BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051M09

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       185   1e-53   Genlisea aurea
ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    183   5e-53   Nicotiana tomentosiformis
gb|AFH57997.1|  chloroplast PsbO1 precursor                             183   6e-53   Nicotiana benthamiana
gb|ABK95838.1|  unknown                                                 178   7e-53   Populus trichocarpa [western balsam poplar]
ref|NP_001140815.1|  hypothetical protein                               179   1e-52   
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    182   2e-52   Nicotiana sylvestris
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    182   2e-52   
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    182   2e-52   Solanum tuberosum [potatoes]
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          182   2e-52   Saccharum hybrid cultivar [sugarcane]
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    182   2e-52   Nicotiana benthamiana
gb|AFH57998.1|  chloroplast PsbO2 precursor                             182   2e-52   Nicotiana benthamiana
gb|ABK96748.1|  unknown                                                 182   2e-52   Populus trichocarpa x Populus deltoides
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    182   2e-52   Nicotiana tomentosiformis
gb|AFH58000.1|  chloroplast PsbO4 precursor                             182   3e-52   Nicotiana benthamiana
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    182   3e-52   Populus euphratica
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         181   3e-52   
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            181   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    181   3e-52   Nicotiana sylvestris
gb|AAR85969.1|  ERT12                                                   175   3e-52   Nicotiana tabacum [American tobacco]
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         181   4e-52   Jatropha curcas
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            181   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    181   5e-52   Populus euphratica
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    181   5e-52   Nicotiana sylvestris
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 181   6e-52   Morus notabilis
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      181   6e-52   Litchi chinensis [litchi]
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    181   6e-52   Solanum tuberosum [potatoes]
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    181   6e-52   Solanum tuberosum [potatoes]
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    181   7e-52   Cucumis sativus [cucumbers]
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     181   7e-52   Solanum tuberosum [potatoes]
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    180   8e-52   
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    180   9e-52   Ricinus communis
ref|NP_001130585.1|  uncharacterized protein LOC100191684               180   9e-52   Zea mays [maize]
emb|CDP02430.1|  unnamed protein product                                180   1e-51   Coffea canephora [robusta coffee]
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      181   1e-51   
dbj|BAJ89638.1|  predicted protein                                      180   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       179   1e-51   Triticum urartu
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                      175   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          179   2e-51   Amborella trichopoda
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             179   2e-51   Citrus clementina [clementine]
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    176   2e-51   
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   177   2e-51   Citrus sinensis [apfelsine]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    179   2e-51   Setaria italica
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                      175   2e-51   Oryza sativa Indica Group [Indian rice]
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   179   2e-51   Citrus sinensis [apfelsine]
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     177   2e-51   Eucalyptus grandis [rose gum]
gb|AEN02470.1|  oxygen-evolving enhancer protein                        179   2e-51   Camellia sinensis [black tea]
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    179   3e-51   Fritillaria agrestis
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    179   3e-51   Phoenix dactylifera
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    179   3e-51   Elaeis guineensis
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    179   3e-51   Cucumis melo [Oriental melon]
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    178   4e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|ADR71223.1|  chloroplast manganese stabilizing protein               178   5e-51   Solanum tuberosum [potatoes]
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    178   6e-51   Eucalyptus grandis [rose gum]
prf||2002393A  oxygen-evolving complex protein 1                        176   6e-51
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    178   6e-51   
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           178   6e-51   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    178   7e-51   Phoenix dactylifera
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    178   8e-51   Oryza brachyantha
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          177   8e-51   Leymus chinensis
gb|EEC70714.1|  hypothetical protein OsI_02088                          178   8e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    177   8e-51   Brachypodium distachyon [annual false brome]
ref|NP_001043134.1|  Os01g0501800                                       178   8e-51   
prf||1204192A  photosystem II protein 33kD                              175   9e-51
gb|AFH57999.1|  chloroplast PsbO3 precursor                             177   9e-51   Nicotiana benthamiana
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    177   9e-51   Spinacia oleracea
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    177   1e-50   Vitis vinifera
emb|CAA29062.1|  unnamed protein product                                177   1e-50   Spinacia oleracea
emb|CAN61828.1|  hypothetical protein VITISV_027630                     177   1e-50   Vitis vinifera
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    177   2e-50   Helianthus annuus
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    176   2e-50   Vitis vinifera
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    173   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    176   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    176   6e-50   Tarenaya hassleriana [spider flower]
gb|ACJ84218.1|  unknown                                                 171   7e-50   Medicago truncatula
emb|CAN79166.1|  hypothetical protein VITISV_019248                     175   7e-50   Vitis vinifera
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    175   9e-50   Pyrus x bretschneideri [bai li]
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    175   9e-50   Pyrus x bretschneideri [bai li]
ref|NP_001240871.1|  uncharacterized protein LOC100811386               175   9e-50   Glycine max [soybeans]
gb|KJB43587.1|  hypothetical protein B456_007G208000                    173   1e-49   Gossypium raimondii
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    175   1e-49   Prunus mume [ume]
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    175   1e-49   Pyrus x bretschneideri [bai li]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          175   1e-49   Dimocarpus longan [longan]
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             175   1e-49   Prunus persica
gb|ACU19823.1|  unknown                                                 170   1e-49   Glycine max [soybeans]
gb|ACN40581.1|  unknown                                                 175   1e-49   Picea sitchensis
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   1e-49   Malus domestica [apple tree]
gb|ABK24541.1|  unknown                                                 175   1e-49   Picea sitchensis
gb|AFK46831.1|  unknown                                                 169   2e-49   Lotus japonicus
gb|ABK23365.1|  unknown                                                 174   2e-49   Picea sitchensis
gb|ABQ85434.1|  33 kDa OEC protein                                      169   2e-49   Salicornia veneta
emb|CDY30764.1|  BnaC07g16640D                                          174   2e-49   Brassica napus [oilseed rape]
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      174   2e-49   Pinus sylvestris [Scotch pine]
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   2e-49   Fragaria vesca subsp. vesca
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   2e-49   Brassica rapa
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   2e-49   Brassica rapa
emb|CDX81388.1|  BnaC09g07990D                                          174   2e-49   
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   2e-49   Brassica rapa
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             172   2e-49   Phaseolus vulgaris [French bean]
emb|CDY50981.1|  BnaC02g48890D                                          174   2e-49   Brassica napus [oilseed rape]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             174   3e-49   Phaseolus vulgaris [French bean]
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             174   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    174   3e-49   Camelina sativa [gold-of-pleasure]
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           174   3e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         174   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             174   3e-49   Capsella rubella
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    173   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877774.1|  photosystem II subunit O-2                         173   4e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    173   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    173   4e-49   
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    173   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        173   4e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   173   4e-49   Medicago truncatula
gb|AAL08257.1|  AT5g66570/K1F13_25                                      173   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       173   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             173   4e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    173   4e-49   Brassica rapa
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    173   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    173   4e-49   Arabis alpina [alpine rockcress]
gb|KJB43585.1|  hypothetical protein B456_007G208000                    172   7e-49   Gossypium raimondii
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    172   7e-49   Pisum sativum [garden pea]
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            172   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   172   8e-49   
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  172   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   9e-49   Glycine max [soybeans]
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             174   9e-49   
ref|NP_001241522.1|  uncharacterized protein LOC100820458               172   1e-48   Glycine max [soybeans]
gb|KJB43586.1|  hypothetical protein B456_007G208000                    172   1e-48   Gossypium raimondii
gb|AFK43771.1|  unknown                                                 172   1e-48   Lotus japonicus
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    172   1e-48   Arabis alpina [alpine rockcress]
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               172   1e-48   Gossypium arboreum [tree cotton]
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_007047093.1|  Photosystem II subunit O-2                         172   2e-48   
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             172   2e-48   Phaseolus vulgaris [French bean]
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    171   2e-48   Salicornia europaea [chicken-claws]
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   2e-48   Nelumbo nucifera [Indian lotus]
gb|AAT65501.1|  photosystem II protein                                  171   3e-48   Brassica oleracea
ref|NP_001239736.1|  uncharacterized protein LOC100798485               171   4e-48   Glycine max [soybeans]
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    169   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    165   8e-46   Elaeis guineensis
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      164   9e-46   Phaseolus vulgaris [French bean]
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    164   1e-45   Triticum aestivum [Canadian hard winter wheat]
emb|CDX72613.1|  BnaC07g46350D                                          162   4e-45   
emb|CDY26519.1|  BnaC01g23800D                                          164   6e-45   Brassica napus [oilseed rape]
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             162   9e-45   Eutrema salsugineum [saltwater cress]
emb|CDY33308.1|  BnaA01g19750D                                          163   1e-44   Brassica napus [oilseed rape]
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    160   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             159   7e-44   Arabidopsis lyrata subsp. lyrata
emb|CDY42709.1|  BnaA03g53620D                                          159   8e-44   Brassica napus [oilseed rape]
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    159   1e-43   Sesamum indicum [beniseed]
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    159   1e-43   Sesamum indicum [beniseed]
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    158   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    157   4e-43   
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                156   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             156   2e-42   Selaginella moellendorffii
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             156   2e-42   
ref|XP_001781590.1|  predicted protein                                  155   4e-42   
ref|XP_001784751.1|  predicted protein                                  153   5e-42   
ref|XP_001763258.1|  predicted protein                                  154   1e-41   
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             151   1e-41   
ref|XP_001756893.1|  predicted protein                                  154   1e-41   
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        147   3e-39   Chara braunii
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        145   1e-38   Oedogonium obesum
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    144   4e-38   
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    143   2e-37   
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        142   3e-37   Closterium peracerosum-strigosum-littorale complex
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          141   4e-37   Chlamydomonas incerta
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    140   1e-36   Ostreococcus lucimarinus CCE9901
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    139   3e-36   Micromonas pusilla CCMP1545
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1       139   3e-36   Gymnochlora stellata
gb|AAR20846.1|  oxygen-evolving enhancer protein 1                      134   6e-36   Pseudochlorella pringsheimii
ref|XP_007513615.1|  predicted protein                                  137   2e-35   Bathycoccus prasinos
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II        136   5e-35   Tetraselmis cordiformis
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II        136   7e-35   Chlorarachnion reptans
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    135   7e-35   Chlamydomonas reinhardtii
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    135   7e-35   Chlamydomonas reinhardtii
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    135   9e-35   Coccomyxa subellipsoidea C-169
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II        134   1e-34   Nephroselmis olivacea
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...    135   1e-34   Micromonas commoda
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             134   2e-34   Ostreococcus tauri
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              134   2e-34   Chlorella variabilis
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    132   8e-34   Volvox carteri f. nagariensis
gb|AAP79149.1|  photosystem II protein PsbO                             133   9e-34   Bigelowiella natans
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    132   9e-34   Volvox carteri
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        131   2e-33   Hafniomonas montana
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II        130   8e-33   Bryopsis plumosa
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II        130   9e-33   Eutreptiella gymnastica
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    129   1e-32   Auxenochlorella protothecoides
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor           129   4e-32   Euglena gracilis
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...    128   6e-32   Euglena gracilis
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            127   9e-32   Solanum tuberosum [potatoes]
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II    126   1e-31   Coccomyxa subellipsoidea C-169
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      126   2e-31   Monoraphidium neglectum
gb|AGI15761.1|  collinsiaXIII-like protein                              122   2e-31   Collinsia linearis
gb|AGI15756.1|  collinsiaXIII-like protein                              121   9e-31   Collinsia linearis
gb|AGI15739.1|  collinsiaXIII-like protein                              121   9e-31   Collinsia rattanii
gb|AGI15762.1|  collinsiaXIII-like protein                              117   2e-29   Collinsia linearis
gb|AGI15742.1|  collinsiaXIII-like protein                              117   2e-29   Collinsia rattanii
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    119   7e-29   Morus nigra
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        118   2e-28   Pyramimonas parkeae
ref|WP_017293645.1|  hypothetical protein                               117   2e-28   Geminocystis herdmanii
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...    116   5e-28   [Leptolyngbya] sp. JSC-1
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...    116   8e-28   Hapalosiphonaceae
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...    115   9e-28   Fischerella
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...    115   2e-27   Cyanobacterium aponinum
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...    115   2e-27   Fischerella muscicola
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...    115   2e-27   Fischerella sp. PCC 9605
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...    114   3e-27   Tolypothrix campylonemoides
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...    114   4e-27   Fischerella sp. PCC 9339
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...    114   5e-27   Oscillatoria sp. PCC 10802
gb|ABR17376.1|  unknown                                                 114   7e-27   Picea sitchensis
gb|AGI15740.1|  collinsiaXIII-like protein                              110   7e-27   Collinsia rattanii
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...    113   9e-27   Calothrix sp. PCC 7103
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...    113   1e-26   Fischerella muscicola
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...    112   1e-26   Calothrix sp. 336/3
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...    112   1e-26   
gb|KIY93348.1|  Oxygen-evolving enhancer protein 1                      107   2e-26   Monoraphidium neglectum
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...    112   2e-26   Calothrix parietina
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...    112   2e-26   Chlorogloeopsis fritschii
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...    112   2e-26   Mastigocladopsis repens
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor           112   2e-26   Nostoc sp. PCC 7120
emb|CCH65457.1|  Photosystem II manganese-stabilizing protein (PsbO)    110   2e-26   Richelia intracellularis HM01
ref|WP_036480960.1|  Photosystem II manganese-stabilizing polypep...    112   3e-26   Myxosarcina sp. GI1
ref|WP_044259457.1|  Photosystem II manganese-stabilizing protein...    110   3e-26   
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)     111   3e-26   Nodularia spumigena CCY9414
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...    112   3e-26   Crinalium epipsammum
ref|WP_017662186.1|  hypothetical protein                               112   3e-26   Geitlerinema sp. PCC 7105
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II        112   3e-26   Lepidodinium chlorophorum
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...    111   4e-26   Nodularia spumigena
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...    111   4e-26   Mastigocoleus testarum
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...    111   5e-26   Nostoc sp. PCC 7524
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...    111   6e-26   Trichormus variabilis
