BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051O14

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                187   2e-56   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          187   6e-53   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                187   6e-53   Ipomoea batatas [batate]
gb|AFR42412.1|  catalase                                                153   9e-44   Eperua falcata
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      162   9e-44   Nicotiana tomentosiformis
gb|AFR42410.1|  catalase                                                152   4e-43   Eperua falcata
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      159   2e-42   Nicotiana sylvestris
emb|CAB56850.1|  catalase                                               155   1e-41   Prunus persica
ref|NP_001289779.1|  catalase isozyme 1                                 155   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      154   1e-40   Prunus mume [ume]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               154   1e-40   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             154   1e-40   Prunus persica
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 154   1e-40   Elaeis guineensis
emb|CAD42908.1|  catalase                                               154   1e-40   Prunus persica
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 154   1e-40   Eucalyptus grandis [rose gum]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 153   2e-40   Nicotiana sylvestris
dbj|BAH20283.1|  AT1G20620                                              145   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    153   2e-40   Gossypium raimondii
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 153   2e-40   Nicotiana tomentosiformis
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 152   3e-40   Prunus mume [ume]
gb|AAM97542.1|  catalase 3                                              152   4e-40   Capsicum annuum
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          152   4e-40   Soldanella alpina
dbj|BAF91369.1|  catalase                                               152   5e-40   Capsicum annuum
emb|CDP07287.1|  unnamed protein product                                152   5e-40   Coffea canephora [robusta coffee]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      152   5e-40   
gb|AGC65520.1|  catalase                                                152   5e-40   Eriobotrya japonica [loquat]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      152   6e-40   
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             151   1e-39   Prunus persica
emb|CAD42909.1|  catalase                                               151   1e-39   Prunus persica
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                151   1e-39   Citrus sinensis [apfelsine]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      151   1e-39   Populus euphratica
gb|ABY19573.1|  catalase                                                146   1e-39   Manihot esculenta [manioc]
ref|XP_002306976.2|  catalase family protein                            151   1e-39   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             151   2e-39   Citrus clementina [clementine]
gb|AAX84671.1|  catalase CAT2                                           146   2e-39   Manihot esculenta [manioc]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    150   2e-39   Capsicum annuum
emb|CAA10286.1|  catalase                                               142   2e-39   Cicer arietinum [garbanzo]
gb|AET97564.1|  catalase                                                150   3e-39   Ziziphus jujuba [Chinese jujube]
emb|CBI29556.3|  unnamed protein product                                141   3e-39   Vitis vinifera
dbj|BAD94702.1|  catalase                                               140   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AIS20825.1|  CAT                                                     150   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      149   4e-39   Solanum lycopersicum
gb|KJB14249.1|  hypothetical protein B456_002G115900                    147   4e-39   Gossypium raimondii
gb|AAR84578.1|  catalase 1a                                             149   4e-39   Lotus japonicus
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      149   5e-39   
ref|XP_002301920.1|  catalase family protein                            149   6e-39   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               149   6e-39   Populus deltoides
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 149   7e-39   Phoenix dactylifera
gb|AAB88173.1|  catalase                                                145   7e-39   Glycine max [soybeans]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      149   7e-39   Nelumbo nucifera [Indian lotus]
gb|ACJ11733.1|  catalase                                                149   7e-39   Gossypium hirsutum [American cotton]
ref|XP_010498496.1|  PREDICTED: catalase-3                              149   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             149   8e-39   Phaseolus vulgaris [French bean]
ref|XP_009110221.1|  PREDICTED: catalase-3                              149   8e-39   Brassica rapa
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      149   9e-39   Elaeis guineensis
gb|AAA57551.1|  catalase                                                147   9e-39   Nicotiana sylvestris
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 149   9e-39   Populus euphratica
ref|XP_010061175.1|  PREDICTED: catalase-like                           149   1e-38   Eucalyptus grandis [rose gum]
gb|AGE15298.2|  catalase 1                                              149   1e-38   Eriobotrya japonica [loquat]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 148   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    148   1e-38   Arabis alpina [alpine rockcress]
emb|CDY01364.1|  BnaA07g11370D                                          149   1e-38   
emb|CDY31488.1|  BnaC05g15970D                                          148   1e-38   Brassica napus [oilseed rape]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         148   1e-38   Tarenaya hassleriana [spider flower]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     149   2e-38   Eucalyptus grandis [rose gum]
ref|XP_009149539.1|  PREDICTED: catalase-3                              148   2e-38   Brassica rapa
emb|CDY29519.1|  BnaA06g14510D                                          148   2e-38   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         148   2e-38   Brassica rapa
emb|CDY33636.1|  BnaC08g19360D                                          148   2e-38   Brassica napus [oilseed rape]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      148   2e-38   Nicotiana tomentosiformis
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          148   2e-38   Solanum melongena [aubergine]
gb|AIA61608.1|  catalase                                                148   2e-38   Gynostemma pentaphyllum [jiaogulan]
gb|KHG25152.1|  Catalase isozyme 1                                      147   2e-38   Gossypium arboreum [tree cotton]
emb|CDY31878.1|  BnaC07g15280D                                          147   2e-38   Brassica napus [oilseed rape]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      147   2e-38   Vitis vinifera
gb|AJE26131.1|  catalase                                                147   2e-38   Salix matsudana [tortured willow]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           147   2e-38   Sesamum indicum [beniseed]
gb|AFK46618.1|  unknown                                                 139   2e-38   Lotus japonicus
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    147   2e-38   Nicotiana tabacum [American tobacco]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      147   2e-38   Nicotiana sylvestris
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           147   3e-38   
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      147   3e-38   Eucalyptus grandis [rose gum]
ref|NP_001031072.3|  catalase 3                                         145   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      147   3e-38   Phoenix dactylifera
gb|AIX10947.1|  putative catalase                                       147   4e-38   Gardenia jasminoides
gb|KJB14250.1|  hypothetical protein B456_002G115900                    147   4e-38   Gossypium raimondii
gb|ADC95629.1|  catalase                                                147   4e-38   Bruguiera gymnorhiza [Burma mangrove]
gb|AAG43363.1|AF151368_1  catalase                                      147   4e-38   Hevea brasiliensis [jebe]
gb|ABS72010.1|  putative catalase                                       137   4e-38   Olea europaea
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                147   5e-38   Erythranthe guttata [common monkey flower]
ref|NP_001237571.1|  catalase-4                                         146   5e-38   Glycine max [soybeans]
dbj|BAH20307.1|  AT1G20620                                              146   6e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65021.1|  unknown                                                 146   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018034.1|  Catalase 2                                         146   8e-38   
ref|NP_564120.1|  catalase 3                                            146   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530333.1|  PREDICTED: catalase-2                              145   1e-37   Tarenaya hassleriana [spider flower]
ref|NP_001240021.1|  catalase                                           145   1e-37   Glycine max [soybeans]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             145   1e-37   Phaseolus vulgaris [French bean]
gb|AGV54297.1|  peroxisomal catalase                                    145   1e-37   Phaseolus vulgaris [French bean]
gb|ACL27272.1|  catalase                                                145   1e-37   Nicotiana benthamiana
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               145   1e-37   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010094556.1|  Catalase isozyme 1                                 145   1e-37   Morus notabilis
gb|AFU48609.1|  catalase 1                                              145   1e-37   Nicotiana benthamiana
emb|CCP37650.1|  catalase-1                                             145   1e-37   Nicotiana tabacum [American tobacco]
emb|CAC04509.1|  catalase                                               141   1e-37   Digitalis lanata [Grecian foxglove]
ref|NP_001237556.1|  catalase-1/2                                       145   2e-37   Glycine max [soybeans]
ref|NP_001234827.1|  catalase isozyme 1                                 145   2e-37   Solanum lycopersicum
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      145   2e-37   Cucumis melo [Oriental melon]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               145   2e-37   Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      145   2e-37   Gossypium arboreum [tree cotton]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               145   2e-37   Gossypium hirsutum [American cotton]
gb|AAO17721.1|  catalase                                                145   2e-37   Hypericum perforatum
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      144   3e-37   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             144   3e-37   Citrus clementina [clementine]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      145   3e-37   
