gb|AAP80662.1|AF479043_1  40S ribosomal protein                         165   1e-48   Triticum aestivum [Canadian hard winter wheat]
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                177   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1             169   1e-48   Camelina sativa [gold-of-pleasure]
gb|KHG19560.1|  40S ribosomal S3a                                       169   1e-48   Gossypium arboreum [tree cotton]
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    169   1e-48   Nicotiana tomentosiformis
ref|XP_002517085.1|  40S ribosomal protein S3a, putative                169   2e-48   Ricinus communis
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like          169   2e-48   Nicotiana sylvestris
ref|XP_006838990.1|  hypothetical protein AMTR_s00002p00271660          169   2e-48   
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg             169   2e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like        169   2e-48   Camelina sativa [gold-of-pleasure]
ref|NP_001066631.1|  Os12g0406200                                       169   3e-48   
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g             169   3e-48   Phaseolus vulgaris [French bean]
ref|XP_002882377.1|  40S ribosomal protein S3A                          168   3e-48   
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg             168   4e-48   Citrus clementina [clementine]
ref|NP_187135.1|  40S ribosomal protein S3a-1                           167   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195193.1|  40S ribosomal protein S3a-2                           167   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2             167   8e-48   Tarenaya hassleriana [spider flower]
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like        167   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002312545.2|  ribosomal protein S3a                              167   1e-47   
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    167   1e-47   Nicotiana tomentosiformis
ref|XP_009406018.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    166   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a         167   1e-47   Helianthus annuus
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg             167   1e-47   Capsella rubella
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    166   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98656.1|  unnamed protein product                                166   2e-47   Coffea canephora [robusta coffee]
ref|NP_001049289.1|  Os03g0200500                                       166   2e-47   
gb|EMT30223.1|  40S ribosomal protein S3a                               166   3e-47   
ref|XP_002869131.1|  40S ribosomal protein S3A                          166   3e-47   Arabidopsis lyrata subsp. lyrata
emb|CDX75453.1|  BnaA01g02490D                                          166   3e-47   
emb|CDY21109.1|  BnaA01g33400D                                          166   4e-47   Brassica napus [oilseed rape]
emb|CDX76296.1|  BnaA08g11040D                                          166   4e-47   
ref|XP_010092425.1|  40S ribosomal protein S3a                          166   6e-47   
emb|CDY30019.1|  BnaC01g39890D                                          166   6e-47   Brassica napus [oilseed rape]
gb|AAX55706.1|  cyc07                                                   164   7e-47   Vitis vinifera
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like          165   8e-47   Brachypodium distachyon [annual false brome]
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg             165   8e-47   Capsella rubella
emb|CDX69078.1|  BnaC01g03750D                                          165   8e-47   
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like          165   9e-47   Glycine max [soybeans]
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        165   1e-46   Vitis vinifera
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like        164   1e-46   Brassica rapa
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a               164   1e-46   Solanum lycopersicum
ref|NP_001275123.1|  cyc07-like protein                                 164   1e-46   Solanum tuberosum [potatoes]
ref|NP_001274913.1|  40S ribosomal protein S3a-like                     164   1e-46   Solanum tuberosum [potatoes]
ref|XP_001765967.1|  predicted protein                                  164   1e-46   
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like        164   1e-46   Brassica rapa
gb|ABB55362.1|  cyc07-like                                              164   1e-46   Solanum tuberosum [potatoes]
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like        164   1e-46   Tarenaya hassleriana [spider flower]
gb|KDP40219.1|  hypothetical protein JCGZ_02217                         164   1e-46   Jatropha curcas
gb|KHG11221.1|  40S ribosomal S3a                                       164   1e-46   Gossypium arboreum [tree cotton]
gb|ABB72808.1|  cyc07-like protein                                      164   2e-46   Solanum tuberosum [potatoes]
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like          164   2e-46   Oryza brachyantha
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like          164   2e-46   Oryza brachyantha
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like          164   2e-46   Oryza brachyantha
gb|EEC69140.1|  hypothetical protein OsI_38068                          171   3e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_001761018.1|  predicted protein                                  163   3e-46   
emb|CDY50760.1|  BnaAnng10670D                                          163   3e-46   Brassica napus [oilseed rape]
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like          163   4e-46   Setaria italica
gb|EEE53089.1|  hypothetical protein OsJ_35850                          171   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2             163   4e-46   Brassica rapa
gb|ACL53942.1|  unknown                                                 159   6e-46   Zea mays [maize]
gb|KEH32959.1|  40S ribosomal protein S3a-1                             162   7e-46   Medicago truncatula
dbj|BAA00860.1|  cyc07                                                  162   9e-46   Catharanthus roseus [chatas]
gb|AFW89329.1|  hypothetical protein ZEAMMB73_166147                    161   1e-45   
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2             162   1e-45   Prunus mume [ume]
ref|XP_001767326.1|  predicted protein                                  162   2e-45   
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like          161   2e-45   Oryza brachyantha
emb|CDY40680.1|  BnaC03g33960D                                          161   2e-45   Brassica napus [oilseed rape]
emb|CDX74165.1|  BnaA03g28820D                                          161   3e-45   
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2             161   3e-45   Brassica rapa
ref|NP_001046578.1|  Os02g0287000                                       160   4e-45   
ref|NP_001152574.1|  40S ribosomal protein S3a                          160   4e-45   Zea mays [maize]
gb|ABK22319.1|  unknown                                                 160   4e-45   Picea sitchensis
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...    160   4e-45   Setaria italica
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        160   4e-45   Brassica rapa
gb|ACN40078.1|  unknown                                                 160   5e-45   Picea sitchensis
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a               160   6e-45   Brachypodium distachyon [annual false brome]
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a               160   6e-45   Fragaria vesca subsp. vesca
ref|XP_001774288.1|  predicted protein                                  160   6e-45   
gb|ACG33267.1|  40S ribosomal protein S3a                               160   6e-45   Zea mays [maize]
gb|ACG34058.1|  40S ribosomal protein S3a                               160   6e-45   Zea mays [maize]
ref|NP_001149096.1|  40S ribosomal protein S3a                          160   7e-45   Zea mays [maize]
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like          160   7e-45   Brachypodium distachyon [annual false brome]
gb|EEE56753.1|  hypothetical protein OsJ_06287                          163   8e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006481160.1|  PREDICTED: 40S ribosomal protein S3a-like          154   1e-44   Citrus sinensis [apfelsine]
ref|NP_001141038.1|  hypothetical protein                               159   1e-44   Zea mays [maize]
gb|KHG19561.1|  40S ribosomal S3a                                       158   2e-44   Gossypium arboreum [tree cotton]
gb|KJB38201.1|  hypothetical protein B456_006G241700                    158   2e-44   Gossypium raimondii
gb|AGT16352.1|  40S ribosomal protein S3a                               158   3e-44   Saccharum hybrid cultivar R570
gb|AFW89330.1|  40S ribosomal protein S3a                               160   3e-44   
gb|AFW89335.1|  40S ribosomal protein S3a                               160   4e-44   
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906             158   4e-44   Selaginella moellendorffii
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                    158   5e-44   Arabis alpina [alpine rockcress]
ref|NP_001288829.1|  40S ribosomal protein S3a                          157   5e-44   Brassica rapa
dbj|BAJ93929.1|  predicted protein                                      157   6e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370          157   6e-44   Sorghum bicolor [broomcorn]
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2             157   8e-44   Fragaria vesca subsp. vesca
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365          157   8e-44   Sorghum bicolor [broomcorn]
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg             157   8e-44   Prunus persica
dbj|BAA05057.1|  cyc07                                                  156   1e-43   Catharanthus roseus [chatas]
ref|XP_001777314.1|  predicted protein                                  157   2e-43   
gb|ABE66401.1|  S phase protein                                         152   1e-42   Striga asiatica [witchweed]
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                    154   1e-42   Arabis alpina [alpine rockcress]
gb|EMS66737.1|  40S ribosomal protein S3a                               155   2e-42   Triticum urartu
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570          153   2e-42   
ref|XP_001774632.1|  predicted protein                                  153   2e-42   
gb|EYU30365.1|  hypothetical protein MIMGU_mgv1a021183mg                151   4e-42   Erythranthe guttata [common monkey flower]
ref|XP_010229342.1|  PREDICTED: 40S ribosomal protein S3a-like          147   6e-42   
gb|KJB28385.1|  hypothetical protein B456_005G045000                    151   9e-42   Gossypium raimondii
ref|XP_001755439.1|  predicted protein                                  151   1e-41   
dbj|BAD94105.1|  40S ribosomal protein S3A like protein                 145   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAC98779.1|  S-phase-specific ribosomal protein                      150   6e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EYU26004.1|  hypothetical protein MIMGU_mgv1a019927mg                148   6e-41   Erythranthe guttata [common monkey flower]
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a               147   7e-40   Prunus mume [ume]
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             150   3e-39   
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...    145   4e-39   
gb|ABR26074.1|  40S ribosomal protein S3a                               139   9e-39   Oryza sativa Indica Group [Indian rice]
gb|KJB28383.1|  hypothetical protein B456_005G045000                    143   1e-38   Gossypium raimondii
gb|KJB28384.1|  hypothetical protein B456_005G045000                    142   2e-38   Gossypium raimondii
gb|KJB28386.1|  hypothetical protein B456_005G045000                    143   2e-38   Gossypium raimondii
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...    143   3e-38   Volvox carteri f. nagariensis
ref|XP_008350557.1|  PREDICTED: 40S ribosomal protein S3a-like          139   4e-38   
ref|XP_005650618.1|  ribosomal protein S3Ae                             139   6e-37   Coccomyxa subellipsoidea C-169
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                     138   9e-37   Eucalyptus grandis [rose gum]
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like        139   9e-37   Malus domestica [apple tree]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like        139   1e-36   Malus domestica [apple tree]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like        137   5e-36   Pyrus x bretschneideri [bai li]
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...    137   5e-36   Chlamydomonas reinhardtii
gb|KCW84167.1|  hypothetical protein EUGRSUZ_B01030                     136   5e-36   Eucalyptus grandis [rose gum]
emb|CBI34197.3|  unnamed protein product                                135   1e-35   Vitis vinifera
