BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051I11

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    188   2e-53   Solanum tuberosum [potatoes]
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...    184   1e-51   Solanum lycopersicum
ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...    183   2e-51   Nicotiana tomentosiformis
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...    183   2e-51   Nicotiana sylvestris
emb|CBI19566.3|  unnamed protein product                                179   3e-51   Vitis vinifera
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    179   4e-50   Vitis vinifera
emb|CDP01376.1|  unnamed protein product                                178   5e-50   Coffea canephora [robusta coffee]
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...    177   1e-49   Nicotiana tomentosiformis
gb|KDP38389.1|  hypothetical protein JCGZ_04314                         177   2e-49   Jatropha curcas
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                  177   2e-49   
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                  177   2e-49   
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             177   4e-49   Prunus persica
gb|KDO35910.1|  hypothetical protein CISIN_1g029152mg                   169   9e-49   Citrus sinensis [apfelsine]
ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...    175   1e-48   Nicotiana sylvestris
gb|EYU20972.1|  hypothetical protein MIMGU_mgv1a018561mg                166   2e-48   Erythranthe guttata [common monkey flower]
gb|KDO35914.1|  hypothetical protein CISIN_1g029152mg                   167   3e-48   Citrus sinensis [apfelsine]
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    174   5e-48   Prunus mume [ume]
ref|XP_002510266.1|  nuclear acid binding protein, putative             173   8e-48   Ricinus communis
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...    172   1e-47   Cucumis sativus [cucumbers]
ref|XP_002302445.2|  RNA-binding protein 47                             172   1e-47   
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C               172   2e-47   Morus notabilis
ref|XP_006374988.1|  RNA-binding protein 47                             171   3e-47   
gb|KJB58432.1|  hypothetical protein B456_009G209600                    171   3e-47   Gossypium raimondii
gb|KJB59840.1|  hypothetical protein B456_009G275200                    171   4e-47   Gossypium raimondii
emb|CAN81343.1|  hypothetical protein VITISV_008697                     172   7e-47   Vitis vinifera
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...    170   1e-46   Cucumis melo [Oriental melon]
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    170   1e-46   Prunus mume [ume]
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    169   1e-46   Populus euphratica
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...    169   2e-46   Citrus sinensis [apfelsine]
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    169   2e-46   Populus euphratica
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg             169   2e-46   Citrus clementina [clementine]
gb|KHN12758.1|  Polyadenylate-binding protein RBP47C                    166   5e-46   Glycine soja [wild soybean]
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             166   2e-45   Phaseolus vulgaris [French bean]
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...    166   2e-45   Phaseolus vulgaris [French bean]
gb|KHN46301.1|  Polyadenylate-binding protein RBP47C                    164   3e-45   Glycine soja [wild soybean]
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...    166   3e-45   
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...    166   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...    166   4e-45   
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    165   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    165   5e-45   Nelumbo nucifera [Indian lotus]
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                    164   9e-45   Glycine soja [wild soybean]
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    164   9e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    164   9e-45   Nelumbo nucifera [Indian lotus]
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    164   1e-44   Glycine max [soybeans]
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...    165   1e-44   Fragaria vesca subsp. vesca
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...    164   2e-44   Glycine max [soybeans]
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    164   2e-44   Populus euphratica
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    164   2e-44   Populus euphratica
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    164   2e-44   Populus euphratica
gb|ABY75165.1|  RNA binding protein                                     156   2e-44   Arachis diogoi
ref|XP_008357394.1|  PREDICTED: polyadenylate-binding protein RBP...    162   3e-44   
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    163   3e-44   Glycine soja [wild soybean]
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg             163   5e-44   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    162   5e-44   Pyrus x bretschneideri [bai li]
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    162   6e-44   Glycine max [soybeans]