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...    111   6e-26   Richelia intracellularis
ref|WP_010997995.1|  manganese-stabilzing protein                       110   6e-26   Nostocaceae
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...    110   7e-26   Cylindrospermum stagnale
ref|WP_015223075.1|  photosystem II manganese-stabilizing protein...    110   8e-26   
ref|NP_195440.1|  photosystem II manganese-stabilising protein (P...    107   9e-26   Arabidopsis thaliana [mouse-ear cress]
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...    110   1e-25   Nostocales
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...    110   1e-25   Aphanizomenon flos-aquae
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...    110   1e-25   cyanobacterium PCC 7702
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...    110   1e-25   Nostoc
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...    110   2e-25   Rubidibacter lacunae
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...    109   2e-25   
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...    109   2e-25   Pleurocapsa minor
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide        109   2e-25   Tolypothrix bouteillei VB521301
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...    109   2e-25   Nostoc sp. PCC 7107
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...    109   3e-25   Cyanothece
ref|WP_019506429.1|  hypothetical protein                               109   3e-25   Pleurocapsa sp. PCC 7319
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...    108   4e-25   Anabaena sp. PCC 7108
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...    108   5e-25   Scytonema hofmannii
gb|AIR09396.1|  psbO                                                    105   5e-25   Trachelomonas abrupta
ref|WP_018399127.1|  hypothetical protein                               108   6e-25   filamentous cyanobacterium ESFC-1
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...    108   7e-25   Dolichospermum circinale
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...    108   7e-25   Dolichospermum circinale
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...    107   1e-24   Cyanothece sp. PCC 7425
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...    107   1e-24   Anabaena sp. 90
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...    107   2e-24   [Scytonema hofmanni] UTEX B 1581
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...    107   2e-24   Calothrix sp. PCC 7507
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...    106   2e-24   
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...    106   3e-24   Rivularia sp. PCC 7116
ref|WP_015151496.1|  Manganese-stabilising protein / photosystem ...    106   3e-24   Oscillatoria acuminata
ref|WP_012305903.1|  photosystem II manganese stabilizing protein...    106   3e-24   Synechococcus
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Cyanothece sp. CCY0110
ref|WP_030006064.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Synechococcus
ref|WP_002800587.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Microcystis aeruginosa
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide        106   3e-24   Cyanothece sp. CCY0110
ref|WP_002773425.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Microcystis aeruginosa
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...    106   3e-24   Lyngbya confervoides
ref|WP_004162736.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Microcystis
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...    106   3e-24   Oscillatoriales cyanobacterium JSC-12
ref|WP_008199011.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Microcystis
ref|WP_002791059.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Microcystis aeruginosa
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...    106   3e-24   Fortiea contorta
ref|WP_004160298.1|  Photosystem II manganese-stabilizing polypep...    106   4e-24   Microcystis
ref|WP_002738218.1|  photosystem II manganese-stabilizing polypep...    106   4e-24   Microcystis aeruginosa
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...    106   4e-24   Trichormus azollae
ref|WP_002761031.1|  Photosystem II manganese-stabilizing polypep...    106   4e-24   Microcystis
ref|WP_002741980.1|  photosystem II manganese-stabilizing polypep...    106   4e-24   
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)    106   4e-24   
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...    106   4e-24   
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        105   4e-24   
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...    106   4e-24   
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein            105   4e-24   
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide        105   5e-24   
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...    105   5e-24   
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...    105   7e-24   
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...    105   7e-24   
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...    105   8e-24   
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...    105   8e-24   
ref|WP_006529097.1|  Manganese-stabilising protein / photosystem ...    104   2e-23   
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...    104   2e-23   
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...    103   2e-23   
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...    103   3e-23   
ref|WP_017286598.1|  hypothetical protein                               103   3e-23   
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...    103   3e-23   
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...    103   3e-23   
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...    103   4e-23   
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...    103   5e-23   
gb|AAF13997.1|  photosystem II manganese stabilizing protein            103   6e-23   
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...    102   6e-23   
dbj|BAA03321.1|  Mn-stabilizing protein                               99.0    7e-23   
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...    102   7e-23   
ref|WP_016922728.1|  hypothetical protein                               102   9e-23   
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...    102   9e-23   
gb|ABR25929.1|  oxygen-evolving enhancer protein 1                    97.1    1e-22   
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...    102   1e-22   
ref|WP_033373963.1|  Photosystem II manganese-stabilizing polypep...    102   1e-22   
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...    101   2e-22   
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...    101   2e-22   
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    101   2e-22   
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...    101   2e-22   
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...    101   2e-22   
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...    101   3e-22   
ref|WP_035985606.1|  hypothetical protein                               100   3e-22   
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...    100   4e-22   
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...    100   4e-22   
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II        100   4e-22   
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...    100   5e-22   
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...    100   7e-22   
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  99.4    7e-22   
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  99.0    1e-21   
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                     99.8    1e-21   
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO     99.8    1e-21   
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...  99.4    1e-21   
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  98.6    1e-21   
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...  99.4    1e-21   
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  98.2    2e-21   
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...  98.6    2e-21   
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...  98.2    2e-21   
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...  99.0    2e-21   
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...  98.6    2e-21   
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...  98.2    2e-21   
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...  98.6    2e-21   
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...  98.6    2e-21   
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO     99.0    2e-21   
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...  98.6    2e-21   
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...  98.6    2e-21   
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...  98.6    2e-21   
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  97.8    3e-21   
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...  97.8    4e-21   
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...  97.4    6e-21   
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...  97.1    9e-21   
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                   96.7    2e-20   
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...  95.9    2e-20   
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...  95.1    3e-20   
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...  95.1    3e-20   
ref|WP_011243530.1|  MULTISPECIES: photosystem II PsbO protein        95.1    4e-20   
gb|ADC54897.1|  oxygen-evolving enhancer protein                      94.4    5e-20   
emb|CBI19622.3|  unnamed protein product                              94.7    6e-20   
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                   94.7    8e-20   
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                  94.4    9e-20   
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...  94.0    1e-19   
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                     93.6    2e-19   
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein     92.8    2e-19   
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                  92.8    3e-19   
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                     92.8    3e-19   
gb|ACF28703.1|  oxygen evolving complex protein variant               91.3    3e-19   
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor        92.8    3e-19   
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  92.0    3e-19   
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...  92.4    4e-19   
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...  92.4    4e-19   
gb|KEI69285.1|  PsbO                                                  92.4    4e-19   
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                  92.8    4e-19   
ref|WP_008186133.1|  manganese-stabilising protein/ photosystem I...  92.4    4e-19   
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...  92.0    5e-19   
gb|ABF59672.1|  photosystem II extrinsic protein O                    92.0    7e-19   
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                     91.7    9e-19   
emb|CBN78902.1|  manganese stabilising protein                        91.7    1e-18   
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...  91.3    1e-18   
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...  90.9    1e-18   
ref|XP_005706438.1|  photosystem II PsbO protein                      91.3    1e-18   
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor          90.9    1e-18   
ref|YP_002049183.1|  Photosystem II manganese-stabilizing polypep...  90.5    1e-18   
gb|ABH09263.1|  photosystem II manganese-stabilizing protein          90.5    2e-18   
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor     90.5    2e-18   
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...  90.5    2e-18   
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)   90.1    2e-18   
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...  90.1    2e-18   
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                     89.7    3e-18   
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722            89.7    3e-18   
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...  89.7    4e-18   
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                     88.6    1e-17   
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein     88.2    1e-17   
ref|XP_005536430.1|  manganese-stabilzing protein precursor           88.2    1e-17   
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...  87.8    1e-17   
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...  87.4    2e-17   
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...  86.7    4e-17   
gb|AAN11311.1|  oxygen-evolving enhancer 1                            86.7    5e-17   
dbj|BAG85210.1|  extrinsic protein in photosystem II                  86.3    5e-17   
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                     86.3    5e-17   
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...  86.3    6e-17   
gb|EWM24379.1|  oxygen-evolving enhancer protein                      86.3    7e-17   
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                     86.3    7e-17   
emb|CAH25340.1|  oxygen-evolving enhancer                             85.9    7e-17   
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...  85.9    8e-17   
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...  85.9    8e-17   
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111            85.9    9e-17   
ref|WP_026032523.1|  Photosystem II manganese-stabilizing polypep...  85.5    9e-17   
ref|WP_019474069.1|  MULTISPECIES: Photosystem II manganese-stabi...  85.5    1e-16   
ref|WP_026032868.1|  Photosystem II manganese-stabilizing polypep...  85.5    1e-16   
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                     85.5    1e-16   
ref|WP_028953543.1|  Photosystem II manganese-stabilizing polypep...  85.1    1e-16   
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...  85.1    1e-16   
ref|WP_038551339.1|  Photosystem II manganese-stabilizing polypep...  85.1    1e-16   
ref|WP_043694690.1|  Photosystem II manganese-stabilizing polypep...  85.1    1e-16   
gb|KGF94551.1|  Photosystem II manganese-stabilizing protein (PsbO)   84.0    1e-16   
gb|ADD94884.1|  photosystem II manganese stabilizing polypeptide      84.7    2e-16   
gb|AHF62713.1|  photosystem II manganese-stabilizing polypeptide      84.7    2e-16   
ref|WP_011363327.1|  photosystem II manganese-stabilizing polypep...  84.7    2e-16   
ref|WP_025946585.1|  Photosystem II manganese-stabilizing polypep...  84.0    2e-16   
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor     85.1    2e-16   
ref|WP_011127177.1|  photosystem II manganese-stabilizing polypep...  84.7    2e-16   
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1               84.7    2e-16   
ref|WP_029981289.1|  Photosystem II manganese-stabilizing polypep...  84.0    2e-16   
gb|KGF89180.1|  Photosystem II manganese-stabilizing protein (PsbO)   84.0    2e-16   
gb|ABV49867.1|  Photosystem II manganese-stabilizing protein          84.7    2e-16   
ref|WP_002806175.1|  photosystem II manganese-stabilizing protein     84.3    2e-16   
gb|ABO16873.1|  Photosystem II manganese-stabilizing protein          84.3    2e-16   
ref|WP_025952314.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
gb|ABM69537.1|  Photosystem II manganese-stabilizing protein          84.3    2e-16   
ref|WP_011375796.1|  photosystem II manganese-stabilizing protein     84.3    2e-16   
ref|WP_025956454.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_025979193.1|  MULTISPECIES: Photosystem II manganese-stabi...  84.3    2e-16   
ref|WP_025921390.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_041484654.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_025892535.1|  MULTISPECIES: Photosystem II manganese-stabi...  84.3    2e-16   
ref|WP_025945629.1|  MULTISPECIES: Photosystem II manganese-stabi...  84.3    2e-16   
ref|WP_025941252.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_025937984.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_025890347.1|  MULTISPECIES: Photosystem II manganese-stabi...  84.3    2e-16   
ref|WP_025955147.1|  MULTISPECIES: Photosystem II manganese-stabi...  84.3    2e-16   
ref|WP_025942737.1|  MULTISPECIES: Photosystem II manganese-stabi...  84.3    2e-16   
ref|WP_025914084.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_032527523.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_025925905.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16   
ref|WP_042849726.1|  Photosystem II manganese-stabilizing polypep...  84.3    3e-16   
ref|WP_032514588.1|  Photosystem II manganese-stabilizing polypep...  84.3    3e-16   
gb|EJK75097.1|  hypothetical protein THAOC_03193                      84.3    3e-16   
ref|WP_036922154.1|  Photosystem II manganese-stabilizing polypep...  84.3    3e-16   
ref|WP_025929711.1|  Photosystem II manganese-stabilizing polypep...  84.0    3e-16   
pir||S11851  photosystem II oxygen-evolving complex protein 1 - t...  79.0    5e-16
ref|WP_011294230.1|  photosystem II manganese-stabilizing protein     83.6    5e-16   
ref|WP_036906171.1|  Photosystem II manganese-stabilizing polypep...  83.2    5e-16   
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...  83.2    5e-16   
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...  83.2    6e-16   
ref|WP_019500685.1|  hypothetical protein                             83.2    6e-16   
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                     83.6    6e-16   
ref|WP_038651072.1|  Photosystem II manganese-stabilizing polypep...  83.2    6e-16   
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...  83.2    6e-16   
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...  82.8    7e-16   
ref|WP_025906083.1|  Photosystem II manganese-stabilizing polypep...  82.8    8e-16   
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...  82.8    8e-16   
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO    82.8    9e-16   
ref|WP_009788842.1|  photosystem II manganese-stabilizing polypep...  82.8    9e-16   
ref|WP_011360791.1|  photosystem II manganese-stabilizing polypep...  82.4    1e-15   
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein     82.4    1e-15   
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                  82.8    1e-15   
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                  82.4    1e-15   
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein     82.0    1e-15   
ref|WP_025965258.1|  Photosystem II manganese-stabilizing polypep...  82.0    1e-15   
ref|WP_019477231.1|  Photosystem II manganese-stabilizing polypep...  82.0    1e-15   
gb|ADB07372.1|  chloroplast managanese stabilizing protein            80.9    4e-15   
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...  80.9    4e-15   
ref|WP_011819581.1|  photosystem II manganese-stabilizing protein     80.5    4e-15   
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...  80.5    5e-15   
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein     79.3    1e-14   
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor          79.7    2e-14   
gb|ACF95815.1|  oxygen evolving enhancer protein 1                    78.2    2e-14   
sp|P84989.1|PSBO_POPEU  RecName: Full=Oxygen-evolving enhancer pr...  75.9    2e-14   
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...  78.6    2e-14   
ref|WP_011131867.1|  photosystem II manganese-stabilizing protein     78.2    3e-14   
ref|WP_036913864.1|  MULTISPECIES: Photosystem II manganese-stabi...  78.2    3e-14   
ref|WP_036901453.1|  Photosystem II manganese-stabilizing polypep...  77.8    4e-14   
gb|KGG33279.1|  Photosystem II manganese-stabilizing protein (PsbO)   78.2    4e-14   
ref|WP_011131167.1|  photosystem II manganese-stabilizing protein     77.8    5e-14   
ref|WP_011826976.1|  photosystem II manganese-stabilizing protein     77.4    5e-14   
ref|WP_012194806.1|  photosystem II manganese-stabilizing protein     77.0    8e-14   
ref|WP_011433163.1|  photosystem II manganese-stabilizing protein     77.0    8e-14   
ref|WP_025961750.1|  hypothetical protein                             73.2    2e-13   
gb|KGG11425.1|  Photosystem II manganese-stabilizing protein (PsbO)   75.9    2e-13   
ref|WP_011124412.1|  MULTISPECIES: photosystem II manganese-stabi...  75.9    2e-13   
gb|KGG18324.1|  Photosystem II manganese-stabilizing protein (PsbO)   74.7    4e-13   
ref|WP_036916508.1|  MULTISPECIES: Photosystem II manganese-stabi...  74.7    4e-13   
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678            74.7    6e-13   
ref|WP_011430097.1|  photosystem II manganese-stabilizing protein     68.9    6e-11   
ref|WP_026101172.1|  photosystem II manganese-stabilizing protein     64.3    2e-09   
ref|WP_021830355.1|  Photosystem II manganese-stabilizing protein...  59.7    5e-09   
emb|CDX73783.1|  BnaC08g22200D                                        57.0    2e-07   
ref|XP_003082811.1|  photosystem II oxygen-evolving complex prote...  57.0    3e-07   
ref|WP_029959200.1|  Photosystem II manganese-stabilizing polypep...  52.0    5e-06   
ref|WP_025913226.1|  hypothetical protein                             52.4    6e-06   
ref|WP_036974707.1|  Photosystem II manganese-stabilizing polypep...  48.9    5e-05   
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II          50.4    2e-04   
gb|ABV57472.1|  chloroplast PsbO                                      48.5    3e-04   
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                 49.7    3e-04   