gb|AAB62892.1|  catalase-1                                              144   3e-37   Nicotiana glutinosa
gb|AAB71764.1|  catalase 1                                              144   3e-37   Nicotiana tabacum [American tobacco]
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 135   3e-37   
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             144   3e-37   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                                144   3e-37   Eutrema halophilum
gb|AAD37788.1|AF149283_1  catalase 1                                    144   3e-37   Phaseolus vulgaris [French bean]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             144   4e-37   Capsella rubella
gb|AHF27428.1|  catalase                                                142   4e-37   Cucurbita moschata [ayote]
ref|NP_001291326.1|  catalase isozyme 1                                 144   5e-37   Sesamum indicum [beniseed]
emb|CDX72514.1|  BnaC07g45360D                                          144   5e-37   
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 144   5e-37   Solanum tuberosum [potatoes]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       144   6e-37   Cucumis sativus [cucumbers]
ref|NP_001235974.1|  catalase-3                                         144   6e-37   Glycine max [soybeans]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               144   6e-37   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACV92695.1|  catalase                                                144   6e-37   Brassica oleracea
gb|AFU90822.1|  catalase                                                143   7e-37   Populus tomentosa [Chinese white poplar]
gb|AAF19965.1|AF207906_1  catalase 1                                    143   8e-37   Zantedeschia aethiopica [arum-lily]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             143   8e-37   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               143   8e-37   Ricinus communis
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          143   8e-37   Vigna radiata var. radiata [golden gram]
gb|AAB86582.2|  catalase                                                143   9e-37   Raphanus sativus
ref|XP_009106100.1|  PREDICTED: catalase-2                              143   9e-37   Brassica rapa
gb|AAF71742.1|AF248491_1  catalase                                      143   9e-37   Raphanus sativus
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     143   1e-36   Sesamum indicum [beniseed]
gb|AAD30292.1|AF139539_1  catalase 3                                    143   1e-36   Raphanus sativus
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             143   1e-36   Capsella rubella
gb|AFR53082.1|  CAT                                                     143   1e-36   Anthurium andraeanum [flamingo-lily]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              143   1e-36   
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 134   1e-36   
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              142   1e-36   Cicer arietinum [garbanzo]
gb|AFU90823.1|  catalase                                                142   1e-36   Populus x beijingensis
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 142   1e-36   Vitis vinifera
ref|NP_001268098.1|  catalase                                           142   1e-36   Vitis vinifera
emb|CDX76313.1|  BnaA08g10870D                                          142   1e-36   
ref|XP_009138342.1|  PREDICTED: catalase-2                              142   1e-36   Brassica rapa
emb|CDY40645.1|  BnaA03g53180D                                          142   1e-36   Brassica napus [oilseed rape]
gb|ACV30589.1|  catalase                                                136   2e-36   Carica papaya [mamon]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               142   2e-36   Ricinus communis
gb|ACJ73905.1|  CAT1                                                    135   2e-36   Solanum nigrum
gb|AAC48918.1|  salicylic acid binding catalase                         142   2e-36   Nicotiana tabacum [American tobacco]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         142   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      142   2e-36   Nicotiana sylvestris
gb|ABC01913.1|  catalase isozyme 1-like protein                         142   2e-36   Solanum tuberosum [potatoes]
emb|CAA64220.1|  catalase                                               142   2e-36   Arabidopsis thaliana [mouse-ear cress]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          142   2e-36   Avicennia marina
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      142   2e-36   Phoenix dactylifera
gb|AAF79625.1|AC027665_26  F5M15.5                                      145   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      142   2e-36   
gb|AAD30291.2|AF139538_1  catalase 2                                    142   2e-36   Raphanus sativus
gb|AAD17936.1|  catalase                                                142   2e-36   Brassica juncea [brown mustard]
gb|AAD17935.1|  catalase                                                142   2e-36   Brassica juncea [brown mustard]
dbj|BAQ21275.1|  catalase                                               142   2e-36   Citrus tamurana
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             142   2e-36   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             142   2e-36   Populus trichocarpa [western balsam poplar]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         142   2e-36   Jatropha curcas
prf||1906388A  catalase                                                 142   2e-36
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      142   2e-36   Nicotiana tomentosiformis
emb|CAA45564.1|  catalase                                               142   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                142   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            142   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|ACA50528.1|  putative catalase 2                                     142   3e-36   Brassica napus [oilseed rape]
emb|CDP07288.1|  unnamed protein product                                142   3e-36   Coffea canephora [robusta coffee]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               142   3e-36   Cucurbita pepo
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          142   3e-36   Amborella trichopoda
emb|CDP01802.1|  unnamed protein product                                141   3e-36   Coffea canephora [robusta coffee]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      142   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP01803.1|  unnamed protein product                                142   3e-36   Coffea canephora [robusta coffee]
gb|ABM47415.1|  catalase                                                142   3e-36   Prunus avium [gean]
gb|AAC49807.1|  catalase 3                                              142   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 142   3e-36   Manihot esculenta [manioc]
ref|XP_010692544.1|  PREDICTED: catalase-like                           141   4e-36   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAC79443.1|  catalase                                               141   4e-36   Acacia ampliceps
gb|AHF27433.1|  catalase                                                141   4e-36   Cucurbita maxima [Boston marrow]
ref|XP_002890395.1|  F5M15.5                                            144   4e-36   
gb|AHF27430.1|  catalase                                                141   4e-36   Cucurbita moschata [ayote]
gb|ABR15776.1|  catalase                                                138   4e-36   Litchi
gb|KFK30147.1|  catalase                                                141   5e-36   Arabis alpina [alpine rockcress]
emb|CDY17510.1|  BnaC03g65530D                                          141   5e-36   Brassica napus [oilseed rape]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                141   5e-36   Erythranthe guttata [common monkey flower]
ref|XP_011022275.1|  PREDICTED: catalase-like                           141   5e-36   Populus euphratica
emb|CDY52649.1|  BnaAnng11640D                                          140   6e-36   Brassica napus [oilseed rape]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    141   6e-36   Gossypium raimondii
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              140   7e-36   Populus euphratica
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              141   7e-36   Populus euphratica
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         140   8e-36   Tarenaya hassleriana [spider flower]
ref|XP_007046520.1|  Catalase 2                                         140   9e-36   Theobroma cacao [chocolate]
gb|AAR97905.1|  catalase                                                140   1e-35   Solanum tuberosum [potatoes]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               140   1e-35   Solanum tuberosum [potatoes]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          140   1e-35   Helianthus annuus
emb|CAA85470.1|  catalase                                               140   1e-35   Solanum tuberosum [potatoes]
prf||2104177A  catalase                                                 140   1e-35
ref|XP_002510677.1|  catalase, putative                                 143   1e-35   
ref|NP_001234186.1|  catalase isozyme 2                                 140   1e-35   
gb|AAR14052.2|  catalase                                                140   1e-35   Solanum tuberosum [potatoes]
gb|ACJ22771.1|  catalase 1                                              140   1e-35   Jatropha curcas
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          140   1e-35
gb|ADZ45555.1|  catalase                                                139   2e-35   Vigna radiata [mung bean]
gb|EPS69543.1|  catalase                                                139   2e-35   Genlisea aurea
gb|AAL00886.1|  catalase                                                136   2e-35   Suaeda salsa
gb|ADZ45556.1|  catalase                                                139   2e-35   Vigna radiata [mung bean]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      139   3e-35   Elaeis guineensis
ref|XP_002521709.1|  catalase, putative                                 139   3e-35   Ricinus communis
emb|CDX69111.1|  BnaC01g03420D                                          139   3e-35   
gb|KEH36312.1|  catalase heme-binding enzyme                            139   3e-35   Medicago truncatula
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      139   3e-35   Solanum tuberosum [potatoes]
gb|ACB11496.1|  catalase                                                139   3e-35   Pinus sylvestris [Scotch pine]
ref|NP_001274863.1|  catalase isozyme 1                                 139   4e-35   Solanum tuberosum [potatoes]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 139   4e-35   Cucumis melo [Oriental melon]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          139   4e-35   Amborella trichopoda
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               139   4e-35   Solanum tuberosum [potatoes]
gb|AEQ30070.1|  catalase                                                138   4e-35   Litchi chinensis [litchi]
ref|XP_010437527.1|  PREDICTED: catalase-2                              138   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         138   5e-35   Camelina sativa [gold-of-pleasure]