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2      135   2e-35   Vitis vinifera
gb|KJB28382.1|  hypothetical protein B456_005G045000                    133   8e-35   Gossypium raimondii
ref|XP_007268611.1|  40S ribosomal protein S1                           132   2e-34   Fomitiporia mediterranea MF3/22
ref|XP_011395666.1|  40S ribosomal protein S3a                          132   2e-34   Auxenochlorella protothecoides
ref|XP_003038024.1|  40S ribosomal protein S1                           132   2e-34   Schizophyllum commune H4-8
ref|XP_002397772.1|  hypothetical protein MPER_01744                    129   3e-34   
gb|KIY51600.1|  ribosomal protein S3Ae                                  132   3e-34   Fistulina hepatica ATCC 64428
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                   132   4e-34   Gelatoporia subvermispora B
ref|XP_007862325.1|  40S ribosomal protein S1                           132   4e-34   Gloeophyllum trabeum ATCC 11539
gb|AFU61903.1|  putative 40S ribosomal protein S3A                      129   7e-34   Polyporales sp. KUC9061
gb|AAD30429.1|  40S ribosomal protein S3A                               125   1e-33   Avena fatua
gb|KIK65348.1|  hypothetical protein GYMLUDRAFT_38796                   130   1e-33   Gymnopus luxurians FD-317 M1
ref|XP_002505259.1|  predicted protein                                  130   1e-33   Micromonas commoda
sp|Q764D2.1|RS3A_LENED  RecName: Full=40S ribosomal protein S1; A...    130   1e-33   Lentinula edodes
ref|XP_007302916.1|  S-phase-specific ribosomal protein cyc07           130   2e-33   Stereum hirsutum FP-91666 SS1
ref|XP_007843081.1|  40s ribosomal protein s3ae                         130   2e-33   
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07           129   3e-33   Punctularia strigosozonata HHB-11173 SS5
gb|KJA29982.1|  hypothetical protein HYPSUDRAFT_81601                   129   3e-33   Hypholoma sublateritium FD-334 SS-4
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295             129   4e-33   Serpula lacrymans var. lacrymans S7.9
emb|CCM04869.1|  predicted protein                                      129   4e-33   Fibroporia radiculosa
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                   129   4e-33   Hebeloma cylindrosporum h7
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1          129   4e-33   Laccaria bicolor S238N-H82
gb|KIK06774.1|  hypothetical protein K443DRAFT_674057                   129   4e-33   Laccaria amethystina LaAM-08-1
ref|XP_002475466.1|  40S ribosomal protein S3A                          129   6e-33   
gb|KIJ20179.1|  hypothetical protein PAXINDRAFT_166304                  129   6e-33   Paxillus involutus ATCC 200175
ref|XP_001877091.1|  40S ribosomal protein S1                           129   6e-33   Laccaria bicolor S238N-H82
emb|CEG00819.1|  Ribosomal protein S3Ae                                 129   6e-33   Ostreococcus tauri
gb|KHN21710.1|  40S ribosomal protein S3a                               130   6e-33   Glycine soja [wild soybean]
gb|KDR83823.1|  hypothetical protein GALMADRAFT_676836                  129   6e-33   Galerina marginata CBS 339.88
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                   129   7e-33   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007767741.1|  ribosomal protein S3Ae                             129   7e-33   Coniophora puteana RWD-64-598 SS2
emb|CDO74072.1|  hypothetical protein BN946_scf185043.g122              129   7e-33   Trametes cinnabarina
gb|ACU17112.1|  unknown                                                 127   8e-33   Glycine max [soybeans]
gb|KIP10648.1|  hypothetical protein PHLGIDRAFT_84595                   128   8e-33   Phlebiopsis gigantea 11061_1 CR5-6
gb|KDQ64848.1|  hypothetical protein JAAARDRAFT_28494                   128   9e-33   Jaapia argillacea MUCL 33604
gb|EPS95373.1|  hypothetical protein FOMPIDRAFT_157719                  128   1e-32   Fomitopsis pinicola FP-58527 SS1
gb|AFU72288.1|  40S ribosomal protein S1                                127   1e-32   Amanita strobiliformis
gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                   127   1e-32   Citrus sinensis [apfelsine]
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801                 128   1e-32   Scleroderma citrinum Foug A
ref|XP_006460029.1|  hypothetical protein AGABI2DRAFT_191800            128   1e-32   Agaricus bisporus var. bisporus H97
ref|XP_008035602.1|  40S ribosomal protein S1                           127   1e-32   Trametes versicolor FP-101664 SS1
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...    128   1e-32   Ostreococcus lucimarinus CCE9901
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                  127   2e-32   Pisolithus microcarpus 441
ref|XP_007329524.1|  hypothetical protein AGABI1DRAFT_106559            127   2e-32   Agaricus bisporus var. burnettii JB137-S8
gb|KIM90711.1|  hypothetical protein PILCRDRAFT_811171                  127   2e-32   Piloderma croceum F 1598
gb|KII94785.1|  hypothetical protein PLICRDRAFT_33595                   127   2e-32   Plicaturopsis crispa FD-325 SS-3
gb|KIJ70171.1|  hypothetical protein HYDPIDRAFT_104846                  127   2e-32   Hydnomerulius pinastri MD-312
ref|XP_001837102.1|  40S ribosomal protein S1                           127   2e-32   Coprinopsis cinerea okayama7#130
ref|XP_007392195.1|  hypothetical protein PHACADRAFT_250267             127   2e-32   Phanerochaete carnosa HHB-10118-sp
gb|KIY73683.1|  putative S-phase-specific ribosomal protein cyc07       127   2e-32   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_003060358.1|  predicted protein                                  127   3e-32   Micromonas pusilla CCMP1545
ref|XP_009544052.1|  hypothetical protein HETIRDRAFT_458158             126   4e-32   Heterobasidion irregulare TC 32-1
ref|XP_006958032.1|  40S ribosomal protein S1                           126   5e-32   Wallemia mellicola CBS 633.66
gb|KIO12878.1|  hypothetical protein M404DRAFT_699665                   126   5e-32   Pisolithus tinctorius Marx 270
gb|KFH70745.1|  40S ribosomal protein S1                                125   9e-32   Mortierella verticillata NRRL 6337
gb|EUC65367.1|  40s ribosomal protein s3ae                              125   9e-32   Rhizoctonia solani AG-3 Rhs1AP
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a         125   1e-31   Syntrichia ruralis
emb|CBX25071.1|  40S ribosomal protein S3a                              125   1e-31   Polytomella sp. Pringsheim 198.80
gb|KDQ29255.1|  hypothetical protein PLEOSDRAFT_1089059                 125   1e-31   Pleurotus ostreatus PC15
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                   125   1e-31   Botryobasidium botryosum FD-172 SS1
ref|XP_001765908.1|  predicted protein                                  124   2e-31   
emb|CCA67212.1|  probable ribosomal protein 10, cytosolic               125   2e-31   Serendipita indica DSM 11827
gb|ERZ98268.1|  hypothetical protein GLOINDRAFT_339726                  125   2e-31   
gb|EXX58553.1|  ribosomal 40S subunit protein S1A                       125   2e-31   Rhizophagus irregularis DAOM 197198w
gb|KDN43521.1|  40S ribosomal protein S1                                124   3e-31   Rhizoctonia solani AG-8 WAC10335
gb|KIM33406.1|  hypothetical protein M408DRAFT_153936                   124   3e-31   Serendipita vermifera MAFF 305830
emb|CCO27311.1|  40S ribosomal protein S1 AltName: Full=Protein c...    124   4e-31   Rhizoctonia solani AG-1 IB
ref|XP_009269707.1|  40S ribosomal protein S1                           123   8e-31   
gb|KIO31356.1|  hypothetical protein M407DRAFT_241862                   123   9e-31   
gb|KIL70132.1|  hypothetical protein M378DRAFT_605469                   122   1e-30   
ref|XP_007508881.1|  predicted protein                                  123   1e-30   
emb|CDY17474.1|  BnaC03g65890D                                          121   3e-30   
ref|XP_007364341.1|  40S ribosomal protein S1                           121   5e-30   
gb|KIJ56726.1|  hypothetical protein M422DRAFT_72882                    120   9e-30   
ref|XP_007338149.1|  40S ribosomal protein S1                           120   1e-29   
ref|XP_005834480.1|  small subunit ribosomal protein S3Ae, cytopl...    120   1e-29   
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843              119   2e-29   
gb|AAZ99673.1|  40s ribosomal protein S3                                114   2e-29   
emb|CDJ64179.1|  40S ribosomal protein S3A, putative                    119   3e-29   
gb|AET50824.1|  hypothetical protein                                    119   3e-29   
ref|XP_006693334.1|  hypothetical protein CTHT_0028780                  118   4e-29   
dbj|BAF75056.1|  40S ribosome protein                                   117   5e-29   
gb|KDE09348.1|  40S ribosomal protein S1                                117   9e-29   
emb|CDP25519.1|  Putative cytosolic 40S ribosomal protein Rps3a         117   2e-28   
emb|CDR40922.1|  RHTO0S05e08922g1_1                                     117   2e-28   
ref|XP_007874563.1|  hypothetical protein PNEG_02550                    116   2e-28   
ref|XP_005707378.1|  40S ribosomal protein S3A isoform 2                117   2e-28   
gb|KDD76342.1|  ribosomal protein S3Ae                                  116   2e-28   
ref|XP_005710608.1|  40S ribosomal protein S3A                          116   3e-28   
gb|EIT72263.1|  40S ribosomal protein S3A                               116   3e-28   
ref|XP_004349214.1|  ribosomal protein S3a                              116   4e-28   
emb|CDJ49823.1|  40S ribosomal protein S3A, putative                    116   4e-28   
emb|CDI75730.1|  40S ribosomal protein S3A, putative                    115   5e-28   
gb|ACU45023.1|  ribosomal protein S3a                                   115   5e-28   
emb|CDJ27165.1|  40S ribosomal protein S3A, putative                    115   5e-28   
emb|CDI76315.1|  40S ribosomal protein S3A, putative                    115   5e-28   
ref|XP_001817129.1|  40S ribosomal protein S1                           115   5e-28   
gb|EPX74608.1|  40S ribosomal protein S3a                               115   5e-28   
gb|AFG58456.1|  hypothetical protein CL163Contig2_05                    110   6e-28   
ref|XP_001276080.1|  40S ribosomal protein S1                           115   6e-28   
ref|XP_002901276.1|  40S ribosomal protein S3a                          115   6e-28   
gb|EMS23756.1|  40S ribosomal protein s1                                116   6e-28   
gb|EHK49744.1|  hypothetical protein TRIATDRAFT_297633                  115   6e-28   
ref|XP_007927383.1|  hypothetical protein MYCFIDRAFT_87079              115   6e-28   
ref|XP_009520284.1|  hypothetical protein PHYSODRAFT_285013             115   6e-28   
ref|XP_008900376.1|  40S ribosomal protein S3a                          115   6e-28   
ref|XP_007291650.1|  40S ribosomal protein S3                           115   7e-28   
emb|CDJ59956.1|  40S ribosomal protein S3A, putative                    115   7e-28   
gb|AAS55933.1|  40S ribosomal protein S3a                               111   9e-28   
gb|KIV90937.1|  40S ribosomal protein S1                                115   1e-27   
gb|AAN71759.1|  40S ribosomal protein-like protein                      112   1e-27   
sp|A2R9S1.1|RS3A_ASPNC  RecName: Full=40S ribosomal protein S1          115   1e-27   
gb|EJT97646.1|  40S ribosomal protein S1                                115   1e-27   
gb|AEW08513.1|  hypothetical protein CL163Contig2_05                    109   1e-27   
emb|CCE34351.1|  probable ribosomal protein 10, cytosolic               115   1e-27   
emb|CBJ29379.1|  conserved unknown protein                              115   1e-27   
ref|XP_002188524.1|  PREDICTED: 40S ribosomal protein S3a-like          111   1e-27   
gb|EAW77578.1|  hCG33299, isoform CRA_b                                 112   1e-27   
ref|XP_002368140.1|  40S ribosomal protein S3a, putative                114   1e-27   
gb|KHJ33456.1|  putative 40s ribosomal protein s1                       114   1e-27   
ref|XP_001218106.1|  40S ribosomal protein S1                           114   1e-27   
ref|XP_007819839.1|  Ribosomal protein S3Ae                             114   1e-27   
gb|EQL02037.1|  Ribosomal protein S3Ae                                  114   2e-27   
gb|KID69803.1|  Ribosomal protein S3Ae                                  114   2e-27   
ref|XP_003883511.1|  hypothetical protein NCLIV_032660                  114   2e-27   
ref|XP_754085.1|  40S ribosomal protein S3Ae                            114   2e-27   
ref|XP_505043.2|  40S ribosomal protein S1                              114   2e-27   
ref|XP_006967667.1|  hypothetical protein TRIREDRAFT_80484              114   2e-27   
ref|XP_007781885.1|  40S ribosomal protein S1                           114   2e-27   
gb|EAX04992.1|  ribosomal protein S3A, isoform CRA_e                    111   2e-27   
emb|CCU77508.1|  putative 40S ribosomal protein S3a-1                   114   2e-27   
gb|ELR10454.1|  40S ribosomal protein S1                                114   3e-27   