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...    162   7e-44   Sesamum indicum [beniseed]
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...    162   7e-44   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...    162   9e-44   Pyrus x bretschneideri [bai li]
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g             161   1e-43   Phaseolus vulgaris [French bean]
gb|KJB63805.1|  hypothetical protein B456_010G017300                    162   1e-43   Gossypium raimondii
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg                162   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   Beta vulgaris subsp. vulgaris [field beet]
emb|CAC69852.1|  nucleic acid binding protein                           158   3e-42   Nicotiana tabacum [American tobacco]
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                     156   1e-41   Eucalyptus grandis [rose gum]
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    156   2e-41   Cicer arietinum [garbanzo]
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...    156   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...    154   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...    153   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...    152   6e-40   Cicer arietinum [garbanzo]
ref|NP_175181.1|  RNA-binding protein 47C'                              151   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg             151   2e-39   Citrus clementina [clementine]
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...    151   2e-39   Citrus sinensis [apfelsine]
ref|XP_003603009.1|  RNA-binding protein                                150   3e-39   Medicago truncatula
ref|NP_175180.1|  RNA-binding protein 47C                               150   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EPS64859.1|  nucleic acid binding protein                            148   8e-39   Genlisea aurea
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                    148   2e-38   Medicago truncatula
gb|AFK35123.1|  unknown                                                 148   2e-38   Medicago truncatula
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    147   4e-38   
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...    146   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                   146   9e-38   Citrus sinensis [apfelsine]
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    145   9e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845939.1|  hypothetical protein AMTR_s00157p00079360          139   3e-37   
gb|KDO35911.1|  hypothetical protein CISIN_1g029152mg                   135   4e-36   Citrus sinensis [apfelsine]
ref|XP_006442703.1|  hypothetical protein CICLE_v10022585mg             135   6e-36   Citrus clementina [clementine]
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    138   4e-35   Phoenix dactylifera
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    137   8e-35   Phoenix dactylifera
gb|ABR25993.1|  nucleic acid binding protein                            130   1e-34   Oryza sativa Indica Group [Indian rice]
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                    137   2e-34   Arabis alpina [alpine rockcress]
gb|ABR25764.1|  nucleic acid binding protein                            130   3e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    139   3e-34   Elaeis guineensis
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...    136   5e-34   Cucumis melo [Oriental melon]
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     135   7e-34   Elaeis guineensis
ref|XP_008782322.1|  PREDICTED: polyadenylate-binding protein RBP...    129   7e-34   
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP...    135   9e-34   Cucumis sativus [cucumbers]
ref|XP_006423626.1|  hypothetical protein CICLE_v10030115mg             129   2e-33   
ref|XP_006446580.1|  hypothetical protein CICLE_v10017127mg             127   2e-33   
gb|KDO38218.1|  hypothetical protein CISIN_1g038175mg                   128   2e-33   Citrus sinensis [apfelsine]
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...    134   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...    132   6e-33   
ref|XP_006487135.1|  PREDICTED: uncharacterized protein LOC102626638    133   9e-33   
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280          132   1e-32   Sorghum bicolor [broomcorn]
dbj|BAJ85933.1|  predicted protein                                      125   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47     131   2e-32   Sesamum indicum [beniseed]
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...    131   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg             131   2e-32   Capsella rubella
gb|EEE61093.1|  hypothetical protein OsJ_14988                          130   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B    130   3e-32   Tarenaya hassleriana [spider flower]
ref|NP_001052934.2|  Os04g0449900                                       130   3e-32   
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    130   4e-32   Phoenix dactylifera
gb|EAY94326.1|  hypothetical protein OsI_16094                          130   4e-32   Oryza sativa Indica Group [Indian rice]
emb|CAH67097.1|  H0818E04.14                                            130   4e-32   Oryza sativa [red rice]
gb|EEE69858.1|  hypothetical protein OsJ_29658                          129   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...    130   6e-32   Nicotiana tomentosiformis