gb|AAM97541.1|  catalase 2                                              138   5e-35   Capsicum annuum
gb|AHF27429.1|  catalase                                                138   6e-35   Cucurbita moschata [ayote]
gb|AHF27432.1|  catalase                                                138   6e-35   Cucurbita maxima [Boston marrow]
gb|ACJ73906.1|  CAT2                                                    135   7e-35   Solanum nigrum
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      138   7e-35   Cucumis melo [Oriental melon]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               138   8e-35   Cucurbita pepo
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               137   8e-35   Cucurbita pepo
gb|ACJ76836.3|  catalase                                                137   9e-35   Dimocarpus longan [longan]
gb|AAF61732.1|AF243517_1  catalase 2                                    137   1e-34   Helianthus annuus
gb|AAC19397.1|  leaf catalase                                           137   1e-34   Mesembryanthemum crystallinum
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              137   1e-34   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 137   1e-34   
gb|AHA50082.1|  catalase                                                137   1e-34   Eleutherococcus senticosus
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         137   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 137   1e-34   
gb|ADM96039.1|  catalase                                                137   1e-34   Cucumis sativus [cucumbers]
gb|AFN81243.1|  catalase 1                                              137   2e-34   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 137   2e-34   Oryza brachyantha
gb|AAD17933.1|  catalase                                                136   2e-34   Brassica juncea [brown mustard]
emb|CAA42026.1|  catalase                                               127   2e-34   Ricinus communis
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    136   3e-34   Oryza sativa Indica Group [Indian rice]
gb|ABK24453.1|  unknown                                                 136   3e-34   Picea sitchensis
ref|NP_001048861.1|  Os03g0131200                                       136   3e-34   
gb|AAG61140.2|AF332973_1  catalase 2                                    136   3e-34   Zantedeschia aethiopica [arum-lily]
gb|AAY59707.1|  catalase                                                136   3e-34   Oryza sativa Indica Group [Indian rice]
dbj|BAA34205.1|  catalase                                               136   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    136   3e-34   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       135   3e-34   Cucumis sativus [cucumbers]
emb|CDY01363.1|  BnaA07g11360D                                          136   3e-34   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 136   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      136   3e-34   Fragaria vesca subsp. vesca
ref|XP_009103333.1|  PREDICTED: catalase-1                              136   3e-34   Brassica rapa
gb|AFW69584.1|  catalase1                                               134   3e-34   
emb|CDY31877.1|  BnaC07g15270D                                          136   3e-34   Brassica napus [oilseed rape]
dbj|BAA34714.1|  catalase                                               135   4e-34   Oryza sativa [red rice]
gb|AHF21552.1|  catalase                                                135   6e-34   Hylocereus undatus [dragon fruit]
gb|ADU56199.1|  catalase                                                135   6e-34   Hevea brasiliensis [jebe]
gb|AAZ29552.1|  catalase-C                                              135   6e-34   Oryza sativa Indica Group [Indian rice]
dbj|BAA05494.1|  catalase                                               135   7e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AIU99481.1|  catalase                                                135   7e-34   Saccharum spontaneum [fodder cane]
gb|AIU99480.1|  catalase                                                135   7e-34   Saccharum spontaneum [fodder cane]
gb|AIM43584.1|  catalase                                                135   7e-34   Saccharum hybrid cultivar Yacheng05-179
dbj|BAA34204.1|  catalase                                               135   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       135   8e-34   
gb|AIU99484.1|  catalase                                                135   8e-34   Saccharum arundinaceum
gb|AIU99485.1|  catalase                                                135   8e-34   Saccharum spontaneum [fodder cane]
gb|AIU99488.1|  catalase                                                135   8e-34   Saccharum hybrid cultivar ROC22
ref|NP_564121.1|  catalase 1                                            135   8e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17731.1|  catalase 1                                              135   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 137   1e-33   
gb|AIU99479.1|  catalase                                                134   1e-33   Saccharum arundinaceum
emb|CAA42720.1|  catalase-1                                             134   1e-33   
ref|NP_001241808.1|  catalase isozyme B                                 134   1e-33   
gb|ACL35349.1|  catalase                                                134   1e-33   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             134   2e-33   
gb|AIU99482.1|  catalase                                                133   3e-33   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          133   4e-33   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    133   4e-33   
gb|ADU56198.1|  catalase                                                132   5e-33   
emb|CAG23920.1|  catalase                                               132   5e-33   
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         132   6e-33   
dbj|BAJ87148.1|  predicted protein                                      130   6e-33   
ref|NP_001105415.1|  catalase isozyme 1                                 132   7e-33   
gb|AIU99486.1|  catalase                                                132   8e-33   
gb|EMT05040.1|  Catalase-1                                              132   1e-32   
gb|ABY21704.1|  catalase-1 precursor                                    132   1e-32   
gb|AAB07026.1|  catalase 1                                              132   1e-32   
ref|XP_010692546.1|  PREDICTED: catalase                                131   1e-32   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       131   1e-32   
gb|AIU99483.1|  catalase                                                131   1e-32   
gb|AIU99487.1|  catalase                                                131   1e-32   
gb|ABQ44283.1|  catalase                                                129   2e-32   
ref|XP_003558892.1|  PREDICTED: catalase-1                              131   2e-32   
gb|ABB72796.1|  catalase isozyme 1-like protein                         131   2e-32   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 131   2e-32   
gb|AAC17729.1|  catalase 1                                              130   3e-32   
gb|AAC19398.1|  root catalase                                           130   3e-32   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             130   3e-32   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         130   3e-32   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               130   4e-32   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      130   5e-32   
dbj|BAJ90861.1|  predicted protein                                      130   5e-32   
dbj|BAJ88747.1|  predicted protein                                      130   5e-32   
gb|AIP93616.1|  CAT1                                                    129   6e-32   
gb|AFD29285.1|  catalase                                                129   6e-32   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            129   6e-32   
dbj|BAH37035.1|  catalase 1                                             129   6e-32   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      129   7e-32   
gb|AAK67359.2|AF390210_1  catalase                                      129   7e-32   
gb|ABV55108.1|  catalase 2                                              129   8e-32   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      129   1e-31   
gb|ACN36234.1|  unknown                                                 127   1e-31   
gb|AHB72694.1|  catalase                                                128   1e-31   
gb|AIZ77475.1|  catalase                                                128   2e-31   
gb|ADK25939.1|  catalase                                                124   2e-31   
emb|CAE82295.1|  catalase                                               128   2e-31   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         128   3e-31   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               127   3e-31   
gb|KHG21219.1|  Catalase isozyme 1                                      127   3e-31   
emb|CDY31866.1|  BnaC07g15160D                                          122   6e-31   
tpg|DAA43177.1|  TPA: catalase2                                         127   6e-31   
prf||1803522A  catalase                                                 126   7e-31
ref|NP_001105310.1|  catalase isozyme 2                                 126   8e-31   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               126   8e-31   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             126   9e-31   
gb|ACH63223.1|  catalase                                                125   1e-30   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         125   2e-30   
ref|NP_001031073.1|  catalase 3                                         125   2e-30   
gb|AAF61733.1|AF243518_1  catalase 3                                    125   2e-30   
emb|CDY29518.1|  BnaA06g14520D                                          125   3e-30   
emb|CDY31490.1|  BnaC05g15990D                                          125   3e-30   
ref|XP_009149540.1|  PREDICTED: catalase-1                              125   3e-30   
tpg|DAA43178.1|  TPA: catalase2                                         125   3e-30   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             124   4e-30   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         124   7e-30   
gb|ADN94253.1|  catalase                                                123   1e-29   
ref|XP_010477308.1|  PREDICTED: catalase-1                              122   2e-29   
dbj|BAD07937.1|  catalase catA-like protein                             117   2e-29   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             122   3e-29   
gb|AAF61734.1|AF243519_1  catalase 4                                    122   3e-29   
gb|AJF34884.1|  catalase                                                121   7e-29   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      120   1e-28   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      119   3e-28   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   119   7e-28   
ref|XP_001779509.1|  predicted protein                                  118   9e-28   
dbj|BAJ92414.1|  predicted protein                                      117   1e-27   
gb|ADY02963.1|  catalase                                                117   1e-27   
gb|AAC17730.1|  catalase 2                                              116   2e-27   