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTGKIT S+T +KPET
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNTASSTGKITLSITKTKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQLE
Sbjct  294  GEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQLE  329



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN +SSTGKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTSSSTGKITLSVTQSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|ABK95838.1| unknown [Populus trichocarpa]
Length=170

 Score =   178 bits (452),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  74   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPET  133

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  134  GEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  169



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S PET
Sbjct  135  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPET  194

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  195  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  230



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT  KPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQCKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKIT SVT SKPET
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  294  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  329



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKIT SVT SKPET
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  294  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  329



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S PET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  332



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKP+T
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPQT  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKP+T
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPQT  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  236  RGTSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTASSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  296  GEIIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN +SSTGKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTSSSTGKITLSVTQSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTASSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  296  GEIIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S PET
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  294  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  329



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTASSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  296  GEIIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTRSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>gb|AAR85969.1| ERT12 [Nicotiana tabacum]
Length=132

 Score =   175 bits (444),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGST YDNAVALPAGGRGDEEEL+KEN+KN +SSTGKIT SVT SKPET
Sbjct  38   RGSSFLDPKGRGGSTSYDNAVALPAGGRGDEEELEKENVKNTSSSTGKITLSVTNSKPET  97

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL
Sbjct  98   GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQL  132



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KNV SSTGKIT SVTGSKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKNVGSSTGKITLSVTGSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  296  GEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  296  GEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  296  GEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN +SSTGKIT SVT SKPET
Sbjct  232  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTSSSTGKITLSVTNSKPET  291

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  292  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  327



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  297  GEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  332



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTGKIT SVT +KPET
Sbjct  237  RGTSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKNASSSTGKITLSVTKTKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+T
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQT  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+T
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQT  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKNASSSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQL+
Sbjct  296  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLD  331



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+T
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQT  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+T
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQT  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   180 bits (457),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS GKIT SVTGSKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNAASSVGKITLSVTGSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  298  GEIIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLE  333



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   180 bits (457),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S P+T
Sbjct  240  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPDT  299

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  300  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  335



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKNV+SS+GKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKNVSSSSGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLG+KAPKEVKIQGIWYAQLE
Sbjct  296  GEVIGVFESVQPSDTDLGSKAPKEVKIQGIWYAQLE  331



