BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051L08

Length=424
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB23151.1|  hypothetical protein B456_004G083800                  75.1    8e-13   Gossypium raimondii
gb|KHF97715.1|  putative alpha-ketoglutarate-dependent dioxygenas...  74.7    9e-13   Gossypium arboreum [tree cotton]
ref|XP_011079798.1|  PREDICTED: uncharacterized protein LOC105163227  73.6    3e-12   Sesamum indicum [beniseed]
ref|XP_002271361.1|  PREDICTED: uncharacterized protein LOC100256341  72.0    1e-11   Vitis vinifera
ref|XP_002524804.1|  conserved hypothetical protein                   71.6    1e-11   
ref|XP_009769229.1|  PREDICTED: uncharacterized protein LOC104220112  71.6    1e-11   Nicotiana sylvestris
ref|XP_009599211.1|  PREDICTED: uncharacterized protein LOC104094898  70.9    2e-11   Nicotiana tomentosiformis
ref|XP_011082539.1|  PREDICTED: uncharacterized protein LOC105165276  70.9    2e-11   Sesamum indicum [beniseed]
gb|KDP21510.1|  hypothetical protein JCGZ_21981                       70.5    3e-11   Jatropha curcas
gb|EPS57869.1|  hypothetical protein M569_16948                       69.3    4e-11   Genlisea aurea
ref|XP_010279049.1|  PREDICTED: uncharacterized protein LOC104613055  69.3    7e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008234920.1|  PREDICTED: uncharacterized protein LOC103333806  68.9    1e-10   Prunus mume [ume]
ref|XP_008386575.1|  PREDICTED: uncharacterized protein LOC103449078  68.2    2e-10   Malus domestica [apple tree]
ref|XP_009356724.1|  PREDICTED: uncharacterized protein LOC103947542  68.2    2e-10   Pyrus x bretschneideri [bai li]
gb|KHG19647.1|  putative alpha-ketoglutarate-dependent dioxygenas...  68.2    2e-10   Gossypium arboreum [tree cotton]
gb|EYU46628.1|  hypothetical protein MIMGU_mgv1a003933mg              68.2    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_004290685.2|  PREDICTED: uncharacterized protein LOC101299256  67.0    4e-10   Fragaria vesca subsp. vesca
ref|XP_006444148.1|  hypothetical protein CICLE_v10019581mg           67.0    4e-10   Citrus clementina [clementine]
emb|CDP03590.1|  unnamed protein product                              67.0    5e-10   Coffea canephora [robusta coffee]
ref|XP_007201711.1|  hypothetical protein PRUPE_ppa003815mg           66.2    7e-10   Prunus persica
gb|KHN18902.1|  hypothetical protein glysoja_028271                   65.5    1e-09   Glycine soja [wild soybean]
ref|XP_009412173.1|  PREDICTED: uncharacterized protein LOC103993726  65.9    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006358433.1|  PREDICTED: uncharacterized protein LOC102603657  65.5    1e-09   Solanum tuberosum [potatoes]
ref|XP_004496294.1|  PREDICTED: uncharacterized protein LOC101493086  65.5    1e-09   
ref|XP_004247488.1|  PREDICTED: uncharacterized protein LOC101267646  65.5    1e-09   Solanum lycopersicum
ref|XP_007050694.1|  Transport protein sec31 isoform 1                65.5    2e-09   
ref|XP_010542876.1|  PREDICTED: uncharacterized protein LOC104815949  65.5    2e-09   Tarenaya hassleriana [spider flower]
gb|KHN19859.1|  hypothetical protein glysoja_033491                   64.7    2e-09   Glycine soja [wild soybean]
gb|KEH43288.1|  2OG-Fe(II) oxygenase family oxidoreductase            64.3    3e-09   Medicago truncatula
ref|XP_006576883.1|  PREDICTED: uncharacterized protein LOC100796344  64.3    4e-09   
ref|XP_003520217.1|  PREDICTED: uncharacterized protein LOC100791586  64.3    4e-09   Glycine max [soybeans]
ref|XP_007162387.1|  hypothetical protein PHAVU_001G147800g           64.3    4e-09   Phaseolus vulgaris [French bean]
ref|XP_003591621.1|  hypothetical protein MTR_1g089860                63.9    4e-09   
gb|KJB42033.1|  hypothetical protein B456_007G133500                  63.9    5e-09   Gossypium raimondii
ref|XP_007144596.1|  hypothetical protein PHAVU_007G168900g           63.5    5e-09   Phaseolus vulgaris [French bean]
gb|KHN45381.1|  hypothetical protein glysoja_028388                   62.8    8e-09   Glycine soja [wild soybean]
ref|XP_002321056.1|  oxidoreductase family protein                    62.8    1e-08   
ref|XP_010938799.1|  PREDICTED: uncharacterized protein LOC105057798  62.4    1e-08   Elaeis guineensis
ref|XP_008775273.1|  PREDICTED: uncharacterized protein LOC103695673  61.2    2e-08   Phoenix dactylifera
ref|XP_011033673.1|  PREDICTED: uncharacterized protein LOC105132083  62.4    2e-08   Populus euphratica
ref|XP_010255802.1|  PREDICTED: uncharacterized protein LOC104596...  62.4    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010255801.1|  PREDICTED: uncharacterized protein LOC104596...  62.4    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_006604415.1|  PREDICTED: uncharacterized protein LOC100776...  62.0    2e-08   Glycine max [soybeans]
ref|XP_006287389.1|  hypothetical protein CARUB_v10000595mg           61.6    3e-08   Capsella rubella
ref|XP_010696340.1|  PREDICTED: uncharacterized protein LOC104908870  61.2    4e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009607167.1|  PREDICTED: uncharacterized protein LOC104101431  60.8    5e-08   Nicotiana tomentosiformis
gb|KHN03771.1|  hypothetical protein glysoja_011000                   59.3    1e-07   Glycine soja [wild soybean]