gb|EMS51034.1|  Catalase isozyme 2                                      117   2e-27   
emb|CAH61266.1|  catalase                                               117   2e-27   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               116   3e-27   
ref|NP_001045673.1|  Os02g0115700                                       116   4e-27   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          116   4e-27   
gb|ACL81498.1|  catalase                                                116   4e-27   
gb|AAX88799.1|  catalase                                                116   5e-27   
gb|EMT06167.1|  Catalase isozyme 2                                      117   7e-27   
gb|ABN71233.2|  catalase                                                115   8e-27   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 114   2e-26   
ref|XP_010105996.1|  Catalase isozyme 1                                 113   2e-26   
dbj|BAH56915.1|  AT1G20620                                              114   3e-26   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    114   3e-26   
gb|ADQ28492.1|  catalase                                                113   4e-26   
gb|ABY68159.1|  catalase                                                107   5e-26   
gb|ABY68162.1|  catalase                                                107   6e-26   
gb|AFI48101.1|  catalase isozyme B                                      107   7e-26   
gb|ABY68160.1|  catalase                                                107   7e-26   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              112   8e-26   
gb|ABY68158.1|  catalase                                                107   8e-26   
gb|AFI48111.1|  catalase isozyme B                                      106   9e-26   
gb|ABY68164.1|  catalase                                                106   1e-25   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             112   1e-25   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             105   2e-25   
gb|AFI48054.1|  catalase isozyme B                                      105   2e-25   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      111   2e-25   
gb|ABY68161.1|  catalase                                                105   3e-25   
gb|AFI48131.1|  catalase isozyme B                                      105   4e-25   
emb|CDY43951.1|  BnaC04g21590D                                          107   6e-25   
dbj|BAH19523.1|  AT4G35090                                              110   6e-25   
ref|NP_001031791.1|  catalase 2                                         110   6e-25   
gb|AFI48068.1|  catalase isozyme B                                      104   7e-25   
gb|AFI48098.1|  catalase isozyme B                                      103   1e-24   
gb|AGI65617.1|  catalase                                                108   1e-24   
gb|ABY68163.1|  catalase                                                102   3e-24   
ref|XP_001752315.1|  predicted protein                                  108   3e-24   
gb|AFI48130.1|  catalase isozyme B                                      102   4e-24   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          107   5e-24   
gb|AFN85536.1|  catalase                                                100   5e-24   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          107   7e-24   
ref|XP_005645077.1|  catalase                                           107   9e-24   
gb|ABK24449.1|  unknown                                                 106   1e-23   
gb|ABR25882.1|  catalase isozyme b                                    99.0    2e-23   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           105   3e-23
emb|CAA43814.1|  catalase                                               105   3e-23   
gb|AGT16203.1|  catalase                                                105   4e-23   
ref|XP_001784759.1|  predicted protein                                  104   6e-23   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      104   7e-23   
gb|AAY34915.1|  catalase                                              95.9    2e-22   
gb|EMS61345.1|  Catalase isozyme 1                                      104   2e-22   
gb|AFW66787.1|  catalase3                                               102   6e-22   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               102   6e-22   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656           98.2    6e-22   
gb|ABR16304.1|  unknown                                                 100   1e-21   
gb|ABK24543.1|  unknown                                                 100   2e-21   
gb|AHZ13843.1|  catalase                                                100   2e-21   
gb|AGT16188.1|  catalase                                                100   3e-21   
gb|AGT16054.1|  catalase                                                100   3e-21   
gb|AGT15888.1|  catalase                                                100   3e-21   
gb|AGT16310.1|  catalase                                                100   3e-21   
gb|AFW66785.1|  catalase3 isoform 1                                     100   7e-21   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817            97.1    4e-20   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            90.1    5e-20   
gb|KIY96954.1|  catalase                                              94.4    1e-19   
gb|AII23739.1|  catalase                                              95.5    1e-19   
ref|NP_001105416.1|  catalase isozyme 3                               92.4    2e-18   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                   92.0    2e-18   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                      92.0    3e-18   
gb|ABK41476.1|  catalase                                              89.7    2e-17   
ref|XP_011396830.1|  Catalase isozyme 2                               89.0    3e-17   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1    86.7    2e-16   
ref|XP_002950455.1|  catalase                                         84.3    1e-15   
gb|AEY70510.1|  catalase                                              82.0    2e-15   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           80.1    3e-15   
gb|AFW66789.1|  catalase3                                             80.9    4e-15   
ref|XP_001696763.1|  catalase/peroxidase                              82.4    5e-15   
ref|XP_005708279.1|  catalase                                         82.4    5e-15   
gb|AID50071.1|  catalase                                              77.4    1e-14   
gb|AFW66788.1|  catalase3                                             80.9    2e-14   
emb|CAA73663.1|  catalase                                             80.1    3e-14   
gb|AAB70006.1|  catalase                                              79.3    7e-14   
ref|XP_002980255.1|  hypothetical protein SELMODRAFT_112561           72.4    2e-13   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1            66.2    9e-13   
gb|EMS35721.1|  Catalase isozyme 1                                    73.2    2e-12   
ref|XP_005536240.1|  catalase                                         70.9    4e-11   
gb|ABB88582.1|  catalase                                              69.3    1e-10   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g           68.9    2e-10   
gb|KDD77132.1|  catalase                                              68.6    2e-10   
gb|AAR84577.1|  catalase 1b                                           67.8    4e-10   
gb|KJE89728.1|  catalase isozyme 2                                    67.4    7e-10   
ref|XP_004366029.2|  catalase isozyme 2                               67.4    8e-10   
gb|KJB10391.1|  hypothetical protein B456_001G198700                  66.2    1e-09   
dbj|BAK04899.1|  predicted protein                                    61.2    1e-09   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)          65.5    2e-09
ref|XP_005712277.1|  unnamed protein product                          63.5    1e-08   
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                   62.0    2e-08   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1    62.4    3e-08   
gb|KJB17474.1|  hypothetical protein B456_003G002800                  62.0    3e-08   
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                   61.6    4e-08   
gb|AGS17821.1|  catalase 2                                            48.5    1e-07   
ref|WP_033543820.1|  catalase                                         58.2    7e-07   
ref|XP_005644653.1|  catalase-domain-containing protein               55.8    4e-06   
emb|CAB64452.1|  catalase                                             50.4    8e-06   
ref|XP_005647994.1|  catalase-domain-containing protein               55.1    8e-06   
ref|WP_044037961.1|  catalase                                         53.5    2e-05   
ref|WP_034418237.1|  catalase                                         53.1    3e-05   
ref|WP_026673818.1|  catalase                                         52.4    5e-05   
ref|WP_036650771.1|  catalase                                         52.4    6e-05   
ref|WP_043193175.1|  catalase                                         52.4    6e-05   
emb|CEG24228.1|  Vegetative catalase                                  51.6    9e-05   
ref|WP_036802832.1|  catalase                                         51.6    1e-04   
ref|WP_024631056.1|  MULTISPECIES: catalase                           51.6    1e-04   
ref|WP_036674944.1|  catalase                                         51.6    1e-04   
ref|WP_040712563.1|  catalase                                         51.2    1e-04   
gb|EFM10689.1|  Catalase                                              51.2    1e-04   
ref|XP_010320460.1|  PREDICTED: catalase isozyme 3-like               48.9    1e-04   
ref|WP_032664185.1|  catalase                                         50.8    2e-04   
ref|WP_043830984.1|  catalase                                         50.8    2e-04   
ref|WP_027955028.1|  catalase                                         50.4    2e-04   
ref|WP_041058476.1|  catalase                                         50.4    2e-04   
ref|WP_036614478.1|  catalase                                         50.4    3e-04   
ref|WP_032632526.1|  catalase                                         50.1    3e-04   
ref|WP_028549611.1|  catalase                                         50.1    3e-04   
ref|WP_015735444.1|  catalase                                         50.1    3e-04   
ref|WP_009593853.1|  catalase                                         50.1    3e-04   
ref|WP_006256937.1|  MULTISPECIES: catalase                           49.7    4e-04   
emb|CCQ26769.2|  perixode catalase                                    46.2    4e-04   
gb|KIQ35234.1|  catalase                                              49.7    4e-04   
ref|WP_043304355.1|  catalase                                         49.7    4e-04   
ref|WP_032610664.1|  catalase                                         49.3    5e-04   
ref|WP_004887231.1|  catalase                                         49.3    6e-04   
ref|WP_026826608.1|  catalase                                         48.9    7e-04   
ref|WP_006679508.1|  catalase                                         48.9    8e-04   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            RNAER PTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVT
Sbjct  82   RNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVT  141