dbj|BAD33940.1|  putative nucleic acid binding protein                  128   6e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010442131.1|  PREDICTED: polyadenylate-binding protein RBP...    130   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...    130   6e-32   Brassica rapa
emb|CDY52067.1|  BnaA09g53390D                                          130   7e-32   Brassica napus [oilseed rape]
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...    129   8e-32   Solanum tuberosum [potatoes]
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...    129   8e-32   Solanum tuberosum [potatoes]
gb|KDO35913.1|  hypothetical protein CISIN_1g029152mg                   124   9e-32   Citrus sinensis [apfelsine]
emb|CDX95176.1|  BnaC09g16940D                                          129   9e-32   
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...    129   9e-32   Nicotiana sylvestris
gb|EMT27298.1|  Putative RNA-binding protein                            127   1e-31   
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...    129   1e-31   Brachypodium distachyon [annual false brome]
ref|XP_010481964.1|  PREDICTED: polyadenylate-binding protein RBP...    129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010494212.1|  PREDICTED: polyadenylate-binding protein RBP...    129   1e-31   Camelina sativa [gold-of-pleasure]
emb|CBI32444.3|  unnamed protein product                                128   1e-31   Vitis vinifera
dbj|BAG87507.1|  unnamed protein product                                128   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047180.1|  Os02g0567900                                       126   1e-31   
ref|NP_001275430.1|  DNA-binding protein-like                           129   2e-31   Solanum tuberosum [potatoes]
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     129   2e-31   Eucalyptus grandis [rose gum]
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-31   Oryza brachyantha
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     129   2e-31   
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...    128   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1          128   2e-31   
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2          128   2e-31   Solanum lycopersicum
ref|NP_001234487.1|  DNA-binding protein                                128   2e-31   
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    128   3e-31   Vitis vinifera
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    128   3e-31   Vitis vinifera
gb|EMS68577.1|  Uncharacterized RNA-binding protein C23E6.01c           127   3e-31   Triticum urartu
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    128   3e-31   
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                  127   3e-31   
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...    128   3e-31   Setaria italica
gb|KDO35916.1|  hypothetical protein CISIN_1g029152mg                   122   3e-31   Citrus sinensis [apfelsine]
gb|EEC73442.1|  hypothetical protein OsI_07730                          126   4e-31   Oryza sativa Indica Group [Indian rice]
gb|KDP23018.1|  hypothetical protein JCGZ_01681                         127   5e-31   Jatropha curcas
ref|NP_001063403.1|  Os09g0462700                                       127   5e-31   
ref|XP_003575198.1|  PREDICTED: polyadenylate-binding protein RBP...    127   5e-31   Brachypodium distachyon [annual false brome]
gb|EEC84714.1|  hypothetical protein OsI_31675                          127   5e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     127   5e-31   Nicotiana tomentosiformis
emb|CAN74486.1|  hypothetical protein VITISV_029928                     127   6e-31   Vitis vinifera
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    127   6e-31   Nicotiana sylvestris
gb|ACF83065.1|  unknown                                                 125   6e-31   Zea mays [maize]
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    127   7e-31   Nicotiana sylvestris
gb|AAB92518.1|  putative RNA binding protein                            127   8e-31   Nicotiana tabacum [American tobacco]
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    127   8e-31   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...    126   1e-30   Tarenaya hassleriana [spider flower]
emb|CDY06734.1|  BnaA10g05130D                                          124   1e-30   
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    125   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                  125   2e-30   
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    126   2e-30   Setaria italica
gb|EMS62393.1|  Uncharacterized RNA-binding protein C23E6.01c           125   3e-30   Triticum urartu
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...    125   3e-30   Setaria italica
gb|EEE57226.1|  hypothetical protein OsJ_07197                          125   4e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD17764.1|  putative nucleic acid binding protein                  125   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-30   Populus euphratica
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-30   Brachypodium distachyon [annual false brome]
gb|ACF87959.1|  unknown                                                 125   5e-30   Zea mays [maize]