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S P+T
Sbjct  278  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPDT  337

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  338  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  373



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  231  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  291  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  231  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  291  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>gb|ABR26133.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=178

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  83   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  142

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  143  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  178



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA+ALPAGGRGD+EELQKENIKN ASSTG IT SVT SKPE+
Sbjct  236  RGSSFLDPKGRGGSTGYDNAIALPAGGRGDDEELQKENIKNTASSTGNITLSVTKSKPES  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN +SSTGKIT SVT SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  298  GEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKN ASSTGKIT  VT SKPET
Sbjct  137  RGSSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKNTASSTGKITLGVTNSKPET  196

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PKEVKIQG+WYAQLE
Sbjct  197  GEVIGVFESIQPSDTDLGAKVPKEVKIQGVWYAQLE  232



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN +SSTGKIT SVT SKPET
Sbjct  175  RGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPET  234

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  235  GEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  270



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG IT SVT S PET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKNAASSTGNITLSVTKSNPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  296  GEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  331



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  108  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  167

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  168  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  203



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN +SSTGKIT SVT SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  298  GEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE+L KENIKN +SSTGKIT SVT +KPET
Sbjct  151  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEDLTKENIKNASSSTGKITLSVTKTKPET  210

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  211  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  246



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKN ASSTGKIT  VT SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKNTASSTGKITLGVTNSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PKEVKIQG+WYAQLE
Sbjct  298  GEVIGVFESIQPSDTDLGAKVPKEVKIQGVWYAQLE  333



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGS GYDNAVALPAGGRGDEEEL KENIK+V+SSTGKIT SVT SKPET
Sbjct  234  RGSSFLDPKGRGGSAGYDNAVALPAGGRGDEEELVKENIKDVSSSTGKITLSVTKSKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLG+KAPK+VKIQGIWYAQLE
Sbjct  294  GEVIGVFESIQPSDTDLGSKAPKDVKIQGIWYAQLE  329



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTSSSTGTITLSVTKSKPES  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PKEVKIQGIWYAQLE
Sbjct  298  GEVIGVFESIQPSDTDLGAKVPKEVKIQGIWYAQLE  333



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTSSSTGSITLSVTKSKPES  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PKEVKIQGIWYAQLE
Sbjct  298  GEVIGVFESVQPSDTDLGAKTPKEVKIQGIWYAQLE  333



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN +SSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKNASSSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  331



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN ASS G IT SVT SKPET
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASSKGTITLSVTQSKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  294  GEVIGVFQSLQPSDTDLGAKVPKDVKIEGIWYAQLE  329



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKIT SVT SKPET
Sbjct  228  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPET  287

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  286
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQ
Sbjct  288  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQ  321



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE+L KENIKN +SSTGKIT SVT +KPET
Sbjct  235  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEDLTKENIKNASSSTGKITLSVTKTKPET  294

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  295  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  330



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  152  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  211

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  212  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  247



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN +SSTGKIT SVT SKP+T
Sbjct  230  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTSSSTGKITLSVTNSKPDT  289

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  290  GELIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  325



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGY+NAVALPAGGRGDEEEL KENIKN +SSTGKIT  VT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYBNAVALPAGGRGDEEELTKENIKNTSSSTGKITLGVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  296  GEVIGVFESLQPSDTDLGAKVPKDVKIQGIWYAQLD  331



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   178 bits (451),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTSSSTGSITLSVTKSKPES  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  298  GEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  297  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  332



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  231  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFE +QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  291  GEVIGVFERVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  298  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  333



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SS G IT SVT SKPET
Sbjct  233  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSQGNITLSVTKSKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  293  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  298  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  333



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASS G IT SVT SKPET
Sbjct  151  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPET  210

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  211  GEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  246



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGST YDNAVALPAGGRGDEEEL+KEN+KN AS+TGKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTVYDNAVALPAGGRGDEEELEKENVKNTASATGKITLSVTQSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASS G IT SVT SKPET
Sbjct  235  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPET  294

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  295  GEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  330



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KENIK+ +SSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKKENIKDASSSTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PKEVKIQG WY QLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKTPKEVKIQGFWYGQLE  331



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASS G IT SVT SKPET
Sbjct  235  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPET  294

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  295  GEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  330



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KENIK+ +SSTGKIT SVT SKPET
Sbjct  216  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKKENIKDASSSTGKITLSVTKSKPET  275

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PKEVKIQG WY QLE
Sbjct  276  GEVIGVFESIQPSDTDLGAKTPKEVKIQGFWYGQLE  311



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN A+  G+ITFSVT SKPET
Sbjct  229  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTAAGKGEITFSVTSSKPET  288

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQL
Sbjct  289  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQL  323



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL++ENIK+ +SSTGKIT S+T SKPE+
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKRENIKDASSSTGKITLSITKSKPES  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYAQLE  331



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG+IT  VT SKPET
Sbjct  135  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNAASSTGEITLKVTKSKPET  194

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  195  GELIGVFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  230



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG+IT  VT SKPET
Sbjct  222  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNAASSTGEITLKVTKSKPET  281

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  282  GELIGVFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  317



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG+IT  VT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNAASSTGEITLKVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  296  GELIGVFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  331



>gb|ACJ84218.1| unknown [Medicago truncatula]
Length=170

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS GKIT SVT SKPET
Sbjct  74   RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQSKPET  133

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  134  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  169



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+ ENIK+ +SSTGKIT S+T SKPE+
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKXENIKDASSSTGKITLSITKSKPES  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYAQLE  331



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+S+GKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASSGKITLSVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  297  GELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+S+GKIT SVT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASSGKITLSVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  297  GELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKITFSVT +KPET
Sbjct  230  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITFSVTKTKPET  289

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  290  GEVIGVFQSLQPSDTDLGAKAPKDVKIQGIWYAQLE  325



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ ASS+GKIT SVT SKPET
Sbjct  166  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAASSSGKITLSVTKSKPET  225

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  226  GEVIGVFESLQPSDTDLGAKTPKDVKITGVWYAQLD  261



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEEEL KENIKN ASS GKIT SVT SKPE+
Sbjct  237  RGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEELAKENIKNTASSKGKITLSVTKSKPES  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  297  GELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+S GKIT SVT +KPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASKGKITLSVTKTKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  297  GELIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  332



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTGKIT SVT SKPET
Sbjct  237  RGTSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKNASSSTGKITLSVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES QPSDTDLGAK  K+VKIQGIWYAQL+
Sbjct  297  GEVIGVFESFQPSDTDLGAKVAKDVKIQGIWYAQLD  332



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEEEL KENIKN ASS GKIT SVT SKPE+
Sbjct  237  RGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEELAKENIKNTASSKGKITLSVTKSKPES  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  297  GELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>gb|ACU19823.1| unknown [Glycine max]
Length=170

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT +KPET
Sbjct  74   RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPET  133

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  134  GEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  169



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+T
Sbjct  244  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDT  303

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  304  GEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+STGKIT SVT SKPE 
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASTGKITLSVTKSKPEN  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  297  GELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+T
Sbjct  244  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDT  303

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  304  GEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>gb|AFK46831.1| unknown [Lotus japonicus]
Length=170

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT SKP+T
Sbjct  74   RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTQSKPDT  133

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  134  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  169



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+T
Sbjct  244  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDT  303

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  304  GEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>gb|ABQ85434.1| 33 kDa OEC protein, partial [Salicornia veneta]
Length=170

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS G IT SV+ SKPET
Sbjct  74   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENNKNAASSKGTITLSVSKSKPET  133

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  134  GEVIGVFQSLQPSDTDLGAKTPKDVKIEGIWYAQLE  169



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G IT SV+ SKPET
Sbjct  243  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKDVSASKGTITLSVSKSKPET  302

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  303  GEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  338



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS GKIT SVT +KPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTASSKGKITLSVTKTKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  296  GELIGVFESIQPSDTDLGAKVPKDVKIQGVWYAQLD  331



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SSTGKIT SVT +KPET
Sbjct  168  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSTGKITLSVTKTKPET  227

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  228  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  263



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SSTGKIT SVT +KPET
Sbjct  234  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSTGKITLSVTKTKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  294  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  329



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  296  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  296  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  296  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT SKPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTQSKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  293  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS GKIT SVT SKPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQSKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  293  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  298  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  333



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ ASS+GKIT SVT SKPET
Sbjct  220  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAASSSGKITLSVTKSKPET  279

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  280  GEVIGVFESLQPSDTDLGAKTPKDVKITGVWYAQLD  315



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS GKIT SVT +KPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  293  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   172 bits (437),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNSAASVGEITLKVTKSKPET  296

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  297  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   172 bits (437),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS GKIT SVT +KPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  293  GEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  296  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  331



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT +KPET
Sbjct  235  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPET  294

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  295  GEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  330



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G IT  +T SKPET
Sbjct  281  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGDITLRITKSKPET  340

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  341  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  376



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT SKPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKSKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQL+
Sbjct  293  GEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLD  328



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ ASS+GKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAASSSGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  296  GEVIGVFESLQPSDTDLGAKTPKDVKITGVWYAQLD  331



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGTSTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTQSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+IGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  296  GEIIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  331



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNTAASVGEITLKITKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ ASS+GKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAASSSGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  296  GEVIGVFESLQPSDTDLGAKTPKDVKITGVWYAQLD  331



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G IT  +T SKPET
Sbjct  241  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGDITLKITKSKPET  300

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  301  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  336



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+ +SSTG IT SVT SK E+
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKDPSSSTGTITLSVTKSKTES  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  296  GEVIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE+L KEN K+VASS+GKIT SVT ++PET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEDLAKENNKSVASSSGKITLSVTKTRPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLG+KAPK+VKI GIWYAQL+
Sbjct  296  GEVIGVFESLQPSDTDLGSKAPKDVKITGIWYAQLD  331



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT +KPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  293  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS G IT SV+ SKPET
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENNKNTASSKGTITLSVSKSKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  294  GEVIGVFQSLQPSDTDLGAKTPKDVKIEGIWYAQLE  329



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G IT  +T SKPET
Sbjct  239  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGDITLKITKSKPET  298

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  299  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  334



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+ +SSTG I+ SVT SKPE+
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKDPSSSTGTISLSVTKSKPES  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYA+LE
Sbjct  296  GEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAKLE  331



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPET
Sbjct  252  RGPSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPET  311

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+SLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  312  GEVIGVFQSLQPSDTDLGAKVPKDVKIQGVWYGQLE  347



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT +KPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQL+
Sbjct  293  GEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLD  328



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A S G IT  +T SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAGSVGDITLKITKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  298  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  333