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  142  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            RNAER PTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVT
Sbjct  401  RNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  461  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            RNAER PTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVT
Sbjct  401  RNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  461  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   153 bits (387),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  IVTG+R++C+IEKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVT
Sbjct  40   RHAERFPIPPAIVTGKRERCIIEKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVT  99

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  100  HEIRSIWISYLSQADRSLGQKVASHLNMRPSI  131



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P PLR++TG+RDKC++EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEQYPIPLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKIASRLNIRPTM  492



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+A+R P P  IVTG+R++C+IEKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVT
Sbjct  44   RHAKRFPIPPAIVTGKRERCIIEKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVT  103

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  104  HEIRSIWISYLSQADRSLGQKVASHLNMRPSI  135



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD++LGQK+ASRLN+RPTM
Sbjct  461  HEIRSIWISYWSQADKTLGQKIASRLNVRPTM  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVT
Sbjct  332  RHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVT  391

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  392  HEIRSVWISYWSQADKSLGQKLASRLNVRPSI  423



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P +I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVT
Sbjct  401  RHAERYPIPPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN++P+M
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            RNAER P P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RNAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  ++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS W SY +QAD++LGQK+ASRLN+RPTM
Sbjct  461  HEIRSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVT
Sbjct  401  RHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P RI+TGRR+KCVI KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT
Sbjct  401  RHAERFPIPFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIR+ WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  461  YEIRTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVT
Sbjct  401  RHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P +IVTG+R+K +IEKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+EPRVT
Sbjct  401  RHAERYPIPSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE RS WISY TQAD+SLGQK+ASRL+ RP+M
Sbjct  461  HEHRSIWISYWTQADKSLGQKLASRLSARPSM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVT
Sbjct  401  RHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  461  HEIRIIWISYWSQADKSLGEKIASRLNVRPTM  492



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  54   RCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  113

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  114  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  145



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + TG+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S+PRVT
Sbjct  401  RHAERFPIPPALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVT
Sbjct  401  RHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI + WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  461  HEIHTIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I+ G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPIPSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++ G+RD+C+I+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LSEPRVT
Sbjct  401  RHAEQYPIPPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR+ W+SY +QAD+SLGQK+ASRLN++PTM
Sbjct  461  HEIRTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  ++TG+RD+C+IEKENNFKQPG+RYR++APDRQ+RF+ RWV +LS+PRVT
Sbjct  401  RHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  461  HEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PRVT
Sbjct  401  RPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  +++G+RDKCVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+ RVT
Sbjct  401  RHAERHPIPPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT
Sbjct  401  RHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT
Sbjct  401  RHAETFPIPSNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  461  YEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT
Sbjct  401  RHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVT
Sbjct  386  RHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVT  445

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  446  HEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVT
Sbjct  401  RHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  461  HEVRSIWISYWSQADKSLGQKLASHLNVRPSI  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER+P P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+T
Sbjct  170  RHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRIT  229

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  230  HEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  261



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVT
Sbjct  401  RHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  461  HEVRSIWISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVT
Sbjct  402  RHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVT  461

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  462  HEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER+P P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+T
Sbjct  179  RHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRIT  238

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  239  HEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  270



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PR T
Sbjct  401  RPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRAT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA10286.1| catalase [Cicer arietinum]
Length=125

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER PTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVT
Sbjct  34   RHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVT  93

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  94   HEVRSIWISYWSQADRSLGQKIASHLNMRPSI  125



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  I  G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVT
Sbjct  401  RHAEQHPIPSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CBI29556.3| unnamed protein product [Vitis vinifera]
 emb|CBI37653.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   141 bits (355),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT
Sbjct  21   RHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVT  80

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRP  283
            +EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  81   YEIRSIWISYWSQADRSLGQKLASRLNVKP  110



>dbj|BAD94702.1| catalase [Arabidopsis thaliana]
Length=108

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+T
Sbjct  17   RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRIT  76

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  77   HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  108



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT
Sbjct  401  RHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  461  YEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TG+R+K +IEKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS+PR T
Sbjct  401  RHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRAT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVT
Sbjct  253  RHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVT  312

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  313  HEIRSIWISYWSQADKSVGQKLASRLNVRPSI  344



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TG R++C IEKENNFKQPG+RYRS+APDRQDRF+ RWV +LS+PRVT
Sbjct  401  RHAERYPIPPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRSTWISY +QADRSLGQK+AS LN+RP++
Sbjct  461  HEIRSTWISYWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT
Sbjct  401  RHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  461  YEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P RI+TGRR+KCVI+KENNFKQPG+RYRSW PDRQ RFI RWV++LS+PRVT
Sbjct  401  RHAERCPIPSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI+S WISY +Q D+SLG+K+A+RLN++P+M
Sbjct  461  HEIQSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVT
Sbjct  217  RHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVT  276

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  277  HEIRSVWISYWSQADRSLGQKIASRLSMRPNI  308



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P RI TG+R+KCVIEKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS+PRVT
Sbjct  401  RHAERFPIPPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+A+RLN++P+M
Sbjct  461  HEIRSIWISYWSQADKSLGQKLATRLNVKPSM  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++LS+PRVT
Sbjct  401  RHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVT
Sbjct  401  RHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  461  HEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P RI+TGRR+KCVI KENNFKQPG+RYRSW P+RQ+RFI RWV++LS+PRVT
Sbjct  401  RHAERFPIPSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI+S WISY +Q D+SLGQK+A+RLN++P M
Sbjct  461  HEIQSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT
Sbjct  292  RHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVT  351

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  352  YEIRSIWISYLSQADKSCGQKVASRLTLKPTM  383



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVT
Sbjct  401  RHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT
Sbjct  401  RHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  461  QEIRSIWISYWTQADKSLGQKIASCLNVRPSM  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSE RVT
Sbjct  401  RHAETFPIPSSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  461  YEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  +VTGRR+K +I KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT
Sbjct  401  RHAERFPIPSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +Q D+SLGQK+A+RLN++PTM
Sbjct  461  HEIRDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KCVI+KENNFKQPGDRYRSWAPDRQDRFI RWV+ LSEPR+T
Sbjct  401  RCAEKVPVPSKSYTGIRTKCVIKKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  465  RCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  524

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  525  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  556



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  409  RCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  468

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  469  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  500



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P+P  I +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS+ R T
Sbjct  401  RHAERFPSPPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP+ 
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSF  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT
Sbjct  493  RHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVT  552

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  553  QEIRSIWISYWTQADKSLGQKIASCLNVRPSM  584



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  452  RCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  511

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  512  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  543



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT
Sbjct  401  RHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  YEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVT
Sbjct  401  RPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLLVKPTM  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + TG+R++CVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPHPPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  461  HEIRSIWISYWSQADRSVGQKLASHLNMRPSI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++ S+PRVT
Sbjct  401  RHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE++P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKAPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I+TGRR+KC+I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PR T
Sbjct  401  RHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRAT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS W+SY +QAD+SLGQK+AS LN+RPTM
Sbjct  461  HEIRSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>gb|AFK46618.1| unknown [Lotus japonicus]
Length=112

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TG R++C +EKEN+FKQPG+RYRS+APDRQDRF+ RWV +LS+PRVT
Sbjct  21   RHAERYPIPPAICTGSRERCAVEKENDFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVT  80

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRS GQK+A  LN+ P++
Sbjct  81   HEIRSAWISYWSQADRSFGQKIAFHLNLGPSI  112



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT
Sbjct  401  RHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  YEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT
Sbjct  401  RHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  YEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS W+SY +QAD+SLGQK+ASRLN+RP M
Sbjct  461  HEIRSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P +IVTG+R++ +IEKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LSEPRVT
Sbjct  401  RHAERYPIPSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE RS WISY TQAD+S+GQK+AS L+ RP+M
Sbjct  461  HEHRSIWISYWTQADKSIGQKLASSLSARPSM  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  286  RCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  345

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  346  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  377



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  ++TGRR+KCVI KENNFKQPG+RYRSWAPDRQ RFI RWV++LS+PRVT
Sbjct  401  RHAETFPIPSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  461  YEIRSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P R++TGRR++ VIEKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS+PR+T
Sbjct  401  RHAERHPIPTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+A RLN+RPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSVGQKLASRLNVRPSI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + TGRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS+PRVT
Sbjct  401  RHAERFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI S WISY TQ D+ LGQK+A+RLN+RP++
Sbjct  461  HEICSIWISYWTQCDKFLGQKLATRLNVRPSI  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R++ER P P  I +GRRDKCVIEKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS+PR+T
Sbjct  401  RHSERFPIPSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WISY TQ DRSLGQK+A RLN+RP++
Sbjct  461  HELRSIWISYWTQCDRSLGQKLAFRLNVRPSI  492