ref|NP_001144988.1|  uncharacterized protein LOC100278143               124   5e-30   Zea mays [maize]
ref|XP_002313840.2|  RNA-binding protein 47                             124   6e-30   Populus trichocarpa [western balsam poplar]
gb|KHN31058.1|  Polyadenylate-binding protein RBP47                     122   7e-30   Glycine soja [wild soybean]
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47     124   7e-30   Populus euphratica
ref|XP_002891364.1|  ATRBP47C                                           124   8e-30   
gb|EMT16295.1|  Putative RNA-binding protein                            124   8e-30   
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    124   8e-30   Pyrus x bretschneideri [bai li]
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             124   1e-29   Prunus persica
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    124   1e-29   Prunus mume [ume]
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                    124   1e-29   Arabis alpina [alpine rockcress]
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                  123   1e-29   
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g             124   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002518798.1|  nuclear acid binding protein, putative             124   1e-29   Ricinus communis
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    124   1e-29   Prunus mume [ume]
dbj|BAJ85879.1|  predicted protein                                      124   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     123   2e-29   Solanum lycopersicum
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     122   2e-29   Solanum tuberosum [potatoes]
ref|XP_002863750.1|  hypothetical protein ARALYDRAFT_331131             122   3e-29   
emb|CDO97156.1|  unnamed protein product                                122   4e-29   Coffea canephora [robusta coffee]
gb|ACG32072.1|  nucleic acid binding protein                            121   5e-29   Zea mays [maize]
gb|KJB58433.1|  hypothetical protein B456_009G209600                    121   5e-29   Gossypium raimondii
gb|ACN40970.1|  unknown                                                 122   5e-29   Picea sitchensis
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540          122   5e-29   Sorghum bicolor [broomcorn]
gb|ACN39849.1|  unknown                                                 122   5e-29   Picea sitchensis
gb|ACF85767.1|  unknown                                                 121   6e-29   Zea mays [maize]
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    121   7e-29   Glycine max [soybeans]
ref|NP_001150649.1|  nucleic acid binding protein                       121   7e-29   Zea mays [maize]
ref|XP_006279885.1|  hypothetical protein CARUB_v100264670mg            120   8e-29   
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    121   8e-29   Pyrus x bretschneideri [bai li]
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     121   9e-29   Eucalyptus grandis [rose gum]
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg             121   9e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    120   1e-28   Tarenaya hassleriana [spider flower]
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                    120   1e-28   Arabis alpina [alpine rockcress]
gb|AAC49850.1|  DNA binding protein ACBF                                120   2e-28   Nicotiana tabacum [American tobacco]
ref|XP_002894197.1|  hypothetical protein ARALYDRAFT_474095             119   3e-28   
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...    119   5e-28   Zea mays [maize]
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                    119   5e-28   Arabis alpina [alpine rockcress]
gb|KFK31830.1|  hypothetical protein AALP_AA6G163800                    119   6e-28   Arabis alpina [alpine rockcress]
ref|NP_001130489.1|  uncharacterized protein LOC100191587               118   7e-28   Zea mays [maize]
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     118   8e-28   
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47     118   1e-27   Malus domestica [apple tree]
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A    118   1e-27   Brassica rapa
emb|CDY50959.1|  BnaA06g37550D                                          118   1e-27   Brassica napus [oilseed rape]
gb|ABK24911.1|  unknown                                                 117   1e-27   Picea sitchensis
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg             117   1e-27   Capsella rubella
ref|NP_001275480.1|  DNA binding protein ACBF-like                      117   1e-27   Solanum tuberosum [potatoes]
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    117   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    117   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG13046.1|AC011807_5  Putative RNA binding protein                  117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175383.1|  RNA-binding protein 47A                               117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307519.1|  hypothetical protein CARUB_v10009142mg             117   2e-27   Capsella rubella
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg             117   2e-27   Capsella rubella
ref|XP_010500505.1|  PREDICTED: polyadenylate-binding protein RBP...    117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010461802.1|  PREDICTED: polyadenylate-binding protein RBP...    117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010479396.1|  PREDICTED: polyadenylate-binding protein RBP...    117   2e-27   Camelina sativa [gold-of-pleasure]