gb|KFY76180.1|  hypothetical protein V498_09734                         114   3e-27   
gb|EME43162.1|  hypothetical protein DOTSEDRAFT_72517                   114   3e-27   
ref|XP_006741534.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-27   
ref|XP_007812794.1|  40S ribosomal protein S3                           114   3e-27   
ref|NP_593116.1|  40S ribosomal protein S1                              113   3e-27   
emb|CCA17701.1|  40S ribosomal protein S3a putative                     113   4e-27   
emb|CCX31922.1|  Similar to 40S ribosomal protein S1; acc. no. C7...    113   4e-27   
gb|KEZ40245.1|  hypothetical protein SAPIO_CDS8739                      113   4e-27   
emb|CCI44314.1|  unnamed protein product                                113   4e-27   
ref|XP_005538843.1|  40S ribosomal protein S3A                          113   4e-27   
ref|XP_008619762.1|  40S ribosomal protein S3a-2                        113   4e-27   
ref|XP_008353071.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    111   4e-27   
gb|ELW71334.1|  Coiled-coil domain-containing protein 25                113   5e-27   
ref|XP_008600583.1|  ribosomal S3Ae family protein                      113   5e-27   
ref|XP_008047613.1|  PREDICTED: 40S ribosomal protein S3a               113   5e-27   
gb|ELW69964.1|  40S ribosomal protein S3a                               113   5e-27   
gb|EHK15137.1|  hypothetical protein TRIVIDRAFT_83608                   113   5e-27   
ref|XP_009260836.1|  hypothetical protein FPSE_09444                    113   5e-27   
gb|EMT64937.1|  40S ribosomal protein S1                                112   5e-27   
gb|EGU87266.1|  hypothetical protein FOXB_02248                         113   5e-27   
gb|KDO28449.1|  40S ribosomal protein S3a-2                             113   5e-27   
gb|EAW76709.1|  hCG40355, isoform CRA_b                                 110   6e-27   
gb|EAW76708.1|  hCG40355, isoform CRA_a                                 110   6e-27   
gb|EPY50727.1|  40S ribosomal protein S3a                               113   6e-27   
gb|EDM00797.1|  rCG62728, isoform CRA_b                                 112   6e-27   
gb|KFY15252.1|  hypothetical protein V492_02139                         112   6e-27   
ref|XP_005344227.1|  PREDICTED: 40S ribosomal protein S3a isoform X2    112   7e-27   
gb|KFP00832.1|  40S ribosomal protein S3a                               112   7e-27   
ref|XP_001931333.1|  40S ribosomal protein S1                           112   7e-27   
ref|XP_008492080.1|  PREDICTED: 40S ribosomal protein S3a               112   7e-27   
ref|XP_002172001.1|  40S ribosomal protein S3a                          112   8e-27   
ref|NP_592828.1|  40S ribosomal protein S1                              112   8e-27   
gb|AAT81418.1|  ribosomal protein S3a                                   112   9e-27   
ref|XP_002838347.1|  40S ribosomal protein S1                           112   9e-27   
ref|XP_001514859.1|  PREDICTED: 40S ribosomal protein S3a               112   9e-27   
ref|XP_010773841.1|  PREDICTED: 40S ribosomal protein S3a               112   9e-27   
ref|XP_682139.1|  hypothetical protein AN8870.2                         112   9e-27   
ref|XP_008079199.1|  40S ribosomal protein S3                           112   9e-27   
ref|XP_004655919.1|  PREDICTED: 40S ribosomal protein S3a               112   9e-27   
ref|XP_005692628.1|  PREDICTED: 40S ribosomal protein S3a-like          112   1e-26   
ref|XP_005982108.1|  PREDICTED: 40S ribosomal protein S3a-like is...    111   1e-26   
ref|XP_001366653.1|  PREDICTED: 40S ribosomal protein S3a               112   1e-26   
ref|XP_003850287.1|  40S ribosomal protein S1                           112   1e-26   
ref|XP_003790290.1|  PREDICTED: 40S ribosomal protein S3a-like          111   1e-26   
ref|XP_009896517.1|  PREDICTED: 40S ribosomal protein S3a               112   1e-26   
ref|XP_004685258.1|  PREDICTED: 40S ribosomal protein S3a               111   1e-26   
ref|NP_058849.1|  40S ribosomal protein S3a                             112   1e-26   
sp|Q2GW51.2|RS3A_CHAGB  RecName: Full=40S ribosomal protein S1          112   1e-26   
ref|XP_955974.2|  40S ribosomal protein S1                              112   1e-26   
dbj|GAA97694.1|  hypothetical protein E5Q_04372                         112   1e-26   
ref|XP_007696626.1|  hypothetical protein COCSADRAFT_34493              112   1e-26   
gb|ABY28374.1|  ribosomal protein S3a                                   112   1e-26   
gb|KEQ76235.1|  ribosomal protein S3Ae                                  112   1e-26   
ref|XP_003349668.1|  40S ribosomal protein S1                           112   1e-26   
ref|XP_003649140.1|  40S ribosomal protein S1                           112   1e-26   
gb|EAW77577.1|  hCG33299, isoform CRA_a                                 112   1e-26   
ref|XP_001225459.1|  40S ribosomal protein S1                           112   1e-26   
ref|NP_001134789.1|  40S ribosomal protein S3a                          112   1e-26   
ref|XP_008023145.1|  hypothetical protein SETTUDRAFT_176044             112   1e-26   
ref|XP_009994185.1|  PREDICTED: 40S ribosomal protein S3a               111   1e-26   
ref|XP_007707649.1|  hypothetical protein COCCADRAFT_83997              112   1e-26   
gb|EMD91948.1|  hypothetical protein COCHEDRAFT_1173335                 112   1e-26   
ref|XP_002598366.1|  hypothetical protein BRAFLDRAFT_69722              112   1e-26   
ref|XP_007686274.1|  hypothetical protein COCMIDRAFT_90741              112   1e-26   
ref|XP_007800525.1|  40S ribosomal protein S1                           112   1e-26   
ref|XP_003844525.1|  hypothetical protein LEMA_P021760.1                114   1e-26   
gb|AAT76631.1|  ribosomal protein S3a                                   111   1e-26   
gb|KEY66556.1|  hypothetical protein S7711_08060                        112   1e-26   
ref|XP_009472997.1|  PREDICTED: 40S ribosomal protein S3a               111   1e-26   
dbj|BAF83764.1|  unnamed protein product                                112   1e-26   
ref|XP_003050314.1|  40S ribosomal protein S1                           112   1e-26   
gb|ACJ12076.1|  ribosomal protein S3a                                   110   1e-26   
ref|XP_009935259.1|  PREDICTED: 40S ribosomal protein S3a               111   1e-26   
gb|EPS27387.1|  hypothetical protein PDE_02330                          112   2e-26   
gb|KIM94998.1|  hypothetical protein OIDMADRAFT_21260                   112   2e-26   
ref|XP_007586018.1|  putative 40s ribosomal protein s1 protein          112   2e-26   
gb|ABI52667.1|  40S ribosomal protein S3a                               111   2e-26   
gb|KEQ61803.1|  ribosomal protein S3Ae                                  111   2e-26   
gb|KFY25487.1|  hypothetical protein V493_04626                         114   2e-26   
emb|CCQ18660.1|  40S ribosomal protein S3A                              112   2e-26   
gb|AAA35682.1|  ribosmal protein small subunit                          112   2e-26   
gb|EDL15382.1|  mCG1128, isoform CRA_a                                  111   2e-26   
dbj|GAM40150.1|  ribosomal protein 10 of the small 40S subunit          111   2e-26   
gb|EMC77645.1|  40S ribosomal protein S3a                               111   2e-26   
gb|KFY72930.1|  hypothetical protein V499_06972                         114   2e-26   
ref|XP_002482424.1|  40S ribosomal protein S1                           111   2e-26   
ref|XP_003473456.1|  PREDICTED: 40S ribosomal protein S3a-like          112   2e-26   
ref|XP_006735747.1|  PREDICTED: 40S ribosomal protein S3a-like is...    111   2e-26   
ref|XP_002148168.1|  40S ribosomal protein S1                           111   2e-26   
ref|XP_001799717.1|  hypothetical protein SNOG_09423                    111   2e-26   
gb|ENH81345.1|  40s ribosomal protein s3ae                              111   2e-26   
ref|XP_007409874.1|  hypothetical protein MELLADRAFT_43398              111   2e-26   
gb|EFB26537.1|  hypothetical protein PANDA_001716                       111   2e-26   
gb|KFY22572.1|  hypothetical protein V491_02767                         113   2e-26   
ref|XP_001728782.1|  hypothetical protein MGL_4117                      111   2e-26   
gb|KFZ06978.1|  hypothetical protein V501_06882                         114   2e-26   
gb|KFY81387.1|  hypothetical protein V500_11478                         114   2e-26   
sp|P61246.1|RS3A_FELCA  RecName: Full=40S ribosomal protein S3a         111   2e-26   
ref|XP_003661611.1|  hypothetical protein MYCTH_2314609                 111   2e-26   
gb|KFW97162.1|  40S ribosomal protein S3a                               111   2e-26   
ref|XP_004323125.1|  PREDICTED: 40S ribosomal protein S3a-like          111   2e-26   
ref|XP_001555389.1|  40S ribosomal protein S1                           111   2e-26   
ref|XP_006884543.1|  PREDICTED: 40S ribosomal protein S3a-like          111   2e-26   
ref|XP_001598109.1|  40S ribosomal protein S1                           111   2e-26   
gb|KFM10230.1|  40S ribosomal protein S3a                               111   2e-26   
ref|XP_007469965.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
ref|XP_006040183.1|  PREDICTED: 40S ribosomal protein S3a-like          111   2e-26   
gb|KFR12636.1|  40S ribosomal protein S3a                               111   2e-26   
ref|XP_003923833.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
ref|XP_010203978.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
ref|XP_009075160.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
ref|XP_006174472.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
dbj|BAE88391.1|  unnamed protein product                                111   2e-26   
ref|XP_001099771.1|  PREDICTED: 40S ribosomal protein S3a-like          111   2e-26   
ref|NP_000997.1|  40S ribosomal protein S3a isoform 1                   111   2e-26   
ref|XP_004055608.1|  PREDICTED: 40S ribosomal protein S3a-like          111   2e-26   
ref|XP_003417586.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
dbj|BAE87927.1|  unnamed protein product                                111   2e-26   
gb|AAH66926.1|  Ribosomal protein S3A                                   111   2e-26   
ref|XP_008933878.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
ref|XP_003797009.1|  PREDICTED: 40S ribosomal protein S3a-like is...    111   2e-26   
ref|XP_003267670.1|  PREDICTED: 40S ribosomal protein S3a-like          111   2e-26   
ref|NP_001270826.1|  40S ribosomal protein S3a                          111   2e-26   
gb|KFO84143.1|  40S ribosomal protein S3a                               111   2e-26   
ref|XP_010311392.1|  PREDICTED: 40S ribosomal protein S3a               111   2e-26   
ref|XP_006779434.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    111   3e-26   
ref|XP_009099772.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
gb|ELK36724.1|  40S ribosomal protein S3a                               108   3e-26   
ref|XP_005415772.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
pdb|4KZX|B  Chain B, Rabbit 40s Ribosomal Subunit In Complex With...    111   3e-26   
gb|AII77164.1|  40S ribosomal protein S3aE                              111   3e-26   
gb|KFP91786.1|  40S ribosomal protein S3a                               111   3e-26   
ref|XP_003945196.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    111   3e-26   
ref|XP_009977023.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
ref|XP_005542823.1|  PREDICTED: 40S ribosomal protein S3a-like          111   3e-26   
ref|XP_005045047.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
gb|KFZ15927.1|  hypothetical protein V502_05353                         113   3e-26   
gb|EYE99542.1|  40S ribosomal protein S3aE                              111   3e-26   
ref|XP_010410434.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
ref|XP_010016125.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
ref|XP_009873775.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
ref|XP_009969079.1|  PREDICTED: 40S ribosomal protein S3a               110   3e-26   
ref|XP_009281624.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
ref|XP_004017251.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
ref|XP_009687533.1|  PREDICTED: 40S ribosomal protein S3a               110   3e-26   
ref|XP_005149010.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    111   3e-26   
ref|NP_001008075.1|  40S ribosomal protein S3a                          111   3e-26   
ref|XP_008633930.1|  PREDICTED: 40S ribosomal protein S3a               111   3e-26   
ref|NP_001185510.1|  40S ribosomal protein S3a                          111   3e-26   
ref|XP_003797010.1|  PREDICTED: 40S ribosomal protein S3a-like is...    111   3e-26   
ref|XP_005771394.1|  hypothetical protein EMIHUDRAFT_118270             107   3e-26   
gb|AAP80855.1|  cyc07                                                   110   3e-26   
gb|EMF12040.1|  40S ribosomal protein S3aE-A                            110   4e-26   
ref|XP_003740510.1|  PREDICTED: 40S ribosomal protein S3a-like          111   4e-26   
gb|ADV03066.1|  ribosomal protein S3a                                   111   4e-26   
ref|XP_004411050.1|  PREDICTED: 40S ribosomal protein S3a-like          111   4e-26   