>gb|ABS72010.1| putative catalase, partial [Olea europaea]
Length=86

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  PTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRST  355
            P P  I+TGRR++ +IEKENNFK+PG+RYRSW P RQ+RFI +WV +LS+PRVTHEIRS 
Sbjct  1    PIPSAILTGRRERRIIEKENNFKEPGERYRSWDPARQERFIRKWVDALSDPRVTHEIRSI  60

Query  354  WISYLTQADRSLGQKVASRLNIRPTM  277
            WISY +QADRSLGQK+ASRLN+RPTM
Sbjct  61   WISYCSQADRSLGQKLASRLNVRPTM  86



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  +++G+RD+C IEKENNFKQPG+RYR+++PDRQ+RFI RWV +LS+PR+T
Sbjct  401  RHAEKHPIPPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVT
Sbjct  401  RHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS L+ RP +
Sbjct  461  HEIRSVWISYWSQADRSLGQKIASHLSTRPNI  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  367  RCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  426

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  427  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  458



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERFPIPPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WI+Y +QA +SLGQK+ASRLN++P +
Sbjct  461  HEIRSIWITYWSQACKSLGQKLASRLNVKPNI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I +GRR++C+IEKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS+PR+T
Sbjct  401  RHAERYPIPPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADQSLGQKLASRLNVRPSI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVT
Sbjct  401  RHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  461  HEIRSVWISYWSQADRSLGQKIASRLSMRPNI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVT
Sbjct  401  RHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  461  HEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVT
Sbjct  401  RHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  461  HEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++ GRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT
Sbjct  401  RHAEQYPIPSRVLNGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  YEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TGRR++ VI+KENNFKQPG+RYRS++PDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPIPSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  400  RHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRIT  459

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  460  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P   + G+RD+  IEKENNFKQPG++YRS+ PDRQ+RFI RWV +LS+PR+T
Sbjct  174  RHAERFPHPPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLT  233

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS W+SY TQAD+SLGQK+ASRLNIRPTM
Sbjct  234  HEIRSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P RI+ G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVT
Sbjct  401  RHAEKVPVPPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  461  HEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ GRR  CVI KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVT
Sbjct  401  RPAEQYPIPSCVLNGRRTNCVIPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  461  HEIRSIWISYWSQADRSVGQKLASHLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVT
Sbjct  401  RHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVT
Sbjct  401  RHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+S+GQK+AS LN+RP++
Sbjct  461  HEIRSIWISYWSQADKSVGQKLASLLNVRPSI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  ++ GRR+KC+I KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS+PRVT
Sbjct  401  RHAEKYPIPPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR+ W++Y  QAD+SLGQK+ASRLN+RP M
Sbjct  461  HEIRAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  461  HEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  461  HEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  421  RHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  480

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  481  HEIRHIWISYWSQACKSLGQKLASRLNVRPNI  512



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEKYPIPSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIR+ WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRTIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008365914.1| PREDICTED: catalase isozyme 3-like [Malus domestica]
Length=108

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  525  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  346
            L +V     +CVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WIS
Sbjct  26   LCMVVSLEMQCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  85

Query  345  YLTQADRSLGQKVASRLNIRPTM  277
            Y +QADRS GQK+ASRLN+RP++
Sbjct  86   YWSQADRSFGQKLASRLNVRPSI  108



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVT
Sbjct  342  RHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVT  401

Query  372  HEIRSTWISYLTQADRSLGQKVASRLN  292
            HEIRS WISY +QADRSLGQK+AS LN
Sbjct  402  HEIRSIWISYWSQADRSLGQKIASHLN  428



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVT
Sbjct  253  RHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVT  312

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  313  HEIRSIWISYWSQADRSLGQKLASHLNVRPSI  344



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R++E  P P  +++G+R+K  IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHSEMYPIPPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  389  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  448

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  480



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TG+R+K +IEKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS+ R T
Sbjct  401  RHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRAT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WI+Y +QADRS+GQK+AS LN+RP++
Sbjct  461  HEIRSIWITYWSQADRSVGQKLASHLNVRPSI  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P R + G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVT
Sbjct  401  RHAERVPVPPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  461  HEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  394  RHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRIT  453

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  454  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  485



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  400  RHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  459

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNI  289
            HEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  460  HEIRSIWISYWSQADKSLGQKLASRLNV  487



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P RI+ G R+KC I+KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS+PRVT
Sbjct  401  RHAEQFPIPPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR+ WI+Y +Q D+ LGQK+ASRLNI+PT+
Sbjct  461  HEIRTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            RNAE  P P  I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+T
Sbjct  401  RNAESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+R+ WISY  Q D+SLGQK+A+RLN++P++
Sbjct  461  HELRTIWISYWIQCDKSLGQKLATRLNVKPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVT
Sbjct  401  RHAEKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  461  HEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  400  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  459

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  460  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  +++G+R K VIEKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS+PR+T
Sbjct  422  RHAEKFPIPPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLT  481

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             EIRS W+SY TQAD+SLGQK+ASRLN+RP M
Sbjct  482  AEIRSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KC+I+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPIPNKSYTGIRTKCIIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADASLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P   RIVTGRR+KC+IEK+N+FKQPGDRYRSWA DRQ+RF+ RWV++L+ P+V+
Sbjct  401  RHAERYPINNRIVTGRREKCIIEKQNDFKQPGDRYRSWAHDRQERFVRRWVEALAHPKVS  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS W+SYL+++D SLGQKVA+RLN++P+M
Sbjct  461  HEVRSIWVSYLSKSDVSLGQKVANRLNMKPSM  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER PTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVT
Sbjct  402  RHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVT  461

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  462  HEVRSIWISYWSQADRSLGQKIASHLNMRPSI  493



>ref|XP_008348923.1| PREDICTED: catalase isozyme 3-like [Malus domestica]
Length=103

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  525  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  346
            L +V     +CVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WIS
Sbjct  21   LCMVVWLDMQCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  80

Query  345  YLTQADRSLGQKVASRLNIRPTM  277
            Y +QADRS GQK+ASRLN+RP++
Sbjct  81   YWSQADRSFGQKLASRLNVRPSI  103



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER PTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVT
Sbjct  401  RHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  461  HEVRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R++C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVT
Sbjct  359  RHAESFPIPPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVT  418

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNI  289
            HEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  419  HEIRSIWISYWSQADKSLGQKLASRLNV  446



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT
Sbjct  401  RHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRP  283
            +EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  461  YEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT
Sbjct  401  RHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRP  283
            +EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  461  YEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+T
Sbjct  386  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRIT  445

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  446  HEIRSIWISYWSQADKTLGQKLASRLNVRPSI  477



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  394  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  453

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  454  HEIRSIWISYWSQADKSLGQKLASRLNVRPNI  485



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 81/92 (88%), Gaps = 1/92 (1%)
 Frame = -1

Query  549  NAERSPTPLRIVTG-RRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            NAER P P ++ +  +R+KC+IEK+N+FKQPG+RYR++ PDRQ+RFINRWVK+LSEPR+T
Sbjct  79   NAERYPIPTKVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQERFINRWVKALSEPRIT  138

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WI +L++AD SLG+KVA RLNIRP++
Sbjct  139  HEIRSIWIDWLSRADESLGRKVAMRLNIRPSI  170



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+T
Sbjct  401  RHAEKVPIPNAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS W+S+ TQ D+SLGQK+ASRLN+RP +
Sbjct  461  HEIRSIWVSWWTQCDKSLGQKLASRLNVRPNI  492



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P ++ +G+R+KC+I+KENNFKQ G+RYR++ PDRQ+RF+ RWV+ LS+PR+T
Sbjct  77   RHAEIYPIPSKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQERFVRRWVEPLSDPRIT  136

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  137  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  168



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT
Sbjct  398  RHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVT  457

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WI  L+QAD+S GQKVASRL ++PTM
Sbjct  458  YEIRSIWICSLSQADKSCGQKVASRLTLKPTM  489