gb|AFK41944.1|  unknown                                                 117   2e-27   Medicago truncatula
ref|XP_003610417.1|  RNA-binding protein                                117   2e-27   Medicago truncatula
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    117   3e-27   Fragaria vesca subsp. vesca
gb|AEW68341.1|  putative nuclear acid binding protein                   117   3e-27   Medicago sativa [alfalfa]
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    117   3e-27   Fragaria vesca subsp. vesca
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...    116   3e-27   Sesamum indicum [beniseed]
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...    116   3e-27   Sesamum indicum [beniseed]
gb|EMT05029.1|  Putative RNA-binding protein                            115   3e-27   
emb|CDY28101.1|  BnaC06g02820D                                          116   4e-27   Brassica napus [oilseed rape]
gb|ACL54800.1|  unknown                                                 115   4e-27   Zea mays [maize]
gb|KDO36653.1|  hypothetical protein CISIN_1g037126mg                   112   4e-27   Citrus sinensis [apfelsine]
emb|CDY68866.1|  BnaCnng60840D                                          116   5e-27   Brassica napus [oilseed rape]
gb|KHN37491.1|  Polyadenylate-binding protein RBP47                     115   6e-27   Glycine soja [wild soybean]
emb|CDX95462.1|  BnaC01g33540D                                          115   7e-27   
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...    115   8e-27   Brassica rapa
emb|CDY18570.1|  BnaA01g26250D                                          115   8e-27   Brassica napus [oilseed rape]
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    115   1e-26   Zea mays [maize]
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             115   1e-26   Phaseolus vulgaris [French bean]
ref|XP_002885294.1|  RNA-binding protein 47B                            115   1e-26   
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             115   1e-26   Phaseolus vulgaris [French bean]
emb|CDY16528.1|  BnaA08g02390D                                          115   1e-26   Brassica napus [oilseed rape]
ref|XP_009107272.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Brassica rapa
ref|XP_004168889.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   
ref|XP_004145357.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   
gb|EPS57677.1|  hypothetical protein M569_17140                         115   1e-26   Genlisea aurea
emb|CDY29341.1|  BnaA05g16080D                                          115   1e-26   Brassica napus [oilseed rape]
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg             115   1e-26   Eutrema salsugineum [saltwater cress]
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    114   2e-26   Glycine max [soybeans]
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     114   2e-26   Phoenix dactylifera
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     114   2e-26   Elaeis guineensis
gb|AAM67293.1|  nuclear acid binding protein, putative                  114   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188544.1|  RNA-binding protein 47B                               114   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...    114   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     114   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY32840.1|  BnaC08g02620D                                          114   3e-26   Brassica napus [oilseed rape]
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...    114   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    113   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFA36523.1|  nucleic acid binding protein                            109   4e-26   Lolium perenne [perennial ryegrass]
emb|CAC85246.1|  salt tolerance protein 6                               112   5e-26   Beta vulgaris [beet]
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...    112   8e-26   Phoenix dactylifera
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    112   9e-26   
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     112   9e-26   Cucumis melo [Oriental melon]
gb|KFK35996.1|  hypothetical protein AALP_AA4G064500                    112   1e-25   Arabis alpina [alpine rockcress]
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003608019.1|  RNA Binding Protein                                112   1e-25   Medicago truncatula
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    112   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...    111   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...    111   2e-25   Brassica rapa
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    111   3e-25   Citrus sinensis [apfelsine]
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             111   3e-25   Citrus clementina [clementine]
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...    111   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    110   3e-25   Citrus sinensis [apfelsine]
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             110   3e-25   Citrus clementina [clementine]
emb|CDP18029.1|  unnamed protein product                                111   4e-25   