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPE IGREIEKATSSIYPLQNVFIRK KIL
Sbjct  159  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPELIGREIEKATSSIYPLQNVFIRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP A+EP+AEATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-AEEPVAEATEVVGA  260



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLG+LMEVHGDY+EDVG KLDRP A+EP AE TE VGA
Sbjct  219  KAPKFDLGRLMEVHGDYSEDVGVKLDRP-AEEPAAEPTEVVGA  260



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 97/104 (93%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTE-DVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY E D+GTKLDRP A+E +AE TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYNEDDIGTKLDRP-AEEAVAEPTEVIGA  261



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLG+LMEVHGDY+EDVG K+DRPA D    E TE VGA
Sbjct  219  KAPKFDLGRLMEVHGDYSEDVGVKVDRPAEDVA-TEPTEVVGA  260



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDL LKFIPESIGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAQSCDLKDLALKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLG+LMEVHGDY+EDVG K+DRPA D    E TE VGA
Sbjct  219  KAPKFDLGRLMEVHGDYSEDVGVKVDRPAED-IATEPTEVVGA  260



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+ED+G KLDRP ADE +AEA TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDIGVKLDRP-ADETVAEAPTEVIGA  261



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM N A SCDLK+LV KFIPESIGREIEKATSSIYPLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMREIMTNMATSCDLKELVKKFIPESIGREIEKATSSIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVGTKL+RP ADEP+AE  TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGTKLERP-ADEPVAEGVTEVIGA  261



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVGTK+DRPA +  +  ATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGTKVDRPADETVVEGATEVVGA  261



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004166384.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVERPADETAVEGATEVVGA  261



>ref|XP_004168031.1| PREDICTED: 40S ribosomal protein S3a-like, partial [Cucumis sativus]
Length=208

 Score =   179 bits (453),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKIL
Sbjct  107  SQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKIL  166

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  167  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-AEEAVEGATEVVGA  208



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVERPADEAAVEGATEVVGA  261



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+ED+G K+DRPA D P+   TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDIGVKVDRPAEDAPVEGETEVIGA  261



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQA SCDLKDLV KFIPE IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMINQATSCDLKDLVNKFIPEMIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPI--AEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADE I   E TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADETIVEGEVTEVVGA  262



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATTCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+ED+G KLDRP ADEP+AE  TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDIGVKLDRP-ADEPVAEVPTEVIGA  261



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKELVAKFIPEVIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG KL+RP ADE  AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETTAEGETEVVGA  261



>ref|XP_004145387.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-AEEAVEGATEVVGA  260



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  223
            KAPKFDLGKLMEVHGDY++D+GTK+DRP ADE IA E TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSDDIGTKVDRP-ADETIAEETTEVVGA  261



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVGTK++RPA +  +  ATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGTKVERPAEETVVEGATEVVGA  261



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-AEEAVEGATEIVGA  260



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>gb|KHN30486.1| 40S ribosomal protein S3a, partial [Glycine soja]
Length=242

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  140  SQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  199

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  200  KAPKFDLGKLMEVHGDYSEDVGAKVDRPADETLAEEATEVVGA  242



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +A EATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADETLAEEATEVVGA  261



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +A EATE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADETLAEEATEVVGA  261



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQA SCDLKDLV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMINQATSCDLKDLVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLMEVHGDY+EDVGTK++RP ADE + E T E VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGTKVERP-ADETMVEGTPEIVGA  261



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRPA D  +   TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVDRPADDTQMEGETEIVGA  261



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K+DRPA D P+    E VGA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K+DRPA D P+    E VGA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>gb|EPS57495.1| hypothetical protein M569_17323, partial [Genlisea aurea]
Length=97

 Score =   171 bits (433),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -2

Query  516  IRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKF  337
            IRRKMREIM+NQAQS DLKDLV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKF
Sbjct  1    IRRKMREIMINQAQSSDLKDLVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKF  60

Query  336  DLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            DLGKLMEVHGDY+EDVGTKLDRPA D  + E TE +GA
Sbjct  61   DLGKLMEVHGDYSEDVGTKLDRPAEDAAV-EPTEVIGA  97



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG KL+RP ADEPIAEA     A
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLERP-ADEPIAEAPAETAA  260



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RP ADEP+AE  TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVERP-ADEPMAEEPTEVIGA  261



>gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 96/105 (91%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQA SCDLK+LV KFIPE IGREIEKATSSIYPLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMREIMINQASSCDLKELVAKFIPEMIGREIEKATSSIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+ +D+G KLDRP ADE IAEA TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSADDIGVKLDRP-ADETIAEAETEVVGA  262



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RPA D+     TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKMERPADDQIAEGETEVVGA  261



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_006382772.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
 gb|ERP60569.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
Length=265

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKIL
Sbjct  163  SQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKIL  222

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  223  KAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  265



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETMAEGETEVVGA  261



>ref|XP_003638197.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=159

 Score =   172 bits (436),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  57   SQIRQIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  116

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVGTK++RPA +    E TE VGA
Sbjct  117  KAPKFDLGKLMEVHGDYNEDVGTKVERPADEMVTEEPTEIVGA  159



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   175 bits (444),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPESIG+EIEKAT  IYPLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKDLVAKFIPESIGKEIEKATMGIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA--TEPVGA  223
            K+PKFDLGKLMEVHGDY+EDVG KLDRP A+E +AE   TE VGA
Sbjct  219  KSPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETMAEGETTEVVGA  262



>gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea]
Length=266

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQAQS DLKDLV KFIPESIG+EIEKATS IYPLQNVFIRKVKIL
Sbjct  165  SQIRQIRRKMREIMINQAQSSDLKDLVQKFIPESIGKEIEKATSGIYPLQNVFIRKVKIL  224

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVGTKL+RP A+E  AE  E  GA
Sbjct  225  KAPKFDLGKLMEVHGDYSEDVGTKLERP-AEESTAEPVEVPGA  266



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLVLKFIPE IG+EIEKAT+SI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQASSCDLKDLVLKFIPEVIGKEIEKATASIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K++RPA D  +    E VGA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKMERPAEDVQMEGEAEVVGA  261



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKDLVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K+DRPA D  +    E VGA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDLGKLMEVHGDY+EDVG KL+RP  DEPIAEA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLERP-VDEPIAEA  254



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKMREIM+NQA SCDLK+LV KFIPE IG+EIEKATSS+YPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMREIMINQATSCDLKELVRKFIPEMIGKEIEKATSSVYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLME+HGDY+ED+GTK++RP  +  +  ATE VGA
Sbjct  219  KAPKFDLGKLMEIHGDYSEDIGTKVERPVDETMVEGATEVVGA  261



>ref|XP_006848758.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMRE+M+NQA SCDLK+LV KFIPE IG+EIEK T SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREVMINQATSCDLKELVQKFIPEVIGKEIEKVTMSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY++DVG K+DRPA D P+   TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSDDVGVKVDRPAEDVPLEGVTEVVGA  261



>gb|KDO43437.1| hypothetical protein CISIN_1g040060mg, partial [Citrus sinensis]
Length=241

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  139  SQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKIL  198

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADEPI EA TE +GA
Sbjct  199  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADEPIPEAPTEVIGA  241



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMREIMTNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>gb|AGU71407.1| 40S ribosomal protein, partial [Lumnitzera racemosa]
Length=111

 Score =   169 bits (428),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEK TSSIYPLQNVFIRKVKIL
Sbjct  23   SQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKEIEKVTSSIYPLQNVFIRKVKIL  82

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA  265
            KAPKFDLGKLMEVHGDY+EDVG KLDRPA
Sbjct  83   KAPKFDLGKLMEVHGDYSEDVGVKLDRPA  111



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DR AADEP+AE  TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+ED+G K++RP A+E +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDIGIKMERP-AEETMAEGETEVVGA  261



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DR AADEP+AE  TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DR AADEP+AE  TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM NQA SCDLK+LV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTNQASSCDLKELVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY ED G KLDRP  D P+    E VGA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDFGVKLDRPGEDVPVEGEAEVVGA  261



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDR  271
            KAPKFDLGKLMEVHGDY+EDVG KLDR
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDR  245



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREI++NQA SCDLK+LVLKFIPESIGREIEKATSSIYPLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMREILINQAASCDLKELVLKFIPESIGREIEKATSSIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+ +D+G KL+RP ADE +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSADDIGVKLERP-ADELMAEGETEVVGA  262



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREI+VNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIVVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K++RPA D P+    E VGA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKIERPADDVPMEGEPEVVGA  261



>gb|KDO37446.1| hypothetical protein CISIN_1g045491mg, partial [Citrus sinensis]
Length=241

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  139  SQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKIL  198

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  199  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  241



>ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
 gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
Length=246

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  144  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  203

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  204  KAPKFDLGKLMEVHGDYGEDVGVKLERP-ADETMAEATTEVVGA  246



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM NQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMREIMTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  220  KAPKFDLGKLMEVHGDYGEDVGVKLERP-ADETMAEATTEVVGA  262



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            K+PKFDLGKLMEVHGDY+EDVGTK++ P ADE + E T E VGA
Sbjct  219  KSPKFDLGKLMEVHGDYSEDVGTKVESP-ADETVVEGTPEIVGA  261



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM NQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMREIMTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +AE  TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  261



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AE+T E VGA
Sbjct  220  KAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAESTPEVVGA  262



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K+DRPA D  +   +E  GA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKVDRPAEDVQMEGESEVAGA  261



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDLGKLMEVHGDY+EDVG KLDRP A+E +AEA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETMAEA  254



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPV  229
            KAPKFDLGKLMEVHGDY+EDVG KLDRP ADE +AEA   V
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP-ADETVAEAEAEV  258



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDLGKLMEVHGDY+EDVG KLDRP A+E +AEA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETMAEA  254



>ref|XP_003638196.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=244

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  142  SQIRQIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  201

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVGTK++RPA +    E TE VGA
Sbjct  202  KAPKFDLGKLMEVHGDYNEDVGTKVERPADEMVTEEPTEIVGA  244



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            K+PKFDLGKLMEVHGDY EDVG K+DRPA D P+      VGA
Sbjct  219  KSPKFDLGKLMEVHGDYKEDVGVKVDRPAEDVPMEGEEVVVGA  261



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVERPADESMAEEPTEVIGA  261



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%), Gaps = 2/103 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV QAQSCDLK+LV KFIPESIG+EIEKATSSIYPLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMHEIMVAQAQSCDLKELVQKFIPESIGKEIEKATSSIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYTE+VG K++R  A+E  AE TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYTEEVGVKVER--AEETAAEPTEVVGA  259



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVGTK++RPA +    E TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYNEDVGTKVERPADEMVTEEPTEIVGA  261



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKVERPADETMAEEPTEVIGA  261



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  220  KAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFD GKLMEVHGDY EDVG K+DRPA D  +    E VGA
Sbjct  219  KAPKFDXGKLMEVHGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  220  KAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +A SCDLKDLV KFIPE+IGREIEKAT +IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVKEASSCDLKDLVAKFIPEAIGREIEKATQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            K+PKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  219  KSPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  232
            KAPKFD+GKLMEVHGDY+EDVG KLDRP ADE +AEA EP
Sbjct  219  KAPKFDIGKLMEVHGDYSEDVGVKLDRP-ADETVAEA-EP  256