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 87/102 (85%), Gaps = 6/102 (6%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASS------TGKITFSVT  406
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN          TG IT SVT
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENIKNXXXXXXXSSSTGSITLSVT  297

Query  405  GSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
             SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  298  KSKPETGEVIGVFESLQPSDTDLGAKTPKDVKIQGVWYAQLE  339



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDP  RGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+
Sbjct  239  RGSSFLDPX-RGGSTGYDNAVALPAGGRGDEEELTKENIKNSSSSTGTITLSVTKSKPES  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFESLQPSDTDLGAK PK+VKIQGI YAQLE
Sbjct  298  GEVIGVFESLQPSDTDLGAKVPKDVKIQGIRYAQLE  333



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ + S GKI  SVT +KPET
Sbjct  233  RGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASFSKGKIPLSVTKTKPET  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QP DTDLGAKAPK+VKIQG+WYAQLE
Sbjct  293  GEVIGVFESVQPFDTDLGAKAPKDVKIQGVWYAQLE  328



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA ALP GGRGDEEEL KEN+KN +SSTG IT SVT SKPET
Sbjct  230  RGSSFLDPKGRGGSTGYDNAGALPRGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET  289

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDL  +APK+VKIQG+WYAQLE
Sbjct  290  GEVIGVFESVQPSDTDL--EAPKDVKIQGVWYAQLE  323



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S G+ITFSVT SKPE+
Sbjct  225  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELDKENNKNTAASVGEITFSVTKSKPES  282

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIG+FES+QPSDTDLGAK PK+VKIQGIWYA+LE
Sbjct  283  GEVIGLFESIQPSDTDLGAKTPKDVKIQGIWYAKLE  318



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+   +L
Sbjct  298  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVCATEL  332



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   162 bits (409),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 86/96 (90%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S GKIT SVT S PE+
Sbjct  232  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKNTAASVGKITLSVTKSNPES  289

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVF+S+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  290  GEVIGVFQSIQPSDTDLGAKTPKDVKIQGIWYAQLE  325



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPET
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPET  297

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEVIGVFESLQPSDTDLGAK PK+VKIQG+   +L
Sbjct  298  GEVIGVFESLQPSDTDLGAKVPKDVKIQGVCATEL  332



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 85/96 (89%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S PE 
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKDTTASLGKITFSVTKSNPER  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  296  GEVIGVFESIQPSDTDLGAKNPKDVKIQGIWYAQLE  331



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 85/96 (89%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S GKIT SVT S PE+
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENSKNTAASLGKITLSVTKSNPES  291

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
             EVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  292  REVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  327



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   159 bits (402),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S G+ITFSVT SKPE+
Sbjct  225  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELDKENNKNTAASVGEITFSVTKSKPES  282

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVI +FES+QPSDTDLGAK P++VKIQGIWYA+LE
Sbjct  283  GEVISLFESIQPSDTDLGAKTPEDVKIQGIWYAKLE  318



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KNVASSTGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKNVASSTGKITLSVTQSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  296  GEVIGVFESIQPSDTDLGSKAPKDVKIQGVWYAQLD  331



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KNVASSTGKIT SVT SKPET
Sbjct  234  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKNVASSTGKITLSVTKSKPET  293

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  294  GEVIGVFESVQPSDTDLGSKAPKDVKIQGVWYAQLD  329



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 85/96 (89%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S P+T
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELSKENNKDTTASLGKITFSVTKSNPKT  294

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
             EVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  295  REVIGVFESIQPSDTDLGAKNPKDVKIQGIWYAQLE  330



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 87/96 (91%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S G+ITFSVT SKPE+
Sbjct  220  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELDKENNKNTAASVGEITFSVTKSKPES  277

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVI +FES+QPSDT+LGAK P++VKIQGIWYA+LE
Sbjct  278  GEVISLFESIQPSDTNLGAKTPEDVKIQGIWYAKLE  313



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KNVA+ TGKIT SVT SKPET
Sbjct  236  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKNVAALTGKITLSVTKSKPET  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEVIGVFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  296  GEVIGVFESIQPSDTDLGSKAPKDVKIQGVWYAQLD  331



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+ + STG IT  V  S   T
Sbjct  233  RGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKDTSGSTGNITLKVAESNTAT  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLG+KAPKEVKIQGIWYAQL+
Sbjct  293  GEIAGVFESIQPSDTDLGSKAPKEVKIQGIWYAQLD  328



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+ + STG IT  V  S   T
Sbjct  233  RGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKDTSGSTGNITLKVAESNTAT  292

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLG+KAPKEVKIQGIWYAQL+
Sbjct  293  GEIAGVFESIQPSDTDLGSKAPKEVKIQGIWYAQLD  328



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN A+  G ITFS+  S  ET
Sbjct  231  RGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKNTAALNGNITFSIAKSNTET  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLG+KAPKEVKI+GI+YAQL+
Sbjct  291  GEIAGTFESIQPSDTDLGSKAPKEVKIEGIFYAQLD  326



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN A+  G ITFS+  S  ET
Sbjct  179  RGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKNTAALNGNITFSIAKSNVET  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLG+KAPKEVKI+GI+YAQ+E
Sbjct  239  GEIAGTFESIQPSDTDLGSKAPKEVKIEGIFYAQVE  274



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN A+  G ITFS+  S  ET
Sbjct  231  RGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKNTAALNGNITFSIAKSNTET  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLG+K PKEVKI+GI+YAQLE
Sbjct  291  GEIAGTFESIQPSDTDLGSKTPKEVKIEGIFYAQLE  326



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+ + STG IT  V  S   T
Sbjct  149  RGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKDTSGSTGNITLKVAESNTAT  208

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLG+KAPKEVKIQGIW AQL+
Sbjct  209  GEIAGVFESIQPSDTDLGSKAPKEVKIQGIWCAQLD  244



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN A+  G ITFS+  S  +T
Sbjct  231  RGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKNTAALNGNITFSIAKSNVQT  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLG+KAPKEVKI+GI+YAQL+
Sbjct  291  GEIAGTFESFQPSDTDLGSKAPKEVKIEGIFYAQLD  326



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGG GD ++L+KEN+K+ +++ G I F+V  S PE+
Sbjct  242  RGSSFLDPKGRGGSTGYDNAVALPAGGSGDRDDLEKENLKSTSAAEGNIVFTVAQSNPES  301

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEV+G FES+QPSDTDLGAK  KEVKI GIWY QL+
Sbjct  302  GEVVGTFESVQPSDTDLGAKQAKEVKISGIWYGQLK  337



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN K+VA+S G   FSV    P T
Sbjct  198  RGSSFLDPKGRGGSTGYDNAVALPA--RADSEELAKENTKSVAASKGSAAFSVAVVDPAT  255

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLGAKAPK++KI+G+WYAQL+
Sbjct  256  GEIAGVFESIQPSDTDLGAKAPKDIKIKGLWYAQLK  291



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 79/91 (87%), Gaps = 2/91 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S PE 
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKDTTASLGKITFSVTKSNPER  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIW  295
            GEVIGVFES+QPSDTDLGAK PK+VKIQGI 
Sbjct  296  GEVIGVFESIQPSDTDLGAKNPKDVKIQGIC  326



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S P+T
Sbjct  237  RGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELSKENNKDTTASLGKITFSVTKSNPKT  294

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGI  298
             EVIGVFES+QPSDTDLGAK PK+VKIQGI
Sbjct  295  REVIGVFESIQPSDTDLGAKNPKDVKIQGI  324



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRGGS GYD AVALPAGG GDE+ LQKEN K+  + +G ITFSV  S  ET
Sbjct  230  RGATFLDPKGRGGSQGYDTAVALPAGGFGDEDALQKENQKSYKALSGNITFSVAKSNVET  289

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVF S+QPSDTD+GAK PK+VKI+GIWYAQL+
Sbjct  290  GEIGGVFTSVQPSDTDMGAKVPKDVKIEGIWYAQLD  325



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+KN  +  G   FSV    P T
Sbjct  198  RGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKNTKALKGSAVFSVAKVDPVT  255

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLGAKAPK++K+ G+WYAQL+
Sbjct  256  GEIAGVFESIQPSDTDLGAKAPKDIKVTGLWYAQLK  291



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EELQKEN KN A+  G   F+V    P T
Sbjct  207  RGSSFLDPKGRGGSTGYDNAVALPA--RADSEELQKENQKNTAALKGSAVFNVAKYDPAT  264

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGAK PK+VKI G+WYA L
Sbjct  265  GEIAGVFESIQPSDTDLGAKVPKDVKITGLWYANL  299



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 78/96 (81%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  + D +EL KEN KNVA+  G   F+V    P T
Sbjct  210  RGSSFLDPKGRGGSTGYDNAVALPA--KSDADELLKENNKNVAALKGSAVFNVAKYDPVT  267

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEV GVFES+QPSDTDLG+KAPK+VKI G+WYAQL+
Sbjct  268  GEVAGVFESIQPSDTDLGSKAPKDVKITGLWYAQLQ  303



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGS+FLDPKGRG +TGYD AVA+PAGG GDEEEL KEN K++   +GK   S+    P T
Sbjct  235  RGSTFLDPKGRGAATGYDTAVAIPAGGAGDEEELVKENNKSIKPLSGKAVLSIAKYDPAT  294

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV GVF+S+QPSDTDLGAK PK++KIQG+WYAQL
Sbjct  295  GEVAGVFQSVQPSDTDLGAKVPKDIKIQGLWYAQL  329



>gb|AAR20846.1| oxygen-evolving enhancer protein 1 [Pseudochlorella pringsheimii]
Length=173

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNA ALPA  R D +ELQKEN K+VA+  G+  FS+    P T
Sbjct  79   RGSSFLDPKGRGGSTGYDNAXALPA--RSDPDELQKENNKSVAALKGQAVFSIAKVDPAT  136

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  137  GEIAGVFESIQPSDTDLGSKAPKDVKIIGLWYGQL  171



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D ++LQKEN KNVA+  G   F+V      T
Sbjct  238  RGSSFLDPKGRGGSTGYDNAVALPA--RSDADDLQKENNKNVAALKGSAVFNVAKYDETT  295

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL+
Sbjct  296  GEIAGVFESIQPSDTDLGSKAPKDVKITGLWYMQLQ  331



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D+EEL KEN KN A+  G I  SV      T
Sbjct  213  RGSSFLDPKGRGGSTGYDNAVALPA--RSDDEELFKENNKNTAALKGSIVLSVAKVDAST  270

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  271  GEIAGVFESIQPSDTDLGSKAPKDVKITGLWYGQL  305