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + +GRR++C+IEKENNFKQPG+RYRS+ PDR++RFI RW+++LS+PR+T
Sbjct  401  RHAERYPVPSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASR+N+RP +
Sbjct  461  HEIRSIWISYWSQADQSLGQKLASRMNVRPNI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI+KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEKYPIPSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS+PRVT
Sbjct  401  RPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYINKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  ++TGRRD+ VIEKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS+PR+T
Sbjct  401  RHAERHPIPNAVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             EIRS W+SY +QAD+S GQK+ASRLN+RPTM
Sbjct  461  LEIRSIWVSYWSQADKSFGQKLASRLNVRPTM  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+
Sbjct  401  RHAERFPIPSRVVTGKREKTVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVS  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  461  HELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  440  RCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  499

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPT  280
            HEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  500  HEIRGIWISYWSQADRSLGQKLASRLNVRPS  530


 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552   RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
             R+AE+ PT   + +G R+KC I KENNFKQPG+RYRSW  DRQ+RF+ R+V++LSEPRVT
Sbjct  922   RHAEKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVT  981

Query  372   HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             HEIRS WISY +QAD+SLGQK+A+RLN+RP  
Sbjct  982   HEIRSIWISYWSQADKSLGQKLATRLNVRPNF  1013



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+
Sbjct  401  RHAERFPIPSRVVTGKREKIVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVS  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  461  HELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P +  TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSE R+T
Sbjct  401  RCAEKVPIPSKSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  I +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLANRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKTLGQKLASRLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVT
Sbjct  385  RHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVT  444

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY +QA +SLGQK+ +RLN+RP++
Sbjct  445  HEIRHIWISYWSQACKSLGQKLTARLNVRPSI  476



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT
Sbjct  399  RHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVT  458

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  459  YEIRSIWISYWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT
Sbjct  401  RHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASHLNMRPSI  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  ++TGRR+K VI KENNFKQPG+RYRS+ PDR+DRFI RWV++LS+PRVT
Sbjct  401  RHAEKYPIPPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  461  YEIRSIWISYWSQADKSLGQKIASHLNMRPTM  492



>prf||1906388A catalase
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + TG+R+KCVI+KENNF QPG+RYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEKYPIPSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++C+IEKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+EPRVT
Sbjct  401  RHAEKYPTPPAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRP  283
            HEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  461  HEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+A R P P  ++ G+RD+CVI KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS+ RVT
Sbjct  401  RHAARHPIPSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  461  HEIRSIWISYWSQADKSLGQKMATRLNVRPTM  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVT
Sbjct  401  RHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P ++V+G+R++CVIEKENNFKQPGDRYRS+APDRQ+RF+ R V +LS+ RVT
Sbjct  401  RHAERCPLPPQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +Q D+SLGQK+A+RLNI+P M
Sbjct  461  HEIRSIWISYWSQCDKSLGQKIATRLNIKPHM  492



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  ++TGRR+K +I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT
Sbjct  378  RHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVT  437

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLNIRP++
Sbjct  438  YEIRSIWISYWSQADKSLGQKLASRLNIRPSI  469



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P R++TG+R+KC+I KENNFKQPG+RYRS++PDRQ+RFI RWV++LS+P+VT
Sbjct  401  RHAERFPIPTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +Q D+SL QK+A+RL+++P+M
Sbjct  461  HEIRSIWISYWSQCDKSLSQKLATRLSVKPSM  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  ++TGRR+K +I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLNIRP++
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASRLNIRPSI  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I+TG+R++ VIEKENNFKQPG+RYRSWAPDRQ+RFI R V +LS+PRV+
Sbjct  401  RHAERFPIPSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVS  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKIATRLNVRPSI  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  401  RCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  W SY  +ADRSLGQK+ASRLN+RP++
Sbjct  461  HEIRGIWTSYWLKADRSLGQKLASRLNVRPSI  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AERSP P  I +GRR+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+ R V +LSEPR+T
Sbjct  401  RHAERSPIPNAICSGRREKCVIEKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             EIRS W+SY ++ D SLGQK+ASRLN+RP +
Sbjct  461  FEIRSIWVSYWSKCDASLGQKLASRLNVRPNI  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AER P P  I+ GRR+K +I KENNFK+PG RYRSW P RQDRF+ R+VK+LS+PR+T
Sbjct  401  REAERFPIPTAIIHGRREKQIIPKENNFKEPGVRYRSWDPARQDRFVGRFVKALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS W+SYLTQAD+SLG KVASRLNIRPTM
Sbjct  461  YEIRSIWVSYLTQADKSLGMKVASRLNIRPTM  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P   + GRRD+ +IEKENNFKQPGD YR+WAPDRQ+RFI RW+  LS+P+VT
Sbjct  401  RHAEKFPIPPVNLIGRRDRRIIEKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+RS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  461  HEVRSIWISYLSQADRSLGQKVASHLNMRPSI  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENN-FKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  ++TG+R++CVI KENN FKQ GDRYRSWAPDRQDRF+ R+V++LS+PRV
Sbjct  400  RHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRV  459

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  460  THEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE++P P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+T
Sbjct  408  RCAEKAPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLT  467

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPT  280
            HEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  468  HEIRGIWISYWSQADRSLGQKLASRLNVRPS  498


 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PT   + TG R+KC I KENNF+QPG+RYRSW  DRQ+RF+ R+V++LSEPRVT
Sbjct  890  RHAEKYPTTPIVCTGNREKCFIGKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVT  949

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+A+RLN+RP  
Sbjct  950  HEIRSIWISYWSQADKSLGQKLATRLNVRPNF  981



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENN-FKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  ++TG+R++CVI KENN FKQ GDRYRSWAPDRQDRF+ R+V++LS+PRV
Sbjct  400  RHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRV  459

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  460  THEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  549  NAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTH  370
            NAE+ P P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT 
Sbjct  201  NAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTF  260

Query  369  EIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  261  EIRSIWVSYWSQADKSLGQKIASRLNVRPNI  291



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+T
Sbjct  401  RHAEKYPAPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+T
Sbjct  386  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRIT  445

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD++LGQK+AS LN+RP++
Sbjct  446  HEIRSIWISYWSQADKTLGQKLASHLNVRPSI  477



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  +++G+RD+  IEKENNFK+PG R+RSWA DRQ+RFI RWV +LS+PR+T
Sbjct  401  RHAERHPIPPVVLSGKRDRICIEKENNFKEPGVRFRSWATDRQERFIRRWVDALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  461  HEIRGIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT
Sbjct  385  RHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVT  444

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  445  YEIRSIWISYWSQADKSLGQKLASHLNMRPGI  476



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+R +RFI RW+ +LS+PR+T
Sbjct  358  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERLERFIGRWIDALSDPRIT  417

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  418  HEIRSIWISYWSQADKSLGQKLASRLNVRPNI  449



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + +G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+ RVT
Sbjct  401  RHAEKHPIPSTVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT
Sbjct  401  RHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT
Sbjct  420  RHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVT  479

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  480  YEIRSIWISYWSQADKSLGQKLASHLNMRPGI  511



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+A + P P  I +G R KCVIEKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS+ RVT
Sbjct  401  RHAAKYPIPSAICSGERVKCVIEKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             EIR  WISYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  461  DEIRGIWISYLSQSDKSLGMKVANRLNVRPSF  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  I +G+R+KC+I+KENNF+QPG+RYRS+APDRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEKYPIPTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY ++AD+SLGQK+ASRL++RP++
Sbjct  461  YEIRSIWISYWSKADKSLGQKLASRLSVRPSI  492



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVT
Sbjct  401  RPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVT
Sbjct  401  RPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVT
Sbjct  401  RHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRP  283
            HE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  461  HEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVT
Sbjct  400  RPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVT  459

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  460  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  491



>prf||2104177A catalase
Length=492

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVT
Sbjct  401  RHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRP  283
            HE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  461  HEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            RNAE  P P  I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+T
Sbjct  883  RNAESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRIT  942

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+R+ WISY  Q D+SLGQK+A+RLN++P++
Sbjct  943  HELRTIWISYWIQCDKSLGQKLATRLNVKPSI  974


 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+T
Sbjct  401  RHAEKVPIPNAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPT  280
            HEIRS W+S+ TQ D+SLGQK+ASRLN RP+
Sbjct  461  HEIRSIWVSWWTQCDKSLGQKLASRLNNRPS  491



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+I+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T
Sbjct  384  RHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRIT  443

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  444  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  475



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  I++GRR+KCVI KENNFKQPG+RYRSW PDRQ+RF+ R V +LS+PR+T
Sbjct  401  RHAERYPIPNAIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  W+SY +Q D+SLGQK+ASRLN+RP +
Sbjct  461  HEIRGIWVSYWSQCDQSLGQKLASRLNVRPNI  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVT
Sbjct  401  RPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRL  295
            HEIRS WISYL+QAD+S GQKVASRL
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRL  486