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  232
            KAPKFD+GKLMEVHGDY+EDVG KLDRP ADE +AEA EP
Sbjct  219  KAPKFDIGKLMEVHGDYSEDVGVKLDRP-ADETVAEA-EP  256



>dbj|BAH57033.1| AT4G34670 [Arabidopsis thaliana]
Length=129

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IGREIEKAT  IYPLQNVFIRKVKIL
Sbjct  26   SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKIL  85

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  86   KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMVEEPTEIIGA  129



>gb|KHG08611.1| 40S ribosomal S3a [Gossypium arboreum]
Length=159

 Score =   167 bits (422),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  57   SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  116

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++R  ADE +AEA  E +GA
Sbjct  117  KAPKFDLGKLMEVHGDYSEDVGVKIER-LADETMAEAAPEVIGA  159



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score =   170 bits (430),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RP ADE +AEA  E +GA
Sbjct  220  KAPKFDLGKLMEVHGDYSEDVGVKIERP-ADETMAEAAPEVIGA  262



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFD+GKLMEVHGDY+EDVG KL+RP  +  +   TE VGA
Sbjct  219  KAPKFDIGKLMEVHGDYSEDVGVKLERPIEETMVEGETEVVGA  261



>gb|AAP80662.1|AF479043_1 40S ribosomal protein, partial [Triticum aestivum]
Length=113

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKIL
Sbjct  9    SQIRQIRRKMVEIMVNQAASCDLKELVNKFIPEVIGKEIEKATSSIFPLQNVYVRKVKIL  68

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG KLDRPA  + +    E V A
Sbjct  69   KAPKFDLGKLMEVHGDYKEDVGVKLDRPADGDEVIPGAEEVAA  111



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   177 bits (449),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV Q+QSCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  547  SQIRQIRRKMMEIMVAQSQSCDLKELVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  606

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYTE+VG KLDR AA+E +AE TE VGA
Sbjct  607  KAPKFDLGKLMEVHGDYTEEVGVKLDR-AAEEAVAEPTELVGA  648



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLM++HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  219  KAPKFDLGKLMDIHGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RP ADE +AE T E +GA
Sbjct  220  KAPKFDLGKLMEVHGDYSEDVGVKIERP-ADETMAEPTPEVIGA  262



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  232
            KAPKFD+GKLMEVHGDY+EDVG KLDRP  DE +AEA EP
Sbjct  219  KAPKFDIGKLMEVHGDYSEDVGVKLDRP-TDETVAEA-EP  256



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQI QIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNV+IRKVKIL
Sbjct  159  SQIGQIRRKMREIMTAQAASCDLKELVRKFIPETIGKEIEKATSSIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDLGKLMEVHGDY+EDVG KL+RP ADEP+AEA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLERP-ADEPMAEA  254



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  232
            KAPKFD+GKLMEVHGDY+EDVG KLDRP  DE +AEA EP
Sbjct  219  KAPKFDIGKLMEVHGDYSEDVGVKLDRP-VDETVAEA-EP  256



>ref|XP_006838990.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
 gb|ERN01559.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
Length=265

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  164  SQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  223

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATE  235
            KAPKFDLGKLMEVHGDY++DVG K++RPA D  +   TE
Sbjct  224  KAPKFDLGKLMEVHGDYSDDVGVKVERPAEDVAMDGETE  262



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT +IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLM+VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  219  KAPKFDLGKLMDVHGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPI  250
            KAPKFDLGKLMEVHGDY EDVGTKL+RPA DE +
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGTKLERPAEDEVV  252



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMREIMSNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVGTK+DRP  +    E TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGTKVDRPVEETTAEEPTEIVGA  261



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMR+IM+ +A SCDLKDLV KFIPE+IGREIEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMRDIMIKEASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLM+VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  219  KAPKFDLGKLMDVHGDYTAEDVGVKVDRPADEMAVEEPTEIIGA  262



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 92/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+ QA SCDLK LV KFI E IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K++RP ADEPI EA TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKMERP-ADEPIPEAPTEVIGA  261



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score =   167 bits (424),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMR+IMV +A SCDLKDLV KFIPE+IGREIEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLM+VHGDY+ EDVG K+DRPA +  + E TE +GA
Sbjct  219  KAPKFDLGKLMDVHGDYSAEDVGVKVDRPADEMAVEEPTEIIGA  262



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score =   167 bits (424),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IGREIEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMVEEPTEIIGA  262



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score =   167 bits (424),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+ EDVG K++RPA +    E TE VGA
Sbjct  219  KAPKFDLGKLMEVHGDYSAEDVGVKVERPADETMAEEPTEIVGA  262



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 92/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMTEIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLM++HGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  219  KAPKFDLGKLMDIHGDYTAEDVGVKVDRP-AEEVVEEPTEIIGA  261



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 4/100 (4%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLME---VHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDLGKLME   VHGDY+EDVG KLDRP A+E +AEA
Sbjct  219  KAPKFDLGKLMEASIVHGDYSEDVGVKLDRP-AEETMAEA  257



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFD+GKLMEVHGDY+EDVG KLDRP ADE +    E  GA
Sbjct  219  KAPKFDIGKLMEVHGDYSEDVGVKLDRP-ADETVEAEPEIPGA  260



>ref|XP_009406018.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=241

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA + DLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKIL
Sbjct  140  SQIRQIRRKMREIMVNQATTGDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKIL  199

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K+DRPA D  + E  E  GA
Sbjct  200  KAPKFDLGKLMEVHGDYKEDVGAKVDRPAEDVQM-EGEEVTGA  241



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQI+QIRRKMREIMV QAQ+CDLK+LV KFIPESIGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIKQIRRKMREIMVTQAQTCDLKELVQKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDR  271
            KAPKFD+GKLMEVHGDY+EDVG KLDR
Sbjct  219  KAPKFDIGKLMEVHGDYSEDVGVKLDR  245



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IG+EIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGKEIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPAEETVAEEPTEIIGA  262



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA + DLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATTGDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K+DRPA D  + E  E  GA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGAKVDRPAEDVQM-EGEEVTGA  260



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR+KM EIM NQA SCDLK+LV K IPESIGREIEK+T+SI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRKKMVEIMRNQASSCDLKELVAKIIPESIGREIEKSTTSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG KLDRP A+E +AE  TE VG+
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETVAEGETEVVGS  261



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  247
            KAPKFDLGKLMEVHGDY  ED+GTKLDRPA DE +A
Sbjct  219  KAPKFDLGKLMEVHGDYAKEDIGTKLDRPAEDEAMA  254



>gb|EMT30223.1| 40S ribosomal protein S3a [Aegilops tauschii]
Length=257

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKIL
Sbjct  153  SQIRQIRRKMVEIMVNQAASCDLKELVNKFIPEVIGKEIEKATSSIFPLQNVYVRKVKIL  212

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG KLDRPA  + +    E V A
Sbjct  213  KAPKFDLGKLMEVHGDYKEDVGVKLDRPADGDEVIPGAEEVAA  255



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IGREIEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPESIGR+IEKA  SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR KMREIM+ +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRSKMREIMIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  261



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKM EIMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRP ADE   E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRP-ADETAEEPTEIIGA  261



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score =   166 bits (419),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 94/110 (85%), Gaps = 8/110 (7%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEK T SI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVQKFIPEMIGKEIEKTTKSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLME------VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLME      VHGDY+ED+G K++RP ADE IAEA TE +GA
Sbjct  219  KAPKFDLGKLMEASFLYPVHGDYSEDIGAKVERP-ADETIAEATTEVIGA  267



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR KMREIM+ +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKIL
Sbjct  200  SQIRQIRSKMREIMIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKIL  259

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  260  KAPKFDLGKLMEVHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  302



>gb|AAX55706.1| cyc07 [Vitis vinifera]
Length=237

 Score =   164 bits (416),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  135  SQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKIL  194

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRP  268
            KAPKFDLGKLMEVHGDY+EDVG K++RP
Sbjct  195  KAPKFDLGKLMEVHGDYSEDVGVKMERP  222



>ref|XP_003559021.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=265

 Score =   165 bits (417),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQ+VF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIFPLQSVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG K+DRPA  DE I    E V A
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGMKVDRPAEGDEAIIPGAEDVAA  262



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score =   165 bits (417),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKMR+IMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMRDIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLM+VHGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  219  KAPKFDLGKLMDVHGDYTAEDVGVKVDRP-AEETVEEPTEIIGA  261



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score =   165 bits (417),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IGR+IEKA  SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGRDIEKAVQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score =   165 bits (417),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ++QIRRKM EIMVNQ  SCDLK++V K IPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQVKQIRRKMTEIMVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAE-ATEPVGA  223
            KAPKFDLGKLME+HGDY+EDVG K+DRP  DE + E ATE VGA
Sbjct  219  KAPKFDLGKLMEIHGDYSEDVGVKVDRP-VDETMPEGATEVVGA  261



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRP  268
            KAPKFDLGKLMEVHGDY+EDVG K++RP
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKMERP  246



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKM EIMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG ++DRP ADE   E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVRVDRP-ADETAEEPTEIIGA  261



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRP  268
            KAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRP  268
            KAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRP  268
            KAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDL KLMEVHGDY+E+VG K++RP  DEP AEA
Sbjct  219  KAPKFDLMKLMEVHGDYSEEVGAKIERPVGDEPAAEA  255



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 4/105 (4%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPESIGR+IEKAT +IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPESIGRDIEKATQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRP  DE +AE  TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRP--DETVAEEPTEIIGA  261



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  159  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRP  268
            KAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 91/108 (84%), Gaps = 9/108 (8%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMAKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPA----ADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+ EDVG K+DRP     ADEP    TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYSAEDVGVKVDRPTDEIMADEP----TEVIGA  262



>gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNV++RKVKIL
Sbjct  159  SQIRQIRRKMREIMTAQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVYVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA  265
            KAPKFDLGKLMEVHGDY+EDVGTKL+RPA
Sbjct  219  KAPKFDLGKLMEVHGDYSEDVGTKLERPA  247



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA  265
            KAPKFDLGKLMEVHGDY+EDVG KL+RPA
Sbjct  220  KAPKFDLGKLMEVHGDYSEDVGVKLERPA  248



>gb|ABB72808.1| cyc07-like protein [Solanum tuberosum]
Length=260

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKIL
Sbjct  158  SQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKIL  217

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRP  268
            KAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  218  KAPKFDLGKLMEVHGDYSEDVGVKLDRP  245



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  247
            KAPKFDLGKLMEVHGDYT EDVG KL+RPA DE +A
Sbjct  219  KAPKFDLGKLMEVHGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  247
            KAPKFDLGKLMEVHGDYT EDVG KL+RPA DE +A
Sbjct  219  KAPKFDLGKLMEVHGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  247
            KAPKFDLGKLMEVHGDYT EDVG KL+RPA DE +A
Sbjct  219  KAPKFDLGKLMEVHGDYTKEDVGMKLERPAEDEAVA  254



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score =   171 bits (434),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVG  226
            KAPKFDLGKLMEVHGDY EDVGTKL+RPA DE +   +  +G
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGTKLERPAEDEVVERDSSIIG  260



>ref|XP_001761018.1| predicted protein [Physcomitrella patens]
 gb|EDQ74085.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD--EPIAEATEPVGA  223
            KAPKFDL KLMEVHGDY+E+VG K++RP  D  EP+AEA    GA
Sbjct  219  KAPKFDLMKLMEVHGDYSEEVGAKIERPVGDEAEPVAEAAPVPGA  263



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR KMREIM+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRSKMREIMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETAAEEPTEIIGA  262



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+E+EKATSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMTNQASTCDLKELVSKFIPEVIGKEVEKATSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIA  247
            KAPKFDLGKLMEVHGDY EDVGTK++RPA ADE + 
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGTKVERPAEADEAMG  254



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score =   171 bits (432),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPI  250
            KAPKFDLGKLMEVHGDY EDVGTKL+RPA DE +
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGTKLERPAEDEVV  252



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV +A SCDLK+LV KFIPESIGR+IEKA  SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMSEIMVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT ED G K+DRPA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDGGVKVDRPADEATAEEPTEIIGA  262