ref|XP_010422515.1|  PREDICTED: uncharacterized protein LOC104707789  59.7    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010455955.1|  PREDICTED: uncharacterized protein LOC104737461  59.7    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010430544.1|  PREDICTED: uncharacterized protein LOC104714781  59.7    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006588616.1|  PREDICTED: uncharacterized protein LOC100802371  59.7    1e-07   Glycine max [soybeans]
ref|XP_009393115.1|  PREDICTED: uncharacterized protein LOC103978888  59.7    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30895.1|  hypothetical protein AALP_AA6G039900                  59.7    1e-07   Arabis alpina [alpine rockcress]
dbj|BAK00235.1|  predicted protein                                    57.0    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004158952.1|  PREDICTED: uncharacterized LOC101203670          58.9    2e-07   
ref|XP_009774650.1|  PREDICTED: uncharacterized protein LOC104224666  58.9    2e-07   Nicotiana sylvestris
ref|XP_008809229.1|  PREDICTED: uncharacterized protein LOC103721...  58.9    2e-07   Phoenix dactylifera
ref|XP_008809230.1|  PREDICTED: uncharacterized protein LOC103721...  58.5    3e-07   Phoenix dactylifera
gb|KGN44860.1|  hypothetical protein Csa_7G392330                     58.9    3e-07   Cucumis sativus [cucumbers]
ref|XP_008451400.1|  PREDICTED: uncharacterized protein LOC103492703  58.5    4e-07   Cucumis melo [Oriental melon]
ref|XP_004148896.1|  PREDICTED: uncharacterized protein LOC101203670  58.2    4e-07   
gb|EMT23125.1|  hypothetical protein F775_27644                       57.0    7e-07   
ref|XP_010090348.1|  hypothetical protein L484_025013                 57.8    7e-07   
dbj|BAJ97023.1|  predicted protein                                    57.0    9e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010231391.1|  PREDICTED: uncharacterized protein LOC100841...  57.0    1e-06   Brachypodium distachyon [annual false brome]
ref|XP_003568474.1|  PREDICTED: uncharacterized protein LOC100841...  57.0    1e-06   Brachypodium distachyon [annual false brome]
ref|XP_010323031.1|  PREDICTED: uncharacterized protein LOC101258968  56.2    2e-06   Solanum lycopersicum
ref|XP_009402473.1|  PREDICTED: uncharacterized protein LOC103986253  55.8    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004493638.1|  PREDICTED: uncharacterized protein LOC101495753  55.8    2e-06   Cicer arietinum [garbanzo]
ref|XP_009111249.1|  PREDICTED: uncharacterized protein LOC103836707  55.8    3e-06   Brassica rapa
ref|XP_010905740.1|  PREDICTED: uncharacterized protein LOC105032859  55.5    3e-06   Elaeis guineensis
ref|XP_010038135.1|  PREDICTED: uncharacterized protein LOC104426697  55.1    4e-06   Eucalyptus grandis [rose gum]
gb|KCW49947.1|  hypothetical protein EUGRSUZ_K03407                   55.1    4e-06   Eucalyptus grandis [rose gum]
gb|AFW81533.1|  hypothetical protein ZEAMMB73_697460                  54.3    5e-06   
ref|NP_001147582.1|  oxidoreductase, 2OG-Fe oxygenase family protein  54.3    5e-06   
gb|AFW77935.1|  hypothetical protein ZEAMMB73_473012                  54.3    5e-06   
gb|AFW77933.1|  hypothetical protein ZEAMMB73_473012                  53.9    6e-06   
gb|AAT85147.1|  hypothetical protein                                  53.9    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441065.1|  hypothetical protein SORBIDRAFT_09g019740        54.7    6e-06   Sorghum bicolor [broomcorn]
ref|XP_006352790.1|  PREDICTED: uncharacterized protein LOC102602285  54.3    7e-06   Solanum tuberosum [potatoes]
gb|EEE63665.1|  hypothetical protein OsJ_18483                        53.9    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79195.1|  hypothetical protein OsI_19903                        54.3    7e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008647787.1|  PREDICTED: oxidoreductase, 2OG-Fe oxygenase ...  54.3    8e-06   
gb|KCW58910.1|  hypothetical protein EUGRSUZ_H01531                   53.9    8e-06   Eucalyptus grandis [rose gum]
gb|KCW58911.1|  hypothetical protein EUGRSUZ_H01531                   53.9    8e-06   Eucalyptus grandis [rose gum]
gb|KEH23703.1|  2OG-Fe(II) oxygenase family oxidoreductase            53.5    1e-05   Medicago truncatula
ref|XP_010070257.1|  PREDICTED: uncharacterized protein LOC104457...  53.5    1e-05   
emb|CDY21925.1|  BnaC09g00310D                                        53.1    1e-05   Brassica napus [oilseed rape]
ref|XP_010070256.1|  PREDICTED: uncharacterized protein LOC104457...  53.5    1e-05   Eucalyptus grandis [rose gum]
emb|CDY22086.1|  BnaA09g01150D                                        53.5    1e-05   Brassica napus [oilseed rape]
ref|XP_008656187.1|  PREDICTED: uncharacterized protein LOC103635534  52.8    3e-05   Zea mays [maize]
ref|XP_004962145.1|  PREDICTED: uncharacterized protein LOC101766885  52.4    3e-05   Setaria italica
ref|XP_006396520.1|  hypothetical protein EUTSA_v10028541mg           50.8    1e-04   Eutrema salsugineum [saltwater cress]
ref|NP_192203.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...  50.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874886.1|  oxidoreductase                                   50.4    1e-04   
ref|XP_010497172.1|  PREDICTED: uncharacterized protein LOC104774212  47.0    7e-04   Camelina sativa [gold-of-pleasure]