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGS+FLDPKGRG +TGYD AVA+PAGG GDEE L KEN K++    GK   S+    P T
Sbjct  231  RGSTFLDPKGRGAATGYDTAVAIPAGGAGDEEALGKENNKSIKPLVGKAQLSIAKYDPAT  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV GVF+S+QPSDTDLGAK PK++K+QG+WYAQL
Sbjct  291  GEVAGVFQSVQPSDTDLGAKVPKDIKVQGVWYAQL  325



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K   +  G   FSV    P T
Sbjct  198  RGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKITKALKGSAVFSVAKVDPVT  255

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLGAK PK++K+ G+WYAQL+
Sbjct  256  GEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK  291



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K   +  G   FSV    P T
Sbjct  198  RGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKITKALKGSAVFSVAKVDPVT  255

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLGAK PK++K+ G+WYAQL+
Sbjct  256  GEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK  291



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALP  GR D EEL KEN K+  +  G+  FSV    P T
Sbjct  222  RGSSFLDPKGRGGSTGYDNAVALP--GRSDSEELAKENNKSTVALKGQAVFSVAKVDPAT  279

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  280  GEIAGVFESIQPSDTDLGSKAPKDVKITGLWYGQL  314



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYD AVALPA G  D EEL KEN K+ AS TG   F+V      T
Sbjct  167  RGSSFLDPKGRGASTGYDTAVALPAAG--DAEELAKENNKSAASLTGSAVFNVAKYDAAT  224

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLGAKAPK+VKI G+WYAQL+
Sbjct  225  GEIAGVFESIQPSDTDLGAKAPKDVKITGLWYAQLK  260



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  + D +EL KEN KNVA+  G   F+V      T
Sbjct  209  RGSSFLDPKGRGGSTGYDNAVALPA--KSDADELLKENNKNVAALKGSAVFNVAKYDEVT  266

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLG+KAPK+VKI G+WYAQL
Sbjct  267  GEIAGVFESIQPSDTDLGSKAPKDVKITGLWYAQL  301



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EELQKEN K+ A+  G   F++    P T
Sbjct  208  RGSSFLDPKGRGGSTGYDNAVALPA--RADSEELQKENNKSAAALKGSAVFNIAKYDPAT  265

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGAK PK+VKI G+WY  +
Sbjct  266  GEIAGVFESIQPSDTDLGAKVPKDVKITGLWYGNI  300



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGS+FLDPKGRG +TGYDNAVALPA    D EE  KENIK+ A+  G+  FS+    P T
Sbjct  204  RGSTFLDPKGRGAATGYDNAVALPAAS--DAEEFLKENIKSTAAMKGQAVFSIAKVDPVT  261

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGAKAPK+VKI G+WYAQL
Sbjct  262  GEIAGVFESVQPSDTDLGAKAPKDVKITGLWYAQL  296



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K+  +  G   FSV      T
Sbjct  203  RGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKSTKALKGSAVFSVAKVNTAT  260

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGAK PK++KI G+WY QL
Sbjct  261  GEIAGVFESIQPSDTDLGAKPPKDIKITGLWYGQL  295



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGS+FLDPKGRG +TGYD AVA+PAGG GDE+ L KEN K++    GK   S+      T
Sbjct  231  RGSTFLDPKGRGAATGYDTAVAIPAGGAGDEDALGKENNKSIKPLAGKAQLSIAKYDAAT  290

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEV GVF+S+QPSDTDLGAK PK++KIQG+WYAQL+
Sbjct  291  GEVAGVFQSIQPSDTDLGAKVPKDIKIQGLWYAQLQ  326



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K+  +  G   FSV      T
Sbjct  199  RGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKSTKALKGSAVFSVAKVNTAT  256

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGAK PK++KI G+WY QL
Sbjct  257  GEIAGVFESIQPSDTDLGAKPPKDIKITGLWYGQL  291



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPA  R D EEL KEN K+ ASS G   FS+    P T
Sbjct  196  RGSSFLDPKGRGASTGYDNAVALPA--RADAEELAKENSKSAASSKGSAVFSIAKVDPVT  253

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEV GVFES+QPSDTDLGAK PK++KI GIWYAQL+
Sbjct  254  GEVAGVFESIQPSDTDLGAKTPKDIKITGIWYAQLQ  289



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYD AV LPA  +GD EEL KENIK+ A+  G   FSV      T
Sbjct  209  RGSSFLDPKGRGGSTGYDTAVGLPA--KGDAEELLKENIKSTAALKGSAVFSVAKVDSGT  266

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV G+FES+QPSDTDLGAK PK+VKI G+WY Q+
Sbjct  267  GEVAGIFESVQPSDTDLGAKVPKDVKITGVWYGQI  301



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVALPA    D EEL KEN KN+A S G I F V     ET
Sbjct  251  RGATFLDPKGRGAATGYDNAVALPAAS--DTEELAKENTKNIAGSVGTIAFKVAKVNTET  308

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV GVFES+QPSDTDLG+K PK++K  G+WY Q+
Sbjct  309  GEVAGVFESIQPSDTDLGSKVPKDIKTAGVWYGQI  343



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG STGYDNAVALPA G  D EEL+KEN K+  +  G+  FS+      T
Sbjct  210  RGSSFLDPKGRGASTGYDNAVALPAAG--DSEELEKENNKSTKALKGEAIFSIAKVDAGT  267

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV G+FES+QPSDTDLGAK PKEVKI G+WY QL
Sbjct  268  GEVAGIFESIQPSDTDLGAKVPKEVKITGLWYGQL  302



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRGG++GYD AVALPA G  D+EE  KEN K+ A+S G I F V     ET
Sbjct  288  RGATFLDPKGRGGASGYDTAVALPASG--DDEEYAKENSKSTAASVGTIAFKVAKVNAET  345

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGAK PK++K  G+WYAQ+
Sbjct  346  GEIAGVFESIQPSDTDLGAKVPKDIKTSGVWYAQI  380



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRGG++GYD AVALPA G  D+EE  KEN K+ A+S G I F V     ET
Sbjct  242  RGATFLDPKGRGGASGYDTAVALPASG--DDEEYAKENSKSTAASVGTIAFKVAKVNAET  299

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGAK PK++K  G+WYAQ+
Sbjct  300  GEIAGVFESIQPSDTDLGAKVPKDIKTSGVWYAQI  334



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+T
Sbjct  226  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQT  285

Query  387  GEVIGVFES  361
            GEVIGVFES
Sbjct  286  GEVIGVFES  294



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGS+FLDPKGRGGSTGYD A AL    R D+E L+ EN+K   S  G++ FSV    P T
Sbjct  177  RGSTFLDPKGRGGSTGYDTAHALHT--RADDEALESENLKKFDSGIGQVVFSVAKVDPGT  234

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV GVFES+QPSDTD+GAK PK+VK+QG+WY QL
Sbjct  235  GEVAGVFESVQPSDTDMGAKVPKQVKVQGLWYGQL  269



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGS+FLDPKGRG S GY++A+AL      D+E + KEN+K+VA+S G   FSV    P T
Sbjct  196  RGSTFLDPKGRGASQGYESAIALQTAQ--DDEFVLKENVKSVAASKGSAVFSVAKVDPST  253

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLGAKAPK+VKI G+WYAQL+
Sbjct  254  GEIAGVFESVQPSDTDLGAKAPKDVKITGLWYAQLQ  289



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPET
Sbjct  102  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPET  161

Query  387  GEVIGV  370
            GE+IGV
Sbjct  162  GEIIGV  167



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPET
Sbjct  102  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPET  161

Query  387  GEVIG  373
            GE+IG
Sbjct  162  GEIIG  166



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPET
Sbjct  103  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPET  162

Query  387  GEVIG  373
            GE+IG
Sbjct  163  GEIIG  167



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPET
Sbjct  96   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPET  155

Query  387  GEV  379
            GE+
Sbjct  156  GEI  158



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPET
Sbjct  102  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPET  161

Query  387  GEV  379
            GE+
Sbjct  162  GEI  164



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPET
Sbjct  200  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPET  259

Query  387  GEVI  376
            GE+I
Sbjct  260  GELI  263



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVA       D EEL KEN+KN A+  G   F+V    P+T
Sbjct  210  RGATFLDPKGRGNATGYDNAVA--LPAAADAEELLKENVKNTAALKGSAVFNVAKFDPKT  267

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV GVFES+QPSDTDLGAKAPK+VKI G+WYAQ+
Sbjct  268  GEVAGVFESIQPSDTDLGAKAPKDVKITGLWYAQI  302



>ref|WP_017293645.1| hypothetical protein [Geminocystis herdmanii]
Length=277

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRG ++GYDNAVALPAG   D+ E  + NIKN  S  G+I+  +T    ET
Sbjct  181  RGASFLDPKGRGLTSGYDNAVALPAGA--DKTEYTRNNIKNADSYEGEISLQITKVDQET  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES QPS TDLGA+ P+EVKI+G++YA+LE
Sbjct  239  GEISGVFESEQPSSTDLGAEDPEEVKIRGVFYARLE  274



>ref|WP_035997199.1| Photosystem II manganese-stabilizing polypeptide [Leptolyngbya 
sp. JSC-1]
Length=274

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            R S+FLDPKGRG + GYDNAVALP+  R D EE+ KEN+K   + TG+I+  V      T
Sbjct  179  RTSNFLDPKGRGLTAGYDNAVALPS--RADSEEILKENLKRFDTGTGRISLQVAKVNSTT  236

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEV G FES+QPSDTD+G+KAP +VKI+G++YA++E
Sbjct  237  GEVAGTFESIQPSDTDMGSKAPVDVKIRGLFYARVE  272



>ref|WP_026721744.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9431]
Length=277

 Score =   116 bits (290),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + D+EEL + N+K V    GKI+ SV      T
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--QSDDEELLRANVKRVDVLNGKISLSVAKVDSST  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PK+VK++GI+YA+LE
Sbjct  238  GEIAGTFESDQPSDTDLGAGEPKDVKVRGIFYARLE  273



>ref|WP_009456798.1| MULTISPECIES: photosystem II manganese-stabilizing protein PsbO 
[Fischerella]
 gb|EHC13949.1| photosystem II manganese-stabilizing protein PsbO [Fischerella 
sp. JSC-11]
Length=277

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + D+EEL + N+K      GKI+ SV      T
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--QSDDEELLRANVKRADVMNGKISLSVAKVDSST  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVK++GI+YA+LE
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKVRGIFYARLE  273



>ref|WP_015219672.1| photosystem II manganese-stabilizing protein PsbO [Cyanobacterium 
aponinum]
 gb|AFZ53945.1| photosystem II manganese-stabilizing protein PsbO [Cyanobacterium 
aponinum PCC 10605]
Length=277