>gb|ACL53942.1| unknown [Zea mays]
Length=158

 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 3/103 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  57   SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  116

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG KL+RP   +   EA + V A
Sbjct  117  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGD---EAGQEVAA  156



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   162 bits (411),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA SCDLK LV KFIPE IG+EIE ATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIENATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKF L KLMEVHGDY+EDVGTK++ PA +    E TE VGA
Sbjct  219  KAPKFHLEKLMEVHGDYSEDVGTKVESPADEMVTEEPTEIVGA  261



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   162 bits (409),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTED  292
            KAPKFDLGKLMEVHGDY ED
Sbjct  219  KAPKFDLGKLMEVHGDYNED  238



>gb|AFW89329.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=231

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  130  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  189

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  244
            KAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  190  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  226



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 91/104 (88%), Gaps = 3/104 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQA SCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMINQAASCDLKDLVAKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDL KLMEVHG   EDVG K+DR +A+E + E  TE VGA
Sbjct  219  KAPKFDLPKLMEVHGG-KEDVGVKVDR-SAEETVPEGETEVVGA  260



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  +AQSCDLK+LV KFIPE+IG+EIEKAT  IYPLQN FIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTKEAQSCDLKELVGKFIPEAIGKEIEKATQGIYPLQNTFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPV  229
            KAPKFDL KLMEVHGDY+E+VG K++RP  D+   EA TEPV
Sbjct  219  KAPKFDLMKLMEVHGDYSEEVGAKIERPVGDDAETEAVTEPV  260



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG++IEKATSSI+PLQNVF+RKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKDIEKATSSIFPLQNVFVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPI  250
            KAPKFDLGKLMEVHGDY +D+GTK++RPA DE +
Sbjct  219  KAPKFDLGKLMEVHGDYKDDIGTKVERPAEDEAM  252



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR KMREIM+ +A S DLK+LV KFIPESIG+EI+KAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRSKMREIMIKEASSSDLKELVAKFIPESIGKEIDKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR KMREIM+ +A S DLK+LV KFIPESIG+EIEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIREIRSKMREIMIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR KMREIM+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRSKMREIMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+D PA +    E TE +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDSPADETAAEEPTEIIGA  262



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA  265
            KAPKFDLGKLMEVHGDY EDVG KLDRPA
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGMKLDRPA  247



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  244
            KAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  255



>gb|ABK22319.1| unknown [Picea sitchensis]
Length=245

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  143  SQIRQIRRKMTEIMIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  202

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DR   + P     E VGA
Sbjct  203  KAPKFDLGKLMEVHGDYSEDVGVKVDRTTEEAPAEAEAELVGA  245



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG KL+RPA  E      E   A
Sbjct  219  KAPKFDLGKLMEVHGDYTKEDVGVKLERPAEAEEAVVGQEAAAA  262



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR KMREIM+ +A S DLK+LV KFIPESIG+EIEKAT  IYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRSKMREIMIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E  E +GA
Sbjct  219  KAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPAEIIGA  262



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score =   160 bits (405),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  158  SQIRQIRRKMTEIMIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  217

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG K+DR   + P     E VGA
Sbjct  218  KAPKFDLGKLMEVHGDYSEDVGVKVDRTTEEAPAEAEAELVGA  260



>ref|XP_003572000.1| PREDICTED: 40S ribosomal protein S3a [Brachypodium distachyon]
Length=265

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQAASCDLKELVAKFIPEVIGKEIEKATSSIFPLQNVYVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDY-TEDVGTKLDRPA-ADEPIAEATE  235
            KAPKFDLGKLMEVHGDY  EDVG KLDRPA  DE I  A E
Sbjct  219  KAPKFDLGKLMEVHGDYGKEDVGVKLDRPAEGDEAIPGAEE  259



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 91/104 (88%), Gaps = 4/104 (4%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV+QA SCDLKDLV KFI ESIG+EIEK T+SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMTEIMVSQASSCDLKDLVRKFIAESIGKEIEKQTTSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGD  EDVGTK+DRP A+E + EA  E VGA
Sbjct  219  KAPKFDLGKLMEVHGD--EDVGTKVDRP-AEEAVPEAPVEIVGA  259



>ref|XP_001774288.1| predicted protein [Physcomitrella patens]
 gb|EDQ60924.1| predicted protein [Physcomitrella patens]
Length=254

 Score =   160 bits (404),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  +AQ+CDLKDLV KFIPE IG+EIEKAT  IYPLQN FIRKVKIL
Sbjct  149  SQIRQIRRKMREIMTREAQTCDLKDLVSKFIPEVIGKEIEKATQGIYPLQNTFIRKVKIL  208

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD--EPIAEATEPV  229
            KAPKFDL KLMEVHGDY+E+VG+K++RP  D  E  A A EPV
Sbjct  209  KAPKFDLMKLMEVHGDYSEEVGSKIERPVGDVAETDAGAAEPV  251



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   160 bits (404),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  244
            KAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAMQE  255



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   160 bits (404),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  244
            KAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAMQE  255



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score =   160 bits (404),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  244
            KAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAMQE  255



>ref|XP_010229024.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=264

 Score =   160 bits (404),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQATSCDLKELVQKFIPEVIGKEIEKATSSIFPLQNVYVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPI  250
            KAPKFDLGKLMEVHGDY EDVG K+DRPA  DE +
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGMKVDRPADGDEAV  253



>gb|EEE56753.1| hypothetical protein OsJ_06287 [Oryza sativa Japonica Group]
Length=399

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 86/96 (90%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIA  247
            KAPKFDLGKLMEVHGDY EDVG KLDRPA  DE +A
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGMKLDRPAETDEAVA  254



>ref|XP_006481160.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
Length=94

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = -2

Query  504  MREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGK  325
            MREIMV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGK
Sbjct  1    MREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGK  60

Query  324  LMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            LMEVHGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  61   LMEVHGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  94



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 3/103 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG KL+RP   +   EA + V A
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>gb|KHG19561.1| 40S ribosomal S3a [Gossypium arboreum]
Length=245

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQI RKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIR+VKIL
Sbjct  143  SQIRQICRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIREVKIL  202

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLM VHGDY+EDV  K++RP ADE +AE T E +GA
Sbjct  203  KAPKFDLGKLMAVHGDYSEDVRVKIERP-ADETMAEPTPELIGA  245



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 89/104 (86%), Gaps = 6/104 (6%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQ    MREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  160  SQIRQ----MREIMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKIL  215

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  216  KAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  258



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 87/103 (84%), Gaps = 3/103 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGDY EDVG KL+RP   +   EA + V A
Sbjct  219  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  229  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  288

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  244
            KAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  289  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  325



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKIL
Sbjct  231  SQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKIL  290

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  244
            KAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  291  KAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  327



>ref|XP_002987274.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 ref|XP_002987332.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
 ref|XP_002989169.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 ref|XP_002989210.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ09763.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 gb|EFJ09804.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ11589.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 gb|EFJ11647.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
Length=263

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR+KMREIMV +AQSCDLKDLV KFIPE IG+EIEK T+ IYPLQN +IRKVKIL
Sbjct  159  SQIRQIRKKMREIMVREAQSCDLKDLVAKFIPEVIGKEIEKVTAGIYPLQNTYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD  259
            KAPKFDLGKLMEVHGDY+ED G K++RP  D
Sbjct  219  KAPKFDLGKLMEVHGDYSEDTGVKVERPVGD  249



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 88/105 (84%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKM EIM+ +A SCDLK LV KFIPESIGREIEK T +IYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMTEIMIKEASSCDLKQLVAKFIPESIGREIEKVTQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  223
            KAPKFDLGKLMEVH DYT EDVG K+DRP  DE +AE   E +GA
Sbjct  219  KAPKFDLGKLMEVHSDYTAEDVGVKVDRP-EDETVAEEPAEIIGA  262



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQ-AQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKI  355
            SQIRQIR KMREIM+ + A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKI
Sbjct  159  SQIRQIRSKMREIMIKEEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKI  218

Query  354  LKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            LKAPKFDL KLMEVHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  219  LKAPKFDLRKLMEVHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  262



>dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVYVRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIAEATEP  232
            KAPKFD+GKLMEVHGDY  EDVG KL+RPA ADE   E   P
Sbjct  219  KAPKFDIGKLMEVHGDYNKEDVGVKLERPAEADEAGVEVAAP  260



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 2/97 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMTEIMSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIA  247
            KAPKFD+GKLMEVHGDY  EDVG K+DRPA  DE + 
Sbjct  219  KAPKFDIGKLMEVHGDYAKEDVGVKMDRPAEGDEAMG  255



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+NQA +CDLK+LV KFIPE IGREIEKATSSIYPLQ+VFIRK KIL
Sbjct  159  SQIRQIRRKMREIMINQASACDLKELVQKFIPEMIGREIEKATSSIYPLQHVFIRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVH +  EDVG K+DRP A+E + E T  VGA
Sbjct  219  KAPKFDLGKLMEVH-EKKEDVGVKIDRP-AEEIVPEETTIVGA  259



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 85/97 (88%), Gaps = 2/97 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMTEIMSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIA  247
            KAPKFD+GKLMEVHGDY  EDVG K+DRPA  DE + 
Sbjct  219  KAPKFDIGKLMEVHGDYAKEDVGVKMDRPAEGDEAMG  255



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR KMREIM+NQA SCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRLKMREIMINQAASCDLKDLVAKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVG  226
            KAPKFDL KLMEVHG   EDVG K+DR A +      TE VG
Sbjct  219  KAPKFDLPKLMEVHGG-KEDVGVKVDRSAEETAPEGETEVVG  259



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLKDLV KFIPESIGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQAPSCDLKDLVQKFIPESIGREIEKATPSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTED  292
            KAPKFDLGKLMEVHGDY ED
Sbjct  219  KAPKFDLGKLMEVHGDYNED  238



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKIL
Sbjct  165  SQIRQIRRKMREIMVREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKIL  224

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD  259
            KAPKFDL KLMEVHGDY+E+VG K++RP  D
Sbjct  225  KAPKFDLMKLMEVHGDYSEEVGAKIERPVGD  255



>gb|ABE66401.1| S phase protein [Striga asiatica]
Length=190

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 1/86 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQAQSCDLKDLV KF+PESIG+EIEKAT SIYPLQNV+IRKVKIL
Sbjct  106  SQIRQIRRKMREIMVNQAQSCDLKDLVQKFVPESIGKEIEKATQSIYPLQNVYIRKVKIL  165

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLD  274
            KAPKFDL +LMEVHGD+ E++G KL+
Sbjct  166  KAPKFDLSRLMEVHGDH-EEIGVKLE  190



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKMR+IM+ +A S DLK+LV KFIPE+IG+EIEK+T +IYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMRDIMIKEASSVDLKELVKKFIPEAIGKEIEKSTQNIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVHGD T EDVG K+DRP  DE + E  E +GA
Sbjct  219  KAPKFDLGKLMEVHGDLTAEDVGVKVDRP-EDEAVEEPAEIIGA  261



>gb|EMS66737.1| 40S ribosomal protein S3a [Triticum urartu]
Length=342

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 1/92 (1%)
 Frame = -2

Query  519  QIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPK  340
            QIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPK
Sbjct  103  QIRRKMVEIMVNQAASCDLKELVNKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPK  162

Query  339  FDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIA  247
            FDLGKLMEVHGDY EDVG KLDRPA  DE ++
Sbjct  163  FDLGKLMEVHGDYKEDVGVKLDRPADGDEHLS  194



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 84/99 (85%), Gaps = 3/99 (3%)
 Frame = -2

Query  519  QIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPK  340
            QIRRKM +IMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPK
Sbjct  156  QIRRKMVDIMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPK  215

Query  339  FDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            FDLGKLMEVHGDY EDVG KL+RP   +   EA + V A
Sbjct  216  FDLGKLMEVHGDYKEDVGVKLERPVEGD---EAGQEVAA  251