>gb|KJB23151.1| hypothetical protein B456_004G083800 [Gossypium raimondii]
Length=555

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            +SPRK+ PRGGTGVFLPWT+ S+KH KHLPPRAQK R LALPS+  +T  +++TSE S
Sbjct  492  VSPRKL-PRGGTGVFLPWTMGSKKHTKHLPPRAQKGRMLALPSA-VETHVSESTSEPS  547



>gb|KHF97715.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
Length=549

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            +SPRK+ PRGGTGVFLPWT+ S+KH KHLPPRAQK R LALPS+  +T  +++TSE S
Sbjct  486  VSPRKL-PRGGTGVFLPWTMGSKKHTKHLPPRAQKGRMLALPSA-VETHVSESTSEPS  541



>ref|XP_011079798.1| PREDICTED: uncharacterized protein LOC105163227 [Sesamum indicum]
Length=544

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS-SDDQTLEADTTSETSA  217
            +SPR+ VPRGGTGV+LPWTV SRKH KHLPPRAQ+ R+LAL S SD    E    S  ++
Sbjct  485  MSPRR-VPRGGTGVYLPWTVGSRKHAKHLPPRAQRGRYLALTSPSDAHKPETGCDSGATS  543

Query  216  P  214
            P
Sbjct  544  P  544



>ref|XP_002271361.1| PREDICTED: uncharacterized protein LOC100256341 [Vitis vinifera]
Length=557

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            +SPRK+  + GTGVFLPW V+SRKH KHLPPRAQ+ R LALPS+ D T  A+ TSE
Sbjct  494  MSPRKM-QQSGTGVFLPWAVKSRKHAKHLPPRAQRSRLLALPSTVD-THAAEPTSE  547



>ref|XP_002524804.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37647.1| conserved hypothetical protein [Ricinus communis]
Length=550

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTS  229
            LSP+++ PRGGTGVFLPWTV SRK  KHLPPRAQK R LALPS ++   ++   S
Sbjct  489  LSPKRM-PRGGTGVFLPWTVGSRKPAKHLPPRAQKGRLLALPSIENHAADSSEIS  542



>ref|XP_009769229.1| PREDICTED: uncharacterized protein LOC104220112 [Nicotiana sylvestris]
Length=544

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            +SPRK  PRGGTGVFLPW   SRK  KHLPPRAQ+ RFLALP   D + ++DTTSE S
Sbjct  481  MSPRK-APRGGTGVFLPWNGGSRKPAKHLPPRAQRGRFLALPPPGD-SPKSDTTSEPS  536



>ref|XP_009599211.1| PREDICTED: uncharacterized protein LOC104094898 [Nicotiana tomentosiformis]
Length=548

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            +SPRK  PRGGTGVFLPW   SRK  KHLPPRAQ+ RFLALP+  D + +++TTSE S
Sbjct  485  MSPRK-APRGGTGVFLPWNGGSRKPAKHLPPRAQRGRFLALPTPSD-SPKSETTSEPS  540



>ref|XP_011082539.1| PREDICTED: uncharacterized protein LOC105165276 [Sesamum indicum]
Length=555

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS-SDDQTLEADTTSETSA  217
            +SPR+  P GGTGVFLPWTV SR+  KHLPPRAQ+R+FLALPS  D    E  + S  S+
Sbjct  496  VSPRR-TPHGGTGVFLPWTVGSRRPAKHLPPRAQRRKFLALPSPVDTHKFEVISDSGVSS  554

Query  216  P  214
            P
Sbjct  555  P  555



>gb|KDP21510.1| hypothetical protein JCGZ_21981 [Jatropha curcas]
Length=550

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            LSP+++  RGGTGVFLPWTV SRK  KHLPPRAQKRR L LPS   +T   D+ SET 
Sbjct  488  LSPKRM-SRGGTGVFLPWTVGSRKPAKHLPPRAQKRRLLTLPSI--ETHVTDSASETC  542



>gb|EPS57869.1| hypothetical protein M569_16948, partial [Genlisea aurea]
Length=341

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALP  268
            + P++I P GGTGVFLPW + SR+HVKHLPPRAQK R LALP
Sbjct  296  VGPQRIPPCGGTGVFLPWAIGSRRHVKHLPPRAQKGRLLALP  337



>ref|XP_010279049.1| PREDICTED: uncharacterized protein LOC104613055 [Nelumbo nucifera]
Length=557

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALP  268
            ++PRKI PRGGTGVFLPWTV S+K  KHLPPRAQK R LALP
Sbjct  499  MNPRKI-PRGGTGVFLPWTVSSKKPTKHLPPRAQKGRLLALP  539



>ref|XP_008234920.1| PREDICTED: uncharacterized protein LOC103333806 [Prunus mume]
Length=549

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            LSPRK VP  GTGVFLPWTV SRK  KHLPPRAQK R +ALPS   +T   ++TSE
Sbjct  491  LSPRK-VPPSGTGVFLPWTVGSRKPAKHLPPRAQKGRLMALPSP-PETHAGESTSE  544



>ref|XP_008386575.1| PREDICTED: uncharacterized protein LOC103449078 [Malus domestica]
Length=545

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLE  244
            LSPRK VP+ GTGVFLPWT+ SRK  KHLPPRAQK R +A PS  + T E
Sbjct  492  LSPRK-VPQSGTGVFLPWTMGSRKPAKHLPPRAQKGRLMAFPSPAESTSE  540



>ref|XP_009356724.1| PREDICTED: uncharacterized protein LOC103947542 [Pyrus x bretschneideri]
Length=545

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLE  244
            LSP+K VP+ GTGVFLPWT+ SRK  KHLPPRAQK R +ALPS  + T E
Sbjct  492  LSPQK-VPQSGTGVFLPWTMGSRKPAKHLPPRAQKGRLMALPSPAESTSE  540



>gb|KHG19647.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
 gb|KHG21011.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
Length=557

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 3/56 (5%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            +SP+K+ PRGGTGVFLPW +RSRK  KHLPPRAQK    ALP +  +T  A++TSE
Sbjct  493  MSPKKL-PRGGTGVFLPWNMRSRKPTKHLPPRAQKGNMFALPPA--ETHIAESTSE  545



>gb|EYU46628.1| hypothetical protein MIMGU_mgv1a003933mg [Erythranthe guttata]
Length=554