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVT
Sbjct  401  RHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  461  HEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+A++ P P    +GRR+K  IEKENNFKQPG+RYRSW PDRQ+RFI RWV +LS+PR+T
Sbjct  401  RHADKVPIPSVPFSGRREKVSIEKENNFKQPGERYRSWDPDRQERFIRRWVDALSDPRLT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
             EIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  461  QEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>gb|AAL00886.1| catalase [Suaeda salsa]
Length=287

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AER P P  I++GRR+K +I KENNFK+PGDRYRSW P RQ+RF+ R+VK+LS+PR+T
Sbjct  196  REAERHPIPTAIISGRREKQIIPKENNFKEPGDRYRSWDPARQERFVGRFVKALSDPRLT  255

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EI S W +YL+QAD+SLG KVASRLN+RPTM
Sbjct  256  YEICSIWETYLSQADKSLGMKVASRLNVRPTM  287



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVT
Sbjct  401  RHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  461  HEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P R++TG+R+KCVI KENNFKQPG+RYRS+ P RQ+RF++RWV++LS+ RVT
Sbjct  401  RHAERFPLPPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR  WI+Y +Q D+SLGQK+A+RLN+RP+M
Sbjct  461  HEIRGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P RI++G+R+KC+I KENNFKQPG+RYRS+ PDR++RFI RWV++L++ R+T
Sbjct  401  RHAEQHPIPPRILSGKREKCIILKENNFKQPGERYRSFTPDRKERFIRRWVEALTDTRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  461  YEIRSIWISYWSQADKSLGQKLASHLNMRPTM  492



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  +  G+R++CVIEKENNFK+PG+RYR + P+RQ+RFI RW+++LS+PR+T
Sbjct  389  RHAEKYPTPPAVCAGKRERCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRIT  448

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  449  HEIRSIWISYWSQADKSLGQKLASHLNVRPNI  480



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P    +  R+KC I K+NNFKQPG+RYRSWAPDRQDRF+ RWV +LS+PRVT
Sbjct  401  RHAEKVPIPTANFSACREKCNIPKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  461  HEIRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T
Sbjct  401  RHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  461  YEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P    TG+R+KCVIEKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS+PRVT
Sbjct  401  RHAERFPIPSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI S WISY +Q D+SLGQK+A+RLN++  M
Sbjct  461  HEICSIWISYWSQCDKSLGQKIAARLNMKANM  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVT
Sbjct  401  RPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
             +AER P P  + TG+R++CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVT
Sbjct  401  HHAERYPQPPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIR  286
            HEIR+ WISY +QAD+SLGQK+ASRLN++
Sbjct  461  HEIRNIWISYWSQADKSLGQKLASRLNVK  489



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P +I +G+R+KC+IEKENNFKQPG+RYRS+A DRQ+RFI RWV +LS+PRVT
Sbjct  401  RHAEKFPMPPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI S WISY +Q D+SLGQK+A+ LN++P M
Sbjct  461  HEILSIWISYWSQCDKSLGQKLATHLNLKPNM  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVT
Sbjct  401  RPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  461  HEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  549  NAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTH  370
            NAE+ P P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT 
Sbjct  397  NAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTF  456

Query  369  EIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  457  EIRSIWVSYWSQADKSLGQKIASRLNVRPNI  487



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE  P P  + +G+R+KC+I+KENNF+QPG+RYRS++ DRQ+RFI RWV++LS+PR+T
Sbjct  393  RHAENYPIPTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRIT  452

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            +EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  453  YEIRSIWISYWSQADKSLGQKLASRLNVRPSI  484



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +V
Sbjct  369  RHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKV  428

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  429  THEVRNIWISYWTQADRSLGQKIASRMNARPNM  461



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +V
Sbjct  369  RHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKV  428

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  429  THEVRNIWISYWTQADRSLGQKIASRMNARPNM  461



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R AE+ P P  ++ G R  CV  KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVT
Sbjct  224  RPAEQYPIPSCVLNGPRTMCVTPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVT  283

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI S WISYL+QAD+S GQKVASRL ++P M
Sbjct  284  HEIPSIWISYLSQADKSCGQKVASRLTVKPPM  315



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRV
Sbjct  400  RHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRV  459

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY +QADRSLGQK+ASR+N+RP++
Sbjct  460  THEVRNIWISYWSQADRSLGQKIASRMNVRPSI  492



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +V
Sbjct  400  RHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKV  459

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  460  THEVRNIWISYWTQADRSLGQKIASRMNARPNM  492



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENN-FKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  ++TG+R++CVI KENN FKQ GDRYRSWAPDRQDRF+ R+V++LS+PRV
Sbjct  400  RHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRV  459

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            T E+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  460  TDEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  549  NAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTH  370
            NAE+ P P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT 
Sbjct  402  NAEKFPIPSRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTF  461

Query  369  EIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            E+RS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  462  ELRSIWVSYWSQADKSLGQKIASRLNVRPNI  492



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+SP P  +++G+R+KCVIEKENNFKQPG+R+RSW PDRQ+RFI R V +LS+PRVT
Sbjct  401  RHAEQSPIPPVMLSGKRNKCVIEKENNFKQPGERFRSWDPDRQERFIRRIVGALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPT  280
            HE+ + W+SY +QAD+SLGQK+ASRLN++P+
Sbjct  461  HEVCTIWVSYWSQADKSLGQKIASRLNVKPS  491



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  ++ G RD+ +I+KENNFKQPG+RYRSW P RQ+RFI RWV +LS+PR+T
Sbjct  401  RHAERYPIPPNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIR+ WISY +QAD+S+G K+ASRLN+RPTM
Sbjct  461  HEIRNIWISYWSQADKSVGMKLASRLNVRPTM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 83/96 (86%), Gaps = 4/96 (4%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSE  385
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG RYRS+ PD    RQ+RFI RW+++LS+
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSD  460

Query  384  PRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  461  PRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRV
Sbjct  391  RHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRV  450

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  451  THEVRNIWISYWSQADRSLGQKIASRMNVRPNI  483



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P  ++TGRRD+C+++KENNFKQPG+RYRS++ DRQ+RFI+R V +LS+PRVT
Sbjct  401  RHAERHPLPPPMLTGRRDRCMVQKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY TQA +SLGQK+ASRLN++P++
Sbjct  461  HEIRSIWISYWTQACKSLGQKLASRLNVKPSI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P  + +G R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+T
Sbjct  401  RHAEKYPAPPAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  HEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRV
Sbjct  400  RHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRV  459

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  460  THEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRV  376
            R+AE+ P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRV
Sbjct  400  RHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRV  459

Query  375  THEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            THE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  460  THEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++L +PR+T
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEIRS WI Y +QAD++ GQK+ASRLN+RP++
Sbjct  461  HEIRSIWIFYWSQADKTFGQKLASRLNVRPSI  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TG R+KCVI KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PR+T
Sbjct  401  RHAEKVPVPPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  461  HELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 84/96 (88%), Gaps = 4/96 (4%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSE  385
            R+AE+ PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+    RQ+RFI RW+++LS+
Sbjct  401  RHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSD  460

Query  384  PRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  461  PRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>emb|CAA42026.1| catalase [Ricinus communis]
 emb|CAA42215.1| catalase [Ricinus communis]
Length=90

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -1

Query  543  ERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEI  364
            E  P P  I +G+R+KCVIEKENNFKQPG+RYRSW PDRQ+R +NR V   SEPR+T E+
Sbjct  2    ESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWPPDRQERSLNRLVGGFSEPRITQEL  61

Query  363  RSTWISYLTQADRSLGQKVASRLNIRPTM  277
            R+ WISY  Q D+SLGQK+A+RLN++P++
Sbjct  62   RTIWISYWIQCDKSLGQKLATRLNVKPSI  90



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AE+ P P R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+T
Sbjct  401  RHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRIT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  461  HELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  552  RNAERSPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVT  373
            R+AER P P    +G R+KCVIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVT
Sbjct  401  RHAERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVT  460

Query  372  HEIRSTWISYLTQADRSLGQKVASRLNIRPTM  277
            HEI S WISY +Q+D+SLGQK+A+RLN++  M
Sbjct  461  HEICSIWISYWSQSDKSLGQKIAARLNMKANM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760