gb|AFK40720.1|  unknown                                                 110   4e-25   
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    110   4e-25   
gb|ABR18422.1|  unknown                                                 110   6e-25   
emb|CDY22988.1|  BnaC03g40810D                                          110   6e-25   
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    109   9e-25   
gb|ABK25253.1|  unknown                                                 110   9e-25   
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             109   1e-24   
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    109   2e-24   
ref|XP_004153241.1|  PREDICTED: polyadenylate-binding protein RBP...    105   2e-24   
emb|CDP04387.1|  unnamed protein product                                105   2e-24   
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...    107   4e-24   
gb|KJB32435.1|  hypothetical protein B456_005G240800                    108   4e-24   
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              108   5e-24   
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    107   5e-24   
emb|CBI16387.3|  unnamed protein product                                107   5e-24   
gb|KGN55171.1|  hypothetical protein Csa_4G639100                       107   6e-24   
ref|XP_004164285.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    107   6e-24   
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    107   6e-24   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    107   7e-24   
gb|KHG01821.1|  Polyadenylate-binding RBP47C -like protein              107   7e-24   
gb|EAZ27535.1|  hypothetical protein OsJ_11490                          103   9e-24   
ref|XP_001784132.1|  predicted protein                                  107   9e-24   
ref|XP_002518499.1|  nuclear acid binding protein, putative             106   1e-23   
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   
gb|KHG24367.1|  Polyadenylate-binding RBP47                             105   2e-23   
gb|ADE77364.1|  unknown                                                 104   2e-23   
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     105   2e-23   
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    105   2e-23   
ref|NP_001132004.1|  uncharacterized protein LOC100193409               105   2e-23   
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c           105   2e-23   
dbj|BAJ93453.1|  predicted protein                                      105   2e-23   
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             105   2e-23   
dbj|BAB02953.1|  DNA/RNA binding protein-like                           106   3e-23   
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    105   3e-23   
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg                105   3e-23   
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    105   4e-23   
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    105   4e-23   
emb|CDP05748.1|  unnamed protein product                                104   5e-23   
gb|KJB79289.1|  hypothetical protein B456_013G042300                    105   5e-23   
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    104   6e-23   
ref|XP_002513488.1|  nuclear acid binding protein, putative             104   7e-23   
gb|EEC75600.1|  hypothetical protein OsI_12307                          104   7e-23   
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    104   8e-23   
ref|XP_007042377.1|  RNA-binding protein 47A                            104   9e-23   
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    104   9e-23   
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    104   9e-23   
ref|XP_001777334.1|  predicted protein                                  103   9e-23   
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-22   
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    104   1e-22   
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-22   
gb|EYU46265.1|  hypothetical protein MIMGU_mgv1a007107mg                103   1e-22   
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-22   
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-22   
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             103   1e-22   
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    103   1e-22   
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             103   1e-22   
ref|XP_007020874.1|  RNA-binding family protein                         103   1e-22   
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg                103   2e-22   
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    103   2e-22   
ref|XP_006858185.1|  hypothetical protein AMTR_s00062p00161920          104   2e-22   
gb|EMS47480.1|  Uncharacterized RNA-binding protein C23E6.01c           101   2e-22   
ref|XP_009768585.1|  PREDICTED: polyadenylate-binding protein RBP...    103   2e-22   
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    103   2e-22   
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    103   2e-22   
gb|KDP20762.1|  hypothetical protein JCGZ_21233                         103   2e-22   
gb|ABF97193.1|  RNA recognition motif family protein, expressed         102   2e-22   
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 102   2e-22   
gb|KHN33037.1|  Polyadenylate-binding protein RBP45                     102   2e-22   