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKH-VKHLPPRAQKRRFLALPSSDD  256
            ++PR++ PRGGTGVFLPW   +RKH  KHLPPRAQ+ RFLALPSS D
Sbjct  492  VAPRRM-PRGGTGVFLPWNGGTRKHHAKHLPPRAQRGRFLALPSSSD  537



>ref|XP_004290685.2| PREDICTED: uncharacterized protein LOC101299256 [Fragaria vesca 
subsp. vesca]
Length=538

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            LSPRK+ P+ GTGVFLPWTV SRK  KHLPPRAQK R +ALPS
Sbjct  480  LSPRKL-PQSGTGVFLPWTVGSRKPAKHLPPRAQKGRLMALPS  521



>ref|XP_006444148.1| hypothetical protein CICLE_v10019581mg [Citrus clementina]
 ref|XP_006479782.1| PREDICTED: uncharacterized protein LOC102631062 [Citrus sinensis]
 gb|ESR57388.1| hypothetical protein CICLE_v10019581mg [Citrus clementina]
 gb|KDO68840.1| hypothetical protein CISIN_1g008986mg [Citrus sinensis]
Length=547

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSS  262
            LSP ++ P GGTGVFLPW V SRK  KHLPPRAQK RFLALPSS
Sbjct  487  LSPGRM-PHGGTGVFLPWAVGSRKPAKHLPPRAQKGRFLALPSS  529



>emb|CDP03590.1| unnamed protein product [Coffea canephora]
Length=561

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETSAP  214
            +SPR+ V RGGTGVFLPWTV SR+  KHLPPRAQK R LALPS     +EA  T   S P
Sbjct  503  VSPRR-VSRGGTGVFLPWTVGSRRPAKHLPPRAQKGRLLALPSP----VEACKTDTNSDP  557



>ref|XP_007201711.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica]
 gb|EMJ02910.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica]
Length=547

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            LSPRK VP  GTGVFLPWTV SRK  KHLPPRAQK R + LPS   +T   ++TSE
Sbjct  489  LSPRK-VPPSGTGVFLPWTVGSRKPAKHLPPRAQKGRLMVLPSP-PETHVGESTSE  542



>gb|KHN18902.1| hypothetical protein glysoja_028271 [Glycine soja]
Length=492

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            L+PRK+   GGTGVFLPW V SRK  KHLPPRAQK R L LPSS +  +  ++TSE S
Sbjct  432  LNPRKLAG-GGTGVFLPWNVPSRKPAKHLPPRAQKGRLLTLPSSVEPQM-GESTSEPS  487



>ref|XP_009412173.1| PREDICTED: uncharacterized protein LOC103993726 [Musa acuminata 
subsp. malaccensis]
Length=561

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            +SP K  PRGGTGVFLPWTV  +K+ +HLPPR QKRR  +LPS
Sbjct  513  MSPNKKAPRGGTGVFLPWTVGPKKYTRHLPPRIQKRRLPSLPS  555



>ref|XP_006358433.1| PREDICTED: uncharacterized protein LOC102603657 [Solanum tuberosum]
Length=548

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            ++PR+  PRGGTGVFLPW   SRK  KHLPPRAQ+ RFLALP   D + +++T SE S
Sbjct  485  MNPRR-APRGGTGVFLPWNGGSRKPAKHLPPRAQRGRFLALPPPGD-SPKSETASEPS  540



>ref|XP_004496294.1| PREDICTED: uncharacterized protein LOC101493086 [Cicer arietinum]
Length=508

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            L+PRK+   GGTGVFLPW V SRK  KHLPPRAQK R LALPS  +  +  ++TSE S
Sbjct  448  LNPRKLAG-GGTGVFLPWNVPSRKPAKHLPPRAQKGRLLALPSPVEPHI-GESTSEPS  503



>ref|XP_004247488.1| PREDICTED: uncharacterized protein LOC101267646 [Solanum lycopersicum]
Length=549

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            ++PR+  PRGGTGVFLPW   SRK  KHLPPRAQ+ RFLALP   D + +++T SE S
Sbjct  486  MNPRR-APRGGTGVFLPWNGGSRKPAKHLPPRAQRGRFLALPPPGD-SPKSETASEPS  541



>ref|XP_007050694.1| Transport protein sec31 isoform 1 [Theobroma cacao]
 gb|EOX94851.1| Transport protein sec31 isoform 1 [Theobroma cacao]
Length=610

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 6/61 (10%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVR-SRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETSA  217
            +SPRK+ PRGGTGVFLPWT+  SRK  KHLPPRAQK R LALPS     +E +    TS 
Sbjct  546  VSPRKL-PRGGTGVFLPWTMGGSRKPTKHLPPRAQKGRMLALPSP----VEPNAAESTSE  600

Query  216  P  214
            P
Sbjct  601  P  601



>ref|XP_010542876.1| PREDICTED: uncharacterized protein LOC104815949 [Tarenaya hassleriana]
Length=550

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  366  GGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            GGTGVFLPW V  RKHVKHLPPRAQKRR L+LP+
Sbjct  497  GGTGVFLPWAVSPRKHVKHLPPRAQKRRLLSLPA  530



>gb|KHN19859.1| hypothetical protein glysoja_033491 [Glycine soja]
Length=366

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            +PRGGTGVFLPW   SRKH +HLPPRAQK R + LPS  +  +  ++TSE S
Sbjct  311  LPRGGTGVFLPWKGASRKHTRHLPPRAQKGRLMELPSPVESHM-GESTSEPS  361



>gb|KEH43288.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=526

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            ++PRK+   GGTGVFLPW V SRK  KHLPPRAQK R LALPS  +  +  ++TSE S
Sbjct  466  VNPRKLAG-GGTGVFLPWNVPSRKPTKHLPPRAQKGRLLALPSPVEPHI-GESTSEPS  521



>ref|XP_006576883.1| PREDICTED: uncharacterized protein LOC100796344 [Glycine max]
Length=520