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTREAQTCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAA  262
            KAPKFDL KLMEVHGDY+E+VG K+DRP  
Sbjct  219  KAPKFDLMKLMEVHGDYSEEVGAKIDRPVG  248



>gb|EYU30365.1| hypothetical protein MIMGU_mgv1a021183mg, partial [Erythranthe 
guttata]
Length=206

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 86/103 (83%), Gaps = 8/103 (8%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIMV Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKIL
Sbjct  112  SQIRQIRRKMMEIMVAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKIL  171

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVH       G KLDR +A+E +AE TE VGA
Sbjct  172  KAPKFDLGKLMEVH-------GVKLDR-SAEEAVAEPTELVGA  206



>ref|XP_010229342.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=98

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  504  MREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGK  325
            M EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQ+VF+RKVKILKAPKFDLGK
Sbjct  1    MVEIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIFPLQSVFVRKVKILKAPKFDLGK  60

Query  324  LMEVHGDYTEDVGTKLDRPA-ADEPIAEATEPVGA  223
            LMEVHGDY EDVG K+DRPA  DE I    E V A
Sbjct  61   LMEVHGDYKEDVGMKVDRPAEGDEAIILGAEDVAA  95



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score =   151 bits (382),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDV  289
            KAPKFDLGKLMEVHGDY+EDV
Sbjct  220  KAPKFDLGKLMEVHGDYSEDV  240



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTKEAQTCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAA  262
            KAPKFDL KLMEVHGDY+E+VG K++RP  
Sbjct  219  KAPKFDLMKLMEVHGDYSEEVGAKIERPVG  248



>dbj|BAD94105.1| 40S ribosomal protein S3A like protein [Arabidopsis thaliana]
Length=95

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -2

Query  504  MREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGK  325
            MR+IMV +A SCDLKDLV KFIPE+I REIEKAT  IYPLQNVFIRKVKILKAPKFDLGK
Sbjct  1    MRDIMVREASSCDLKDLVAKFIPEAIDREIEKATQGIYPLQNVFIRKVKILKAPKFDLGK  60

Query  324  LMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  223
            LM+VHGDY+ EDVG K+DRPA +  + E TE +GA
Sbjct  61   LMDVHGDYSAEDVGVKVDRPADEMAVEEPTEIIGA  95



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -2

Query  513  RRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFD  334
            RRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFD
Sbjct  165  RRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFD  224

Query  333  LGKLMEVHGDYTEDVGTKLDRPA  265
            LGKLMEVHGDY EDVG KLDRPA
Sbjct  225  LGKLMEVHGDYKEDVGMKLDRPA  247



>gb|EYU26004.1| hypothetical protein MIMGU_mgv1a019927mg, partial [Erythranthe 
guttata]
Length=209

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 85/103 (83%), Gaps = 8/103 (8%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQI QIRRKM EIMV Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKIL
Sbjct  115  SQILQIRRKMMEIMVAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKIL  174

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDLGKLMEVH       G KLDR +A+E +AE TE VGA
Sbjct  175  KAPKFDLGKLMEVH-------GVKLDR-SAEEAVAEPTELVGA  209



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV QA S DLKDLV KFI ESIG+EIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDL KLMEVHG   EDVG K++RPA +       E VGA
Sbjct  219  KAPKFDLTKLMEVHGG-NEDVGQKVERPAEEAVTEPPPEIVGA  260



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   150 bits (380),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 79/103 (77%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMV QA S DLKDLV KFI ESIG+EIEKAT SIYPLQNVFIRKVKIL
Sbjct  528  SQIRQIRRKMREIMVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPLQNVFIRKVKIL  587

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDL KLMEVHG   EDVG K++RPA +       E VGA
Sbjct  588  KAPKFDLTKLMEVHGG-NEDVGQKVERPAEEAVTEPPPEIVGA  629



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 86/131 (66%), Gaps = 28/131 (21%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLME---------------------------VHGDYT-EDVGTKLDRPAADE  256
            KAPKFDLGKLME                           VHGDYT EDVG KL+RPA  E
Sbjct  219  KAPKFDLGKLMEVIPSDRAIMFFPAFLWPVILTLNIASQVHGDYTKEDVGVKLERPAEAE  278

Query  255  PIAEATEPVGA  223
                  E   A
Sbjct  279  EAVVGQEAAAA  289



>gb|ABR26074.1| 40S ribosomal protein S3a [Oryza sativa Indica Group]
Length=88

 Score =   139 bits (349),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = -2

Query  483  QAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGD  304
            QA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLMEVHGD
Sbjct  1    QASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEVHGD  60

Query  303  YT-EDVGTKLDRPAADEPIA  247
            Y  ED+GTKLDRPA DE +A
Sbjct  61   YAKEDIGTKLDRPAEDEAMA  80



>gb|KJB28383.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=225

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 9/104 (9%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKIL
Sbjct  130  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKIL  189

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLME+        G K++RP ADE +AE T E +GA
Sbjct  190  KAPKFDLGKLMEM-------FGVKIERP-ADETMAEPTPELIGA  225



>gb|KJB28384.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=230

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 9/104 (9%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKIL
Sbjct  135  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKIL  194

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLME+        G K++RP ADE +AE T E +GA
Sbjct  195  KAPKFDLGKLMEM-------FGVKIERP-ADETMAEPTPELIGA  230



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 9/104 (9%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKIL  219

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  223
            KAPKFDLGKLME+        G K++RP ADE +AE T E +GA
Sbjct  220  KAPKFDLGKLMEM-------FGVKIERP-ADETMAEPTPELIGA  255



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            +QIRQIR+KM EI+  +A SCDLKDLV KFIPE+IG++IEK+   IYPLQN FIRKVK+L
Sbjct  159  AQIRQIRKKMTEIITREATSCDLKDLVAKFIPEAIGKDIEKSCQGIYPLQNTFIRKVKVL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDR  271
            KAPKFD+ KLMEVHGDY+E+VGTKLDR
Sbjct  219  KAPKFDITKLMEVHGDYSEEVGTKLDR  245



>ref|XP_008350557.1| PREDICTED: 40S ribosomal protein S3a-like, partial [Malus domestica]
Length=149

 Score =   139 bits (350),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKM EIM+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKIL
Sbjct  49   SQVRQIRRKMSEIMIAQATSSDLKGLVSKFIAESIGKEIEKATMSIYPLQNVFIRKVKIL  108

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDL KLMEV+G   EDVG K++RPA +       E VGA
Sbjct  109  KAPKFDLTKLMEVYGG--EDVGVKVERPAEEAAPEVQQEIVGA  149



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR+KM EIM  +A SCDLK+LV KFIPE+IG+EIEKAT  IYPLQN  IRKVKIL
Sbjct  159  SQIRQIRKKMVEIMTREASSCDLKELVGKFIPEAIGKEIEKATQGIYPLQNTAIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKL-DRPAADEPIAEATE  235
            +APKFDL KL+EVHGDY+E+ G K+ ++PA + P A   E
Sbjct  219  RAPKFDLTKLLEVHGDYSEEAGAKIAEKPAEEIPGAATAE  258



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEV  313
            KAPKFDLGK ME+
Sbjct  219  KAPKFDLGKFMEI  231



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   139 bits (349),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKM EIM+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMSEIMIAQATSSDLKGLVSKFIAESIGKEIEKATMSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDL KLMEV+G   EDVG K++RPA +       E VGA
Sbjct  219  KAPKFDLTKLMEVYGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKM EIM+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMSEIMIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDL KLMEV+G   EDVG K++RPA +       E VGA
Sbjct  219  KAPKFDLTKLMEVYGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKM EIM+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMSEIMIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  223
            KAPKFDL KLMEV+G   EDVG K++RP  +       E VGA
Sbjct  219  KAPKFDLTKLMEVYGG--EDVGVKVERPTEEAAPEVQQEIVGA  259



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            +QIRQIR+KM EI+  +A SCDLK+LV KFIPESIG++IEK+   IYPLQN FIRKVK+L
Sbjct  159  AQIRQIRKKMMEIITREATSCDLKELVAKFIPESIGKDIEKSCQGIYPLQNTFIRKVKVL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDR  271
            KAPKFD+ KLMEVHGDY+E+VG K++R
Sbjct  219  KAPKFDITKLMEVHGDYSEEVGAKIER  245



>gb|KCW84167.1| hypothetical protein EUGRSUZ_B01030 [Eucalyptus grandis]
Length=244

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 80/104 (77%), Gaps = 18/104 (17%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRK    
Sbjct  158  SQIRQIRRKMREIMVNQATTCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRK----  213

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  223
                        VHGDY+ED+G KLDRP ADEP+AE  TE +GA
Sbjct  214  ------------VHGDYSEDIGVKLDRP-ADEPVAEVPTEVIGA  244



>emb|CBI34197.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  140  SQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKIL  199

Query  351  KAPKFDLGKLMEV  313
            KAPKFDLGKLME 
Sbjct  200  KAPKFDLGKLMEA  212



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEV  313
            KAPKFDLGKLME 
Sbjct  219  KAPKFDLGKLMEA  231



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKIL
Sbjct  160  SQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKIL  219

Query  351  KAPKFDLGKLMEV  313
            KAPKFDLGKLMEV
Sbjct  220  KAPKFDLGKLMEV  232



>ref|XP_007268611.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
 gb|EJD01334.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
Length=256

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            +QIR+IR+KM EIM  +A SCDLK+LVLKFIPE+IGREIEKAT  IYPLQNV++RK KI+
Sbjct  159  AQIREIRKKMFEIMTREASSCDLKELVLKFIPEAIGREIEKATRKIYPLQNVYVRKAKII  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KLME+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLMELHGESTDETGTRVAKEFKEPEIQES  255



>ref|XP_011395666.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
 gb|KFM22801.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
Length=260

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR IRR+M +IM  +A S DLKDLV KFIPE+IG+EIEKA   IYPLQN F+RKVK+L
Sbjct  159  SQIRAIRRRMVDIMTREATSVDLKDLVAKFIPEAIGKEIEKACQGIYPLQNTFVRKVKVL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPA  265
            ++PKFD+GKLMEVHGD   +V T +DRPA
Sbjct  219  RSPKFDVGKLMEVHGDLPTEVSTAVDRPA  247



>ref|XP_003038024.1| 40S ribosomal protein S1 [Schizophyllum commune H4-8]
 gb|EFJ03122.1| hypothetical protein SCHCODRAFT_72059 [Schizophyllum commune 
H4-8]
Length=256

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+R+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KIL
Sbjct  159  SQVREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KLME+HG+ T++ GTK+ +   +  I E+
Sbjct  219  KAPKFDVSKLMELHGESTDETGTKIAKDFKEPEILES  255



>ref|XP_002397772.1| hypothetical protein MPER_01744 [Moniliophthora perniciosa FA553]
 gb|EEB98702.1| hypothetical protein MPER_01744 [Moniliophthora perniciosa FA553]
Length=154

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KIL
Sbjct  57   SQIREIRKKMFEIMTREASNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKIL  116

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPK+D+ KLME+HG+ T++ GT++ +   +  + E+
Sbjct  117  KAPKYDVSKLMELHGETTDETGTRIAKDFKEPEVLES  153



>gb|KIY51600.1| ribosomal protein S3Ae [Fistulina hepatica ATCC 64428]
Length=256

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IRRKM EIM  +A SCDLK+LV KF+PE+IGREIEKA   IYPLQNV++RK KIL
Sbjct  159  SQIREIRRKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARGIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KLME+HG+ T++ GTK+ +   +  I +A
Sbjct  219  KAPKFDMSKLMELHGESTDETGTKVAKDFQEPEILDA  255



>gb|EMD41078.1| hypothetical protein CERSUDRAFT_80722 [Ceriporiopsis subvermispora 
B]
Length=256

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKAT SIYPLQNV+I K KIL
Sbjct  159  SQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKATRSIYPLQNVYIHKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDL KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDLSKLLELHGESTDETGTRVAKEFKEPEILES  255



>ref|XP_007862325.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ59292.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
Length=256