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRG S+GYDNAVALPAG   D+E+  + N+K   +  G+I+  +T    ET
Sbjct  181  RGASFLDPKGRGLSSGYDNAVALPAGA--DKEDYLRSNLKQYETRNGEISLQITKVDGET  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES QPS TDLGA+ P+EVKI+G++YA+LE
Sbjct  239  GEISGVFESEQPSSTDLGAEEPEEVKIRGVFYARLE  274



>ref|WP_016865127.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYD+AVALPA  + D+EEL + N+K      GKI+ SV      T
Sbjct  180  RGATFLDPKGRGVATGYDSAVALPA--QSDDEELLRANVKRADVLNGKISLSVAKVDSST  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVK++GI+YA+LE
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKVRGIFYARLE  273



>ref|WP_026733494.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9605]
Length=276

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVALPA  + D+EEL + N+K      GKI+ SV      T
Sbjct  179  RGATFLDPKGRGVATGYDNAVALPA--QSDDEELTRANVKRTDILNGKISLSVAKVDSAT  236

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PK+VKI+GI+YA++E
Sbjct  237  GEIAGTFESEQPSDTDLGAGEPKDVKIRGIFYARVE  272



>ref|WP_041036292.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
campylonemoides]
 gb|KIJ75950.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
campylonemoides VB511288]
Length=277

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRG ++GYDNAVALPA  + D+EEL++ N+K      GKI+  V      T
Sbjct  180  RGASFLDPKGRGVTSGYDNAVALPA--QSDDEELRRANVKQAEILKGKISLQVAKVDNST  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGAK P+EVK++G++YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGAKEPEEVKVRGLFYARVE  273



>ref|WP_017310215.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9339]
Length=277

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + D+EEL + N+K      GKI+ SV      T
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--QSDDEELLRANVKRADVLNGKISLSVAKVDSST  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PK+VK++GI+YA+LE
Sbjct  238  GEIAGTFESDQPSDTDLGAGEPKDVKVRGIFYARLE  273



>ref|WP_017720228.1| Photosystem II manganese-stabilizing polypeptide [Oscillatoria 
sp. PCC 10802]
Length=274

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRG +TGYDNAVA PAG   D EEL + N+K    S GKI+  ++     T
Sbjct  178  RGSSFLDPKGRGEATGYDNAVATPAGA--DREELIRANVKRAEVSKGKISLQISKVDSST  235

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G+FES QPSDTDLGA+ P EVKI+G++Y +++
Sbjct  236  GEIAGIFESEQPSDTDLGAQEPLEVKIRGVFYGRVQ  271



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+T
Sbjct  244  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDT  303

Query  387  GEVIGVFE  364
            GEVI V E
Sbjct  304  GEVICVRE  311



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPE  391
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPE
Sbjct  102  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPE  160



>ref|WP_019494816.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
PCC 7103]
Length=276

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  R D EEL +EN+K      G ++ SV      +
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--RSDAEELTRENVKRAQVLEGNVSLSVAKINSAS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLG+  PKEVKI+GI+Y ++E
Sbjct  238  GEIAGTFESIQPSDTDLGSGDPKEVKIRGIFYGRIE  273



>ref|WP_016860504.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + D+EEL + N+K      GKI+ SV      +
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--QSDDEELLRANVKRADVLNGKISLSVAKVDSSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PK+VK++GI+YA+LE
Sbjct  238  GEIAGTFESDQPSDTDLGAGEPKDVKVRGIFYARLE  273



>ref|WP_035156929.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
336/3]
 gb|KFB85527.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
336/3]
Length=276

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + D+EEL + N+K      GKI+ ++      T
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--QSDDEELTRANVKRTEVLNGKISLNIAKVNSST  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVK++G++YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKVRGLFYARVE  273



>ref|WP_037222014.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis]
 emb|CDN14735.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis]
Length=280

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA    D+ EL + N+K+ +   G I+ SV      T
Sbjct  183  RGATFLDPKGRGVASGYDNAVALPADA--DDTELARANVKSFSVLDGNISMSVAKVDSST  240

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLGA  P+EVKI+G++YA++E
Sbjct  241  GEIAGTFESIQPSDTDLGADEPEEVKIRGLFYARIE  276



>gb|KIY93348.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=93

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -1

Query  540  GRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFES  361
            GRG S GY++A+AL      D+E + KEN+K+VA+S G   FSV    P TGE+ GVFES
Sbjct  9    GRGASQGYESAIALQTAQ--DDEFVLKENVKSVAASKGSAVFSVAKVDPSTGEIAGVFES  66

Query  360  LQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            +QPSDTDLGAKAPK+VKI G+WYAQL+
Sbjct  67   VQPSDTDLGAKAPKDVKITGLWYAQLQ  93



>ref|WP_015196540.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
parietina]
 gb|AFY99885.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
sp. PCC 6303]
Length=276

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  R D EEL +EN+K      G+I+ SV      +
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--RSDAEELTRENVKRAQVLEGEISLSVAKIDSVS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLG+  PKEVKI+G++YA++E
Sbjct  238  GEIAGTFESNQPSDTDLGSGDPKEVKIRGVFYARVE  273



>ref|WP_016872421.1| Photosystem II manganese-stabilizing polypeptide [Chlorogloeopsis 
fritschii]
Length=277

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + DEE+L + N+K      GKI+ S+      T
Sbjct  180  RGATFLDPKGRGVASGYDNAVALPA--QSDEEQLLRANVKRADVLEGKISLSIAKVDSAT  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  P+EVK++GI+YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGADEPEEVKVRGIFYARVE  273



>ref|WP_017314485.1| Photosystem II manganese-stabilizing polypeptide [Mastigocladopsis 
repens]
Length=277

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + D+EEL+  N+K      GKI+  V      T
Sbjct  180  RGAAFLDPKGRGVTSGYDNAVALPA--QSDDEELKNANVKRAEVLQGKISLQVAKIDNST  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGAK P+EVK++G++YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGAKEPEEVKVRGLFYARVE  273



>emb|CAA33560.1| manganese-stabilzing protein (MSP) precursor [Nostoc sp. PCC 
7120]
Length=273

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGS+FLDPKGRG  +GYDNAVALPA  + D+E+L + N+K      GKI+  +      +
Sbjct  180  RGSAFLDPKGRGVVSGYDNAVALPA--QADDEDLTRTNVKRAEILNGKISLQIAKVDSSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+GI+YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGADEPKEVKIRGIFYARVE  273



>emb|CCH65457.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis HM01]
Length=209

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVALPA    D+ +L + N+K+ +   G I+ SV      T
Sbjct  112  RGATFLDPKGRGVATGYDNAVALPADA--DDTDLNRANVKSFSVLDGNISLSVAKVDGST  169

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLGA  P+EVKI+G++YA +E
Sbjct  170  GEIAGTFESIQPSDTDLGADEPEEVKIRGLFYALIE  205



>ref|WP_036480960.1| Photosystem II manganese-stabilizing polypeptide [Myxosarcina 
sp. GI1]
Length=275

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG  FLDPKGR  ++GYDNAVALPA  R D+EE  + N+K   S  G+++ +VT    ET
Sbjct  179  RGQVFLDPKGRSLASGYDNAVALPA--RADDEEFTRANVKEFVSRKGRMSLNVTKVDTET  236

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES QPS TDLGA+ P+EVK++GI+Y ++E
Sbjct  237  GEIAGVFESEQPSATDLGAEEPEEVKVRGIFYGRVE  272



>ref|WP_044259457.1| Photosystem II manganese-stabilizing protein (PsbO), partial 
[Richelia intracellularis]
Length=217

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVALPA    D+ +L + N+K+ +   G I+ SV      T
Sbjct  120  RGATFLDPKGRGVATGYDNAVALPADA--DDTDLNRANVKSFSVLDGNISLSVAKVDGST  177

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLGA  P+EVKI+G++YA +E
Sbjct  178  GEIAGTFESIQPSDTDLGADEPEEVKIRGLFYALIE  213



>gb|AHJ27766.1| Photosystem II manganese-stabilizing protein (PsbO) [Nodularia 
spumigena CCY9414]
Length=235

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRG  +GYDNAVALPA  + D+EEL + N+K V +  G I+  V      +
Sbjct  138  RGASFLDPKGRGVVSGYDNAVALPA--QADDEELTRANVKRVETLDGTISLQVAKVDSVS  195

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  196  GEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYARVE  231



>ref|WP_015204171.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum]
 gb|AFZ14065.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum PCC 9333]
Length=277

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+ FLDPKGRG ++GYDNAVALP+    D E+L++ N+K V +  GKI+  V      T
Sbjct  180  RGAVFLDPKGRGVASGYDNAVALPS--EADSEQLRRANVKRVETGKGKISLQVAKVDSNT  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GEV G FES QPSDTDLGA  PKEVK++GI+YA++
Sbjct  238  GEVAGTFESEQPSDTDLGADDPKEVKVRGIFYARI  272



>ref|WP_017662186.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=277

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPK RG +TGYDNAVALPA    D EE+ +EN+K      G+I   V+    +T
Sbjct  181  RGATFLDPKARGQATGYDNAVALPAAA--DNEEIVRENVKRTPVLDGEIELQVSKVNSQT  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GEV G+F+++QPSDTDLGAK P EVKI+G++Y ++E
Sbjct  239  GEVAGIFQAIQPSDTDLGAKEPVEVKIRGLFYGRVE  274



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RGSSFLDPKGRGGSTGYD AVALPA  RGD+E L KEN KN A+  G I  S     P T
Sbjct  261  RGSSFLDPKGRGGSTGYDTAVALPA--RGDDEGLAKENSKNTAALKGSIVLSAAKVDPAT  318

Query  387  GEVIGVFESLQPSDTDLGAKAPK  319
            GE+ GVF+S+QPSDTDLGAK+PK
Sbjct  319  GEIAGVFQSIQPSDTDLGAKSPK  341



>ref|WP_006197397.1| Photosystem II manganese-stabilizing protein PsbO [Nodularia 
spumigena]
 gb|EAW44426.1| Photosystem II manganese-stabilizing protein PsbO [Nodularia 
spumigena CCY9414]
Length=278

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRG  +GYDNAVALPA  + D+EEL + N+K V +  G I+  V      +
Sbjct  181  RGASFLDPKGRGVVSGYDNAVALPA--QADDEELTRANVKRVETLDGTISLQVAKVDSVS  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  239  GEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYARVE  274



>ref|WP_027841041.1| Photosystem II manganese-stabilizing polypeptide [Mastigocoleus 
testarum]
Length=277

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVALPA  + D+EEL + N+K      GK++ S++    +T
Sbjct  180  RGATFLDPKGRGVATGYDNAVALPA--QADDEELLRANVKRTEVLDGKMSLSISKVNSDT  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G F S QPSDTDLGA  PKEVKIQGI+Y  +E
Sbjct  238  GEIAGTFISEQPSDTDLGAGDPKEVKIQGIFYGLVE  273