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            +PRGGTGVFLPW   SRKH +HLPPRAQK R + LPS  +  +  ++TSE S
Sbjct  465  LPRGGTGVFLPWKGASRKHTRHLPPRAQKGRLMELPSPVESHM-GESTSEPS  515



>ref|XP_003520217.1| PREDICTED: uncharacterized protein LOC100791586 [Glycine max]
Length=514

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            L+PRK+   GGTGVFLPW V SRK  KHLPPRAQK R L LPSS +  +  ++TSE S
Sbjct  454  LNPRKLAG-GGTGVFLPWNVPSRKPAKHLPPRAQKGRLLTLPSSVEPQM-GESTSEPS  509



>ref|XP_007162387.1| hypothetical protein PHAVU_001G147800g [Phaseolus vulgaris]
 gb|ESW34381.1| hypothetical protein PHAVU_001G147800g [Phaseolus vulgaris]
Length=516

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            +PRGGTGVFLPW   SRKH +HLPPRAQK R + LPS  +  L  ++TSE S
Sbjct  461  LPRGGTGVFLPWKGASRKHARHLPPRAQKGRLMELPSPVESHL-GESTSEPS  511



>ref|XP_003591621.1| hypothetical protein MTR_1g089860 [Medicago truncatula]
Length=513

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            ++PRK+   GGTGVFLPW V SRK  KHLPPRAQK R LALPS  +  +  ++TSE S
Sbjct  453  VNPRKLAG-GGTGVFLPWNVPSRKPTKHLPPRAQKGRLLALPSPVEPHI-GESTSEPS  508



>gb|KJB42033.1| hypothetical protein B456_007G133500 [Gossypium raimondii]
Length=557

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            +SP+K+ P GGTGVFLPW + SRK  KHLPPRAQK   LALP +  +T  A++TSE
Sbjct  493  MSPKKL-PCGGTGVFLPWNMLSRKPTKHLPPRAQKGNMLALPPA--ETHIAESTSE  545



>ref|XP_007144596.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 gb|ESW16590.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
Length=505

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETSAP  214
            L+ RK+   GGTGVFLPW V SRKH KHLPPRAQK R L LPS     +E+     TS P
Sbjct  445  LNSRKLAG-GGTGVFLPWNVPSRKHAKHLPPRAQKGRLLTLPSP----VESQVGESTSKP  499



>gb|KHN45381.1| hypothetical protein glysoja_028388 [Glycine soja]
Length=366

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETSAP  214
            +PRGGTGVFLPW   +RKH +HLPPRAQK R + LPS     +E+ T    S P
Sbjct  311  LPRGGTGVFLPWKGSARKHARHLPPRAQKGRLMELPS----PVESHTGESISEP  360



>ref|XP_002321056.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE99371.1| oxidoreductase family protein [Populus trichocarpa]
Length=551

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSET  223
            LSP+++ P GGTGVFLPW V SRK  KHLPPRAQ+ R LAL SS  +T  A + S+T
Sbjct  488  LSPKRM-PNGGTGVFLPWAVGSRKPAKHLPPRAQRGRLLAL-SSPVETHVAASASDT  542



>ref|XP_010938799.1| PREDICTED: uncharacterized protein LOC105057798 [Elaeis guineensis]
 ref|XP_010938800.1| PREDICTED: uncharacterized protein LOC105057798 [Elaeis guineensis]
Length=536

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            ++P + + R GTGVFLPW V  +K+ KHLPPR QKRRFL+LPS
Sbjct  488  MTPGRRMSRNGTGVFLPWAVGPKKYTKHLPPRIQKRRFLSLPS  530



>ref|XP_008775273.1| PREDICTED: uncharacterized protein LOC103695673 [Phoenix dactylifera]
Length=314

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            ++P + + R GTGVFLPW V  +K+ KHLPPR QKRRFL+LPS
Sbjct  266  MAPGRRMSRSGTGVFLPWAVGPKKYTKHLPPRIQKRRFLSLPS  308



>ref|XP_011033673.1| PREDICTED: uncharacterized protein LOC105132083 [Populus euphratica]
Length=521

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            LSP+++ P GGTGVFLPW V SRK  KHLPPRAQ+ R LAL S
Sbjct  458  LSPKRM-PNGGTGVFLPWAVGSRKPAKHLPPRAQRGRLLALSS  499



>ref|XP_010255802.1| PREDICTED: uncharacterized protein LOC104596380 isoform X2 [Nelumbo 
nucifera]
Length=559

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -2

Query  393  LSPRKIVPRG-GTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            +SPR+I   G GTGVFLPWTV S+K  KHLPPR Q+ R LALPS
Sbjct  497  MSPRRIARGGSGTGVFLPWTVSSKKSTKHLPPRVQRGRLLALPS  540



>ref|XP_010255801.1| PREDICTED: uncharacterized protein LOC104596380 isoform X1 [Nelumbo 
nucifera]
Length=560

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -2

Query  393  LSPRKIVPRG-GTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            +SPR+I   G GTGVFLPWTV S+K  KHLPPR Q+ R LALPS
Sbjct  498  MSPRRIARGGSGTGVFLPWTVSSKKSTKHLPPRVQRGRLLALPS  541



>ref|XP_006604415.1| PREDICTED: uncharacterized protein LOC100776159 isoform X1 [Glycine 
max]
Length=518

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETSAP  214
            +PRGGTGVFLPW   +RKH +HLPPRAQK R + LPS     +E+ T    S P
Sbjct  463  LPRGGTGVFLPWKGSARKHARHLPPRAQKGRLMELPSP----VESHTGESISEP  512



>ref|XP_006287389.1| hypothetical protein CARUB_v10000595mg [Capsella rubella]
 gb|EOA20287.1| hypothetical protein CARUB_v10000595mg [Capsella rubella]
Length=563

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -2

Query  381  KIVPRGGTGVFLPW--TVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
             ++  GGTGVFLPW  T  SRKHVKHLPPRAQK+R L LP +   +    +TSE
Sbjct  504  NVMGTGGTGVFLPWASTNSSRKHVKHLPPRAQKKRLLPLPPAASSSPAGGSTSE  557