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNV++RK KIL
Sbjct  159  SQIREIRKKMFEIMTREATSCDLKELVQKFIPEAIGREIEKATRSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGESTDETGTRVVKDFKEPEILES  255



>gb|AFU61903.1| putative 40S ribosomal protein S3A, partial [Polyporales sp. 
KUC9061]
Length=171

 Score =   129 bits (323),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IRRKM EIM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++ K KIL
Sbjct  74   SQIREIRRKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVHKAKIL  133

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKL  277
            KAPKFD+ KL+E+HG+ T++ GT++
Sbjct  134  KAPKFDMAKLLELHGESTDETGTRV  158



>gb|AAD30429.1| 40S ribosomal protein S3A [Avena fatua]
Length=84

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  468  DLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDV  289
            DLK+LV KFIPE IG+EIEKAT SI+PLQNV++RKVKILKAPKFDLGKLMEVHGDY EDV
Sbjct  1    DLKELVQKFIPELIGKEIEKATPSIFPLQNVYVRKVKILKAPKFDLGKLMEVHGDYKEDV  60

Query  288  GTKLDRPAADEPIAEATEPVGA  223
            GTKLDRPA  + +    E V A
Sbjct  61   GTKLDRPADGDEVIPGAEEVAA  82



>gb|KIK65348.1| hypothetical protein GYMLUDRAFT_38796 [Gymnopus luxurians FD-317 
M1]
Length=256

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+R+IR+KM EIM  ++ +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV+IRK KIL
Sbjct  159  SQVREIRKKMFEIMTRESTNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYIRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KLME+HG+ T++ GTK+ +   +  I E+
Sbjct  219  KAPKFDVSKLMELHGESTDETGTKIAKDFKEPEILES  255



>ref|XP_002505259.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66517.1| predicted protein [Micromonas sp. RCC299]
Length=263

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
             QIRQIR+KM EI+  +  SCDLK+ VLKFIPE IG+EIEK  + IYPLQNV+IRKVKIL
Sbjct  159  GQIRQIRKKMNEIINREISSCDLKESVLKFIPEVIGKEIEKVCAGIYPLQNVYIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIAEATEPVGA  223
            K PKFD+ KLMEVHGDY  ED G K+DRP    E + +  E VGA
Sbjct  219  KRPKFDVTKLMEVHGDYAGEDAGAKVDRPKDLIEKVEKRDEVVGA  263



>sp|Q764D2.1|RS3A_LENED RecName: Full=40S ribosomal protein S1; AltName: Full=Protein 
cyc07 [Lentinula edodes]
 dbj|BAD11816.1| putative S-phase specific ribosomal protein cyc07 [Lentinula 
edodes]
Length=256

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KIL
Sbjct  159  SQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KLME+HG+ T++ GTK+ +   +  + E+
Sbjct  219  KAPKFDVSKLMELHGESTDETGTKIAKDFKEPEVLES  255



>ref|XP_007302916.1| S-phase-specific ribosomal protein cyc07 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM88274.1| S-phase-specific ribosomal protein cyc07 [Stereum hirsutum FP-91666 
SS1]
Length=256

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            +QIR+IR+KM EIM  +A SCDLK+LVLKF+PE+IGREIEKA  SIYPLQNV++ K KIL
Sbjct  159  AQIREIRKKMFEIMTREASSCDLKELVLKFVPEAIGREIEKAARSIYPLQNVYVHKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KLME+HG+ T++ GT++ +   +  + E+
Sbjct  219  KAPKFDVSKLMELHGEVTDETGTRVAKDFKEPEVLES  255



>ref|XP_007843081.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
 gb|ESK97646.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
Length=256

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KIL
Sbjct  159  SQIREIRKKMFEIMTREASNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KLME+HG+ T++ GT++ +   +  + E+
Sbjct  219  KAPKFDVSKLMELHGETTDETGTRVAKDFKEPEVLES  255



>ref|XP_007382215.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN10703.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=256

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            +QIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKAT SIYPLQNV+IRK KI+
Sbjct  159  AQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKATRSIYPLQNVYIRKAKII  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGETTDETGTRIIKDFKEPEILES  255



>gb|KJA29982.1| hypothetical protein HYPSUDRAFT_81601 [Hypholoma sublateritium 
FD-334 SS-4]
Length=256

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KIL
Sbjct  159  SQIREIRKKMFEIMTREATTCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGESTDETGTRVAKEFKEPEILES  255



>ref|XP_007315533.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01811.1| hypothetical protein SERLA73DRAFT_120459 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27442.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
Length=256

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KIL
Sbjct  159  SQIREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGESTDETGTRIVKDFKEPEILES  255



>emb|CCM04869.1| predicted protein [Fibroporia radiculosa]
Length=256

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IRRKM EIM  +A SCDLK+LV KFIPE+IGREIEKA   IYPLQNVF+ K KIL
Sbjct  159  SQIREIRRKMFEIMTREASSCDLKELVQKFIPEAIGREIEKAARGIYPLQNVFVHKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDMSKLLELHGESTDETGTRVVKDFKEPEILES  255



>gb|KIM46265.1| hypothetical protein M413DRAFT_441346 [Hebeloma cylindrosporum 
h7]
Length=256

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KIL
Sbjct  159  SQIREIRKKMFEIMTREATTCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGESTDETGTRVAKEFKEPEILES  255



>sp|B0CY45.2|RS3A_LACBS RecName: Full=40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
Length=256

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KIL
Sbjct  159  SQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            K+PKFD+ KL+E+HGD T++ GT++ +   +  I E+
Sbjct  219  KSPKFDMSKLLELHGDSTDETGTRIAKDFKEPEILES  255



>gb|KIK06774.1| hypothetical protein K443DRAFT_674057 [Laccaria amethystina LaAM-08-1]
Length=256

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KIL
Sbjct  159  SQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            K+PKFD+ KL+E+HGD T++ GT++ +   +  I E+
Sbjct  219  KSPKFDMSKLLELHGDSTDETGTRIAKDFKEPEILES  255



>ref|XP_002475466.1| 40S ribosomal protein S3A [Postia placenta Mad-698-R]
 sp|B8PIG4.1|RS3A_POSPM RecName: Full=40S ribosomal protein S1 [Postia placenta Mad-698-R]
 gb|EED79317.1| 40S ribosomal protein S3A [Postia placenta Mad-698-R]
Length=256

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIR+KM EIM  +A SCDLK+LV KFIPE+IGREIEKA   IYPLQNVF+ K KIL
Sbjct  159  SQIRQIRQKMFEIMTREASSCDLKELVQKFIPEAIGREIEKAARGIYPLQNVFVHKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDMSKLLELHGESTDETGTRVVKDFKEPEILES  255



>gb|KIJ20179.1| hypothetical protein PAXINDRAFT_166304 [Paxillus involutus ATCC 
200175]
 gb|KIK98754.1| hypothetical protein PAXRUDRAFT_823536 [Paxillus rubicundulus 
Ve08.2h10]
Length=256

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KIL
Sbjct  159  SQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGESTDETGTRVAKDFKEPEILES  255



>ref|XP_001877091.1| 40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
 gb|EDR12827.1| predicted protein [Laccaria bicolor S238N-H82]
Length=273

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KIL
Sbjct  176  SQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKIL  235

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            K+PKFD+ KL+E+HGD T++ GT++ +   +  I E+
Sbjct  236  KSPKFDMSKLLELHGDSTDETGTRIAKDFKEPEILES  272



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            +QIR+IR KM EI+  +  +CDLK+LVLKFIPE IG+EIEK+ S IYPLQNV+IRKVK+L
Sbjct  159  AQIRRIRAKMVEIITRECTTCDLKELVLKFIPEVIGKEIEKSCSGIYPLQNVYIRKVKVL  218

Query  351  KAPKFDLGKLMEVHGDYT-EDVGTKLDRP  268
            KAPKFDL KLMEVHGDY+ E VG  ++RP
Sbjct  219  KAPKFDLTKLMEVHGDYSNEAVGQPVERP  247



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ++QIRRKM EIMVNQ  SCDLK++V K IPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQVKQIRRKMTEIMVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEVHGDY  301
            KAPKFDLGKLME+H  +
Sbjct  219  KAPKFDLGKLMELHSIF  235



>gb|KDR83823.1| hypothetical protein GALMADRAFT_676836 [Galerina marginata CBS 
339.88]
Length=253

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV+IRK KIL
Sbjct  156  SQIREIRKKMFEIMTREATTCDLKELVQKFLPEAIGREIEKACRSIYPLQNVYIRKAKIL  215

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E 
Sbjct  216  KAPKFDMSKLLELHGESTDETGTRVAKDFKEPEILET  252



>gb|KIK48635.1| hypothetical protein CY34DRAFT_797777 [Suillus luteus UH-Slu-Lm8-n1]
Length=256

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KIL
Sbjct  159  SQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGESTDETGTRVAKDFKEPEILES  255



>ref|XP_007767741.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
 gb|EIW82383.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
Length=256

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV+IRK KIL
Sbjct  159  SQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKNTRNIYPLQNVYIRKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDVSKLLELHGESTDETGTRVVKDFKEPEILES  255



>emb|CDO74072.1| hypothetical protein BN946_scf185043.g122 [Trametes cinnabarina]
Length=256

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM+ +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++ K KIL
Sbjct  159  SQIREIRKKMFEIMIREASSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVHKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDMSKLLELHGESTDETGTRVVKDFKEPEILES  255



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKIL
Sbjct  159  SQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLG  328
            KAPKFDLG
Sbjct  219  KAPKFDLG  226



>gb|KIP10648.1| hypothetical protein PHLGIDRAFT_84595 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=256

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++ K KIL
Sbjct  159  SQIREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVHKAKIL  218

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFDL KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  219  KAPKFDLSKLLELHGESTDETGTRVVKDFKEPEILES  255



>gb|KDQ64848.1| hypothetical protein JAAARDRAFT_28494 [Jaapia argillacea MUCL 
33604]
Length=257

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            +QIR+IR+KM EIM  +A SCDLK+LVLKFIPE+IGREIEKAT +IYPLQNV+IRK KIL
Sbjct  159  AQIREIRKKMFEIMTREASSCDLKELVLKFIPEAIGREIEKATRAIYPLQNVYIRKAKIL  218

Query  351  KAPKFDLGKLMEVH-GDYTEDVGTKLDRPAADEPIAEA  241
            K+PKFD+ KL+E+H G+ T++ GT++ +   +  I E+
Sbjct  219  KSPKFDMSKLLELHGGESTDETGTRVAKDFKEPAILES  256



>gb|EPS95373.1| hypothetical protein FOMPIDRAFT_157719 [Fomitopsis pinicola FP-58527 
SS1]
Length=266

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIR+IRRKM EIM  +A SCDLK+LV KFIPE+IGREIEKA  SIYP+QNV++ K KIL
Sbjct  169  SQIREIRRKMFEIMTREATSCDLKELVQKFIPEAIGREIEKAARSIYPVQNVYVHKAKIL  228

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  229  KAPKFDMSKLLELHGESTDETGTRVAKDFKEPEILES  265



>gb|AFU72288.1| 40S ribosomal protein S1, partial [Amanita strobiliformis]
Length=219

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQ+R+IR+KM EI+  +A SCDLK+LV KF+PE+IGREIEKA   IYPLQNV+IRK KIL
Sbjct  122  SQVREIRKKMFEIITREATSCDLKELVQKFVPEAIGREIEKACRGIYPLQNVYIRKAKIL  181

Query  351  KAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  241
            KAPKFD+ KL+E+HG+ T++ GTK+ +   +  I E+
Sbjct  182  KAPKFDVSKLLELHGESTDETGTKVAKDFQEPEILES  218



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  531  SQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKIL  352
            SQIRQIRRKMREIM+ QA SCDLK LV KFI E IGREIEKAT SIYPLQNVFIRKVKIL
Sbjct  159  SQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKIL  218

Query  351  KAPKFDLGKLMEV  313
            KAPKFDLGKLMEV
Sbjct  219  KAPKFDLGKLMEV  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200