>ref|WP_015139796.1| Manganese-stabilising protein / photosystem II polypeptide [Nostoc 
sp. PCC 7524]
 gb|AFY49369.1| Manganese-stabilising protein / photosystem II polypeptide [Nostoc 
sp. PCC 7524]
Length=277

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPA  + D+EEL + N+K      GKI+  V      +
Sbjct  180  RGAAFLDPKGRGIVSGYDNAVALPA--QADDEELTRANVKRAEILNGKISLQVAKVDSSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  238  GEIAGTFESNQPSDTDLGADEPKEVKIRGLFYARVE  273



>ref|WP_011318645.1| photosystem II manganese-stabilizing protein PsbO [Anabaena variabilis]
 gb|ABA21465.1| Photosystem II manganese-stabilizing protein PsbO [Anabaena variabilis 
ATCC 29413]
Length=273

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPA  + D+E+L + N+K      GKI+  +      +
Sbjct  180  RGAAFLDPKGRGVVSGYDNAVALPA--QADDEDLTRTNVKRAEILNGKISLQIAKVDSSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+GI+YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGADEPKEVKIRGIFYARVE  273



>ref|WP_008233010.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis]
 emb|CCH66961.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis HH01]
Length=280

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVALPA    D+ +L + N+K+ +   G I+ SV      T
Sbjct  183  RGATFLDPKGRGVATGYDNAVALPADA--DDTDLNRANVKSFSVLDGSISLSVAKVDGST  240

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES+QPSDTDLGA  P+EVKI+G++YA +E
Sbjct  241  GEIAGTFESIQPSDTDLGADEPEEVKIRGLFYALIE  276



>ref|WP_010997995.1| manganese-stabilzing protein [Nostoc sp. PCC 7120]
 sp|P13907.2|PSBO_NOSS1 RecName: Full=Photosystem II manganese-stabilizing polypeptide; 
Short=MSP; Flags: Precursor [Nostoc sp. PCC 7120]
 dbj|BAB75553.1| manganese-stabilzing protein precursor [Nostoc sp. PCC 7120]
Length=273

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPA  + D+E+L + N+K      GKI+  +      +
Sbjct  180  RGAAFLDPKGRGVVSGYDNAVALPA--QADDEDLTRTNVKRAEILNGKISLQIAKVDSSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+GI+YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGADEPKEVKIRGIFYARVE  273



>ref|WP_015209602.1| Manganese-stabilising protein / photosystem II polypeptide [Cylindrospermum 
stagnale]
 gb|AFZ26360.1| Manganese-stabilising protein / photosystem II polypeptide [Cylindrospermum 
stagnale PCC 7417]
Length=277

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPA  + D+EEL + N+K     +GKI+  V      +
Sbjct  180  RGAAFLDPKGRGVVSGYDNAVALPA--QADDEELTRTNVKRAEILSGKISLQVAKVDNSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYARVE  273



>ref|WP_015223075.1| photosystem II manganese-stabilizing protein PsbO [Cyanobacterium 
stanieri]
 gb|AFZ47759.1| photosystem II manganese-stabilizing protein PsbO [Cyanobacterium 
stanieri PCC 7202]
Length=277

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+SFLDPKGRG ++GYDNAVALPAG   D  E  + N+K   +  G+++  +T    ET
Sbjct  181  RGASFLDPKGRGLTSGYDNAVALPAGA--DNSEYTRSNLKQAETMNGEMSLQITKVDAET  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G+FES QPS TDLGA+ P+EVKI+G +YA+LE
Sbjct  239  GEIAGIFESEQPSSTDLGAEEPEEVKIRGSFYARLE  274



>ref|NP_195440.1| photosystem II manganese-stabilising protein (PsbO) [Arabidopsis 
thaliana]
 emb|CAB16775.1| photosystem II oxygen-evolving complex like protein (partial) 
[Arabidopsis thaliana]
 emb|CAB80389.1| photosystem II oxygen-evolving complex like protein (partial) 
[Arabidopsis thaliana]
 gb|AEE86770.1| photosystem II manganese-stabilising protein (PsbO) [Arabidopsis 
thaliana]
Length=143

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 61/81 (75%), Gaps = 10/81 (12%)
 Frame = -1

Query  522  GYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDT  343
            GYDNAVALPA  RG+ EEL KEN         KIT SVT S PE+GEVIG FES+QPSDT
Sbjct  72   GYDNAVALPA--RGNNEELAKEN--------NKITLSVTKSNPESGEVIGAFESIQPSDT  121

Query  342  DLGAKAPKEVKIQGIWYAQLE  280
            DLGA  PK+VKIQGIWY QL+
Sbjct  122  DLGATTPKDVKIQGIWYCQLD  142



>ref|WP_039205072.1| Photosystem II manganese-stabilizing polypeptide [Aphanizomenon 
flos-aquae]
 gb|KHG39015.1| Photosystem II manganese-stabilizing polypeptide [Aphanizomenon 
flos-aquae 2012/KM1/D3]
Length=276

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPAG   D EEL + N+K      GKI+  V      +
Sbjct  180  RGAAFLDPKGRGVVSGYDNAVALPAGS--DNEELTRTNVKRAEILPGKISLQVAKVDNTS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYARIE  273



>ref|WP_027404713.1| Photosystem II manganese-stabilizing polypeptide [Aphanizomenon 
flos-aquae]
Length=276

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPAG   D EEL + N+K      GKI+  V      +
Sbjct  180  RGAAFLDPKGRGVVSGYDNAVALPAGS--DNEELTRTNVKRAEILPGKISLQVAKVDNTS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYARIE  273



>ref|WP_017322486.1| Photosystem II manganese-stabilizing polypeptide [cyanobacterium 
PCC 7702]
Length=277

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYD AVALPA  + D+EEL + N+K      GKI+ SV      T
Sbjct  180  RGATFLDPKGRGVASGYDAAVALPA--QSDDEELLRANVKRAEVLNGKISLSVAKVDSAT  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PK+VK++GI+YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGADEPKDVKVRGIFYARVE  273



>ref|WP_012411115.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme]
 gb|ACC83159.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme 
PCC 73102]
Length=277

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPA  + D+EEL + N+K   +  GKI+  +      +
Sbjct  180  RGAAFLDPKGRGVVSGYDNAVALPA--QADDEELTRTNVKRAENLNGKISLQIAKVDSSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G+++A++E
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKIRGLFFARVE  273



>ref|WP_022609298.1| manganese-stabilising protein / photosystem II polypeptide [Rubidibacter 
lacunae]
 gb|ERN39876.1| manganese-stabilising protein / photosystem II polypeptide [Rubidibacter 
lacunae KORDI 51-2]
Length=280

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+ FLDPKGRG ++GYDNAVALPA  + D ++L++ N+K V   TG I+  V     +T
Sbjct  181  RGAVFLDPKGRGVASGYDNAVALPA--QADIDDLERANVKRVDRGTGDISLQVQRVNSDT  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA+ P+ VKI+GI+YA LE
Sbjct  239  GEIAGTFESEQPSDTDLGAQEPEAVKIRGIFYAVLE  274



>ref|WP_040939353.1| Photosystem II manganese-stabilizing polypeptide [Prochloron 
didemni]
Length=277

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+ FLDPKGRG +TGY+NAVALPAG   D +E  + N+K + +  G I+  +T     T
Sbjct  181  RGAGFLDPKGRGAATGYENAVALPAGA--DRDEYARSNMKQIDTGKGNISLQITKVDGTT  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES QPSDTDLGA  P+EVKI+GI+Y +++
Sbjct  239  GEIAGVFESEQPSDTDLGADEPEEVKIKGIFYGRIQ  274



>ref|WP_015142403.1| Manganese-stabilising protein / photosystem II polypeptide [Pleurocapsa 
minor]
 gb|AFY76095.1| Manganese-stabilising protein / photosystem II polypeptide [Pleurocapsa 
sp. PCC 7327]
Length=277

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG+ FLDPKGRG  TGYD AVALPA G  DE E  + N+K   +  GKI+  VT    ET
Sbjct  181  RGAGFLDPKGRGVYTGYDTAVALPASG--DEAEYSRANVKETTAGVGKISLQVTKVDGET  238

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  283
            GE+ GVFES+QPSDTDLGA+   +VK++GI+YA++
Sbjct  239  GEIAGVFESVQPSDTDLGARDAVDVKVRGIFYARV  273



>gb|KIE10612.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
bouteillei VB521301]
Length=275

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG ++GYDNAVALPA  + D+ EL   N+K      GKI+  V      T
Sbjct  179  RGATFLDPKGRGVASGYDNAVALPA--QADDRELVNANVKRTDVLKGKISLQVAKVDNVT  236

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGAK P+EVKI+G++YA+LE
Sbjct  237  GEIGGTFESEQPSDTDLGAKEPEEVKIRGLFYARLE  272



>ref|WP_015115272.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
 gb|AFY45079.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
Length=277

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG  +GYDNAVALPA  + D+EEL + N+K      GKI+  V      +
Sbjct  180  RGAAFLDPKGRGIVSGYDNAVALPA--QADDEELTRANVKRAEILKGKISLQVAKIDNSS  237

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  238  GEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYARVE  273



>ref|WP_015785306.1| MULTISPECIES: photosystem II manganese-stabilizing protein PsbO 
[Cyanothece]
 gb|ACK68250.1| photosystem II manganese-stabilizing protein PsbO [Cyanothece 
sp. PCC 8801]
 gb|ACV03176.1| photosystem II manganese-stabilizing protein PsbO [Cyanothece 
sp. PCC 8802]
Length=275

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 4/96 (4%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG++FLDPKGRG +TGYDNAVALPA    D+E+    N+K      G I+  VT    ET
Sbjct  181  RGATFLDPKGRGLATGYDNAVALPA--TADKEDFA--NVKQTPIGKGTISLQVTKVDQET  236

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES+QPSDTDLGA+ P +VKI+GI+YAQ++
Sbjct  237  GEIAGVFESIQPSDTDLGAQEPVDVKIRGIFYAQVQ  272



>ref|WP_019506429.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=275

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  388
            RG  FLDPKGR  ++GYDNAVALP  GR D+ E  K N+K   S  G+++ +VT    ET
Sbjct  179  RGQVFLDPKGRSLASGYDNAVALP--GRADDPEFSKANVKEFVSRKGRMSLNVTKIDSET  236

Query  387  GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  280
            GE+ GVFES QPS TDLGA+ P+EVK++GI+Y +++
Sbjct  237  GEIAGVFESEQPSATDLGAEEPEEVKVRGIFYGRVD  272



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960