>ref|XP_010696340.1| PREDICTED: uncharacterized protein LOC104908870 [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            +PRGGTGVFLPW V S+K  KHLPPRAQK RFL+    ++    +DT S+
Sbjct  491  MPRGGTGVFLPWAVGSKKPAKHLPPRAQKGRFLSFSRVEEHV--SDTMSD  538



>ref|XP_009607167.1| PREDICTED: uncharacterized protein LOC104101431 [Nicotiana tomentosiformis]
Length=540

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            L+P++I P  GTGVFLP    SRK VKHLPPRAQKRRFL LPS  D + ++++TSE S
Sbjct  485  LNPKRI-PHNGTGVFLPL---SRKPVKHLPPRAQKRRFLELPSPGD-SPKSESTSEAS  537



>gb|KHN03771.1| hypothetical protein glysoja_011000 [Glycine soja]
Length=386

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            L+P K+   GGTGVFLPW V SRK  KHLPPRAQK R L LPS
Sbjct  334  LNPHKL-SGGGTGVFLPWNVPSRKPAKHLPPRAQKGRLLTLPS  375



>ref|XP_010422515.1| PREDICTED: uncharacterized protein LOC104707789 [Camelina sativa]
Length=575

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  381  KIVPRGGTGVFLPWTV--RSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
             ++  GGTGVFLPW     SRKHVKHLPPRAQK+R L LP +   +    +TSE
Sbjct  516  NVMGTGGTGVFLPWASVNSSRKHVKHLPPRAQKKRLLPLPPAASSSPAGGSTSE  569



>ref|XP_010455955.1| PREDICTED: uncharacterized protein LOC104737461 [Camelina sativa]
Length=572

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  381  KIVPRGGTGVFLPWTV--RSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
             ++  GGTGVFLPW     SRKHVKHLPPRAQK+R L LP +   +    +TSE
Sbjct  513  NVMGTGGTGVFLPWASVNSSRKHVKHLPPRAQKKRLLPLPPAASSSPAGGSTSE  566



>ref|XP_010430544.1| PREDICTED: uncharacterized protein LOC104714781 [Camelina sativa]
Length=567

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  381  KIVPRGGTGVFLPWTV--RSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
             ++  GGTGVFLPW     SRKHVKHLPPRAQK+R L LP +   +    +TSE
Sbjct  508  NVMGTGGTGVFLPWASVNSSRKHVKHLPPRAQKKRLLPLPPAASSSPAGGSTSE  561



>ref|XP_006588616.1| PREDICTED: uncharacterized protein LOC100802371 [Glycine max]
Length=511

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            L+P K+   GGTGVFLPW V SRK  KHLPPRAQK R L LPS
Sbjct  459  LNPHKL-SGGGTGVFLPWNVPSRKPAKHLPPRAQKGRLLTLPS  500



>ref|XP_009393115.1| PREDICTED: uncharacterized protein LOC103978888 [Musa acuminata 
subsp. malaccensis]
Length=548

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            +S  K  PR GTGVFLPW V  +K+ KHLPPR QKRR  +LPS
Sbjct  500  MSSSKKAPRNGTGVFLPWMVGPKKYTKHLPPRIQKRRLPSLPS  542



>gb|KFK30895.1| hypothetical protein AALP_AA6G039900 [Arabis alpina]
Length=564

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 1/33 (3%)
 Frame = -2

Query  363  GTGVFLPW-TVRSRKHVKHLPPRAQKRRFLALP  268
            GTGVFLPW +V S+KHVKHLPPRAQK+RFL LP
Sbjct  509  GTGVFLPWASVSSKKHVKHLPPRAQKKRFLPLP  541



>dbj|BAK00235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=202

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLAL  271
            RGGTGVFLPWTV  +++ KHLPPR QKRRF A+
Sbjct  162  RGGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAM  194



>ref|XP_004158952.1| PREDICTED: uncharacterized LOC101203670 [Cucumis sativus]
Length=548

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            R GTGVFLPW V +RK  KHLPPRA+K RFLALP + +  L  D++ E S
Sbjct  497  RDGTGVFLPWAVNTRKPAKHLPPRARKGRFLALPPAVETRL-PDSSHEPS  545



>ref|XP_009774650.1| PREDICTED: uncharacterized protein LOC104224666 [Nicotiana sylvestris]
Length=540

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 5/58 (9%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            L+P++I P  GTGVFLP    SRK  KHLPPRAQKRRFL LPS  D + ++++TSE S
Sbjct  485  LNPQRI-PHNGTGVFLPL---SRKPAKHLPPRAQKRRFLELPSPGD-SPKSESTSEAS  537



>ref|XP_008809229.1| PREDICTED: uncharacterized protein LOC103721002 isoform X1 [Phoenix 
dactylifera]
Length=545

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALP  268
            +SP + V R GTGVFLPWTV  +K+ KHLPPR QKRR  +LP
Sbjct  497  MSPGRRVSRSGTGVFLPWTVGPKKYTKHLPPRIQKRRLPSLP  538



>ref|XP_008809230.1| PREDICTED: uncharacterized protein LOC103721002 isoform X2 [Phoenix 
dactylifera]
Length=527

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALP  268
            +SP + V R GTGVFLPWTV  +K+ KHLPPR QKRR  +LP
Sbjct  479  MSPGRRVSRSGTGVFLPWTVGPKKYTKHLPPRIQKRRLPSLP  520



>gb|KGN44860.1| hypothetical protein Csa_7G392330 [Cucumis sativus]
Length=583

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTL  247
            R GTGVFLPW V +RK  KHLPPRA+K RFLALP + +  L
Sbjct  532  RDGTGVFLPWAVNTRKPAKHLPPRARKGRFLALPPAVETRL  572



>ref|XP_008451400.1| PREDICTED: uncharacterized protein LOC103492703 [Cucumis melo]
Length=578

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTL  247
            R GTGVFLPW V +RK  KHLPPRA+K RFLALP + +  L
Sbjct  527  RDGTGVFLPWAVNTRKPAKHLPPRARKGRFLALPPAVETRL  567



>ref|XP_004148896.1| PREDICTED: uncharacterized protein LOC101203670 [Cucumis sativus]
Length=548

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTL  247
            R GTGVFLPW V +RK  KHLPPRA+K RFLALP + +  L
Sbjct  497  RDGTGVFLPWAVNTRKPAKHLPPRARKGRFLALPPAVETRL  537



>gb|EMT23125.1| hypothetical protein F775_27644 [Aegilops tauschii]
Length=412

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            RGGTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  372  RGGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  406



>ref|XP_010090348.1| hypothetical protein L484_025013 [Morus notabilis]
 gb|EXB39318.1| hypothetical protein L484_025013 [Morus notabilis]
Length=664

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -2

Query  393  LSPRKIVPRG-GTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSETS  220
            LSP K    G GTGVFLPW + SRK  KHLPPRAQ+ R L+LPSS +     D  S TS
Sbjct  597  LSPHKNPCNGNGTGVFLPWNMGSRKPQKHLPPRAQRGRLLSLPSSPEA--HGDDKSTTS  653



>dbj|BAJ97023.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            RGGTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  510  RGGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  544



>ref|XP_010231391.1| PREDICTED: uncharacterized protein LOC100841736 isoform X1 [Brachypodium 
distachyon]
Length=553

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            RGGTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  513  RGGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  547



>ref|XP_003568474.1| PREDICTED: uncharacterized protein LOC100841736 isoform X2 [Brachypodium 
distachyon]
Length=552

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            RGGTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  512  RGGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  546



>ref|XP_010323031.1| PREDICTED: uncharacterized protein LOC101258968 [Solanum lycopersicum]
Length=510

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLAL  271
            LSPRKI P GGTGVFLP    SRK  KH+PPRAQKRRFL L
Sbjct  455  LSPRKI-PTGGTGVFLPL---SRKPAKHIPPRAQKRRFLEL  491



>ref|XP_009402473.1| PREDICTED: uncharacterized protein LOC103986253 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRF  280
            + P K  PR GTGVFLPWTV  +KH KHLPPR QK R 
Sbjct  470  VGPGKKAPRNGTGVFLPWTVGPKKHTKHLPPRFQKGRL  507



>ref|XP_004493638.1| PREDICTED: uncharacterized protein LOC101495753 [Cicer arietinum]
Length=522

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSET  223
            LSP ++ PRGGTGVFLPW  + +K  +HLPPRA + R +ALPS  +   E   +  T
Sbjct  462  LSPCEL-PRGGTGVFLPWKGQPKKQPRHLPPRANRGRLIALPSPVESPREVAASEPT  517



>ref|XP_009111249.1| PREDICTED: uncharacterized protein LOC103836707 [Brassica rapa]
Length=585

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -2

Query  390  SPRKIVPRGGTGVFLPW-TVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            SP  +    GTGVFLPW +  SRKHVKHLPPRAQK+R L  P     +   ++TSE
Sbjct  522  SPGVMGTGNGTGVFLPWASTSSRKHVKHLPPRAQKKRLLPPPPPAASSPAGESTSE  577



>ref|XP_010905740.1| PREDICTED: uncharacterized protein LOC105032859 [Elaeis guineensis]
Length=525

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALP  268
            V R GTGVFLPWTV  +K+ KHLPPR QKRR  +LP
Sbjct  483  VSRSGTGVFLPWTVGPKKYTKHLPPRIQKRRLPSLP  518



>ref|XP_010038135.1| PREDICTED: uncharacterized protein LOC104426697 [Eucalyptus grandis]
Length=569

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 7/64 (11%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS------SDDQTLEADTT  232
             SP+KI   G TGVFLPW V++RK  ++LPPRA+K R L LPS      +D   L  DT 
Sbjct  497  FSPKKIQTEG-TGVFLPWPVKARKPARYLPPRARKGRLLNLPSPVETHRADCTALLGDTV  555

Query  231  SETS  220
            ++T 
Sbjct  556  TQTG  559



>gb|KCW49947.1| hypothetical protein EUGRSUZ_K03407 [Eucalyptus grandis]
Length=546

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 7/64 (11%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS------SDDQTLEADTT  232
             SP+KI   G TGVFLPW V++RK  ++LPPRA+K R L LPS      +D   L  DT 
Sbjct  474  FSPKKIQTEG-TGVFLPWPVKARKPARYLPPRARKGRLLNLPSPVETHRADCTALLGDTV  532

Query  231  SETS  220
            ++T 
Sbjct  533  TQTG  536



>gb|AFW81533.1| hypothetical protein ZEAMMB73_697460 [Zea mays]
 gb|AFW81534.1| hypothetical protein ZEAMMB73_697460 [Zea mays]
Length=317

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  381  KIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            K + R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  273  KWMSRSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  311



>ref|NP_001147582.1| oxidoreductase, 2OG-Fe oxygenase family protein [Zea mays]
 gb|ACG27985.1| oxidoreductase, 2OG-Fe oxygenase family protein [Zea mays]
 gb|AFW77934.1| oxidoreductase, 2OG-Fe oxygenase family protein [Zea mays]
Length=345

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  305  RSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  339



>gb|AFW77935.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=337

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  297  RSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  331



>gb|AFW77933.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=317

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  277  RSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  311



>gb|AAT85147.1| hypothetical protein [Oryza sativa Japonica Group]
Length=318

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  278  RSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  312



>ref|XP_002441065.1| hypothetical protein SORBIDRAFT_09g019740 [Sorghum bicolor]
 gb|EES19495.1| hypothetical protein SORBIDRAFT_09g019740 [Sorghum bicolor]
Length=595

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  555  RSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  589



>ref|XP_006352790.1| PREDICTED: uncharacterized protein LOC102602285 [Solanum tuberosum]
Length=514

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLAL  271
            L+PR+I P GGTGVFLP    SRK  KH+PPRAQKRRFL L
Sbjct  459  LNPRRI-PTGGTGVFLPL---SRKPAKHIPPRAQKRRFLEL  495



>gb|EEE63665.1| hypothetical protein OsJ_18483 [Oryza sativa Japonica Group]
Length=370

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  330  RSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  364



>gb|EEC79195.1| hypothetical protein OsI_19903 [Oryza sativa Indica Group]
Length=670

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  384  RKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
             K + R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  625  NKRMSRSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  664



>ref|XP_008647787.1| PREDICTED: oxidoreductase, 2OG-Fe oxygenase family protein isoform 
X1 [Zea mays]
 gb|AFW77937.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=573

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  369  RGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  533  RSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  567



>gb|KCW58910.1| hypothetical protein EUGRSUZ_H01531 [Eucalyptus grandis]
Length=414

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEAD  238
            LSP+KI   GGTGVFLPW + +RK  KHLPPRAQK R     SS   ++  +
Sbjct  358  LSPKKI-QNGGTGVFLPWALGARKPTKHLPPRAQKGRHHIAESSSTASVGCE  408



>gb|KCW58911.1| hypothetical protein EUGRSUZ_H01531 [Eucalyptus grandis]
Length=411

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEAD  238
            LSP+KI   GGTGVFLPW + +RK  KHLPPRAQK R     SS   ++  +
Sbjct  355  LSPKKI-QNGGTGVFLPWALGARKPTKHLPPRAQKGRHHIAESSSTASVGCE  405



>gb|KEH23703.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=514

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  375  VPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSET  223
            +P GGTGVFLPW  + +K  ++LPPRA K R +ALPS  +   E  TT  T
Sbjct  459  LPCGGTGVFLPWKGQPKKQPRYLPPRAHKGRVMALPSHVESHKEDSTTEPT  509



>ref|XP_010070257.1| PREDICTED: uncharacterized protein LOC104457030 isoform X2 [Eucalyptus 
grandis]
Length=553

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRR  283
            LSP+KI   GGTGVFLPW + +RK  KHLPPRAQK R
Sbjct  497  LSPKKI-QNGGTGVFLPWALGARKPTKHLPPRAQKGR  532



>emb|CDY21925.1| BnaC09g00310D [Brassica napus]
Length=386

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = -2

Query  390  SPRKIVPRGGTGVFLPW-TVRSRKHVKHLPPRAQKRRFL  277
            SP  +    GTGVFLPW +  SRKHVKHLPPRAQK+R L
Sbjct  320  SPSVMGTGNGTGVFLPWASASSRKHVKHLPPRAQKKRLL  358



>ref|XP_010070256.1| PREDICTED: uncharacterized protein LOC104457030 isoform X1 [Eucalyptus 
grandis]
Length=525

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -2

Query  393  LSPRKIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRR  283
            LSP+KI   GGTGVFLPW + +RK  KHLPPRAQK R
Sbjct  469  LSPKKI-QNGGTGVFLPWALGARKPTKHLPPRAQKGR  504



>emb|CDY22086.1| BnaA09g01150D [Brassica napus]
Length=584

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = -2

Query  390  SPRKIVPRGGTGVFLPW-TVRSRKHVKHLPPRAQKRRFL  277
            SP  +    GTGVFLPW +  SRKHVKHLPPRAQK+R L
Sbjct  520  SPGVMGTGNGTGVFLPWASTSSRKHVKHLPPRAQKKRLL  558



>ref|XP_008656187.1| PREDICTED: uncharacterized protein LOC103635534 [Zea mays]
 gb|AFW81532.1| hypothetical protein ZEAMMB73_697460 [Zea mays]
Length=584

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  381  KIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            K + R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  540  KWMSRSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  578



>ref|XP_004962145.1| PREDICTED: uncharacterized protein LOC101766885 [Setaria italica]
Length=582

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  381  KIVPRGGTGVFLPWTVRSRKHVKHLPPRAQKRRFLALPS  265
            K + R GTGVFLPWTV  +++ KHLPPR QKRRF A+ S
Sbjct  538  KRMGRSGTGVFLPWTVGPKRYNKHLPPRIQKRRFSAMMS  576



>ref|XP_006396520.1| hypothetical protein EUTSA_v10028541mg [Eutrema salsugineum]
 gb|ESQ37973.1| hypothetical protein EUTSA_v10028541mg [Eutrema salsugineum]
Length=571

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 2/30 (7%)
 Frame = -2

Query  351  FLPWT--VRSRKHVKHLPPRAQKRRFLALP  268
            FLPWT  V SRKHVKHLPPRAQK+R L LP
Sbjct  521  FLPWTSSVSSRKHVKHLPPRAQKKRLLPLP  550



>ref|NP_192203.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAC79112.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77779.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM13042.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91324.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82253.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=569

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = -2

Query  390  SPRKIVPRGGTGVFLPWTV--RSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            SP  +   GGTGVFLPW     SRKHVKHLPPRAQK+R L LP +   +    +TSE
Sbjct  507  SPNVMGTGGGTGVFLPWASVNSSRKHVKHLPPRAQKKRLLPLPPAASSSPAGGSTSE  563



>ref|XP_002874886.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51145.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=565

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = -2

Query  390  SPRKIVPRGGTGVFLPWTV--RSRKHVKHLPPRAQKRRFLALPSSDDQTLEADTTSE  226
            SP  +   GGTGVFLPW     SRKHVKHLPPRAQK+R L LP +   +    +TSE
Sbjct  503  SPNVMGTGGGTGVFLPWASVNSSRKHVKHLPPRAQKKRLLPLPPAASSSPAGGSTSE  559



>ref|XP_010497172.1| PREDICTED: uncharacterized protein LOC104774212, partial [Camelina 
sativa]
Length=190

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 2/33 (6%)
 Frame = -2

Query  366  GGTGVFLPWT--VRSRKHVKHLPPRAQKRRFLA  274
            GGTGVFLPWT  V SRK  KHLPPR Q+ R L+
Sbjct  140  GGTGVFLPWTPPVSSRKPAKHLPPRVQRLRLLS  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350