emb|CDX92304.1|  BnaA05g21030D                                          102   3e-22   
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             102   3e-22   
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    102   3e-22   
emb|CBI26626.3|  unnamed protein product                                100   3e-22   
gb|KJB09397.1|  hypothetical protein B456_001G139100                    102   3e-22   
gb|KJB09396.1|  hypothetical protein B456_001G139100                    102   3e-22   
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    102   4e-22   
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    102   4e-22   
gb|KJB09398.1|  hypothetical protein B456_001G139100                    102   4e-22   
ref|XP_004295261.2|  PREDICTED: polyadenylate-binding protein RBP45B    102   4e-22   
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    102   4e-22   
ref|NP_001050516.1|  Os03g0569900                                       102   4e-22   
ref|XP_007015034.1|  RNA-binding family protein isoform 2               102   5e-22   
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...    102   5e-22   
ref|XP_007015035.1|  RNA-binding family protein isoform 3               102   5e-22   
ref|XP_007015033.1|  RNA-binding family protein isoform 1               102   5e-22   
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    102   5e-22   
ref|XP_010911059.1|  PREDICTED: polyadenylate-binding protein RBP...    100   6e-22   
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    101   6e-22   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             101   7e-22   
gb|KJB22074.1|  hypothetical protein B456_004G028000                    101   7e-22   
emb|CDX99265.1|  BnaC05g33800D                                          101   7e-22   
gb|KJB13666.1|  hypothetical protein B456_002G088100                    101   7e-22   
ref|XP_009615947.1|  PREDICTED: polyadenylate-binding protein RBP...    101   7e-22   
gb|KJB13664.1|  hypothetical protein B456_002G088100                    101   7e-22   
gb|KJB13665.1|  hypothetical protein B456_002G088100                    101   8e-22   
ref|XP_002460777.1|  hypothetical protein SORBIDRAFT_02g034736        98.2    9e-22   
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    101   9e-22   
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    100   1e-21   
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    100   1e-21   
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    100   1e-21   
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg             100   2e-21   
emb|CAN83958.1|  hypothetical protein VITISV_039907                     100   2e-21   
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   
ref|XP_004250947.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   
ref|XP_011080284.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   
ref|XP_010313279.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             100   3e-21   
gb|EPS67039.1|  hypothetical protein M569_07737                       99.8    3e-21   
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...  99.8    3e-21   
ref|XP_006361747.1|  PREDICTED: polyadenylate-binding protein RBP...  99.8    3e-21   
ref|XP_006361746.1|  PREDICTED: polyadenylate-binding protein RBP...  99.8    3e-21   
gb|KDP22083.1|  hypothetical protein JCGZ_25914                       99.8    3e-21   
ref|XP_002988285.1|  hypothetical protein SELMODRAFT_447249           99.4    3e-21   
dbj|BAE71244.1|  putative DNA binding protein                         99.4    4e-21   
ref|XP_009135617.1|  PREDICTED: polyadenylate-binding protein RBP...  99.8    4e-21   
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    4e-21   
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45   99.4    4e-21   
gb|EEE68172.1|  hypothetical protein OsJ_26296                        98.6    5e-21   
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...  99.0    5e-21   
gb|KCW76953.1|  hypothetical protein EUGRSUZ_D01313                   97.8    6e-21   
gb|EMS60206.1|  RNA-binding post-transcriptional regulator csx1       98.6    6e-21   
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...  99.0    6e-21   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...  99.0    7e-21   
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein            99.0    7e-21   
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...  98.6    7e-21   
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570        98.6    9e-21   
gb|KHN33346.1|  Polyadenylate-binding protein RBP47B'                 97.4    9e-21   
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg           98.2    1e-20   
gb|KJB32438.1|  hypothetical protein B456_005G240800                  97.8    1e-20   
ref|XP_004957865.1|  PREDICTED: polyadenylate-binding protein RBP...  99.0    1e-20   
gb|ACR34003.1|  unknown                                               98.2    1e-20   
ref|NP_001152183.1|  LOC100285821                                     98.2    1e-20   
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg           98.2    1e-20   
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45   97.8    1e-20   
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                   97.8    1e-20   
ref|NP_001141359.1|  uncharacterized protein LOC100273450             98.6    1e-20   
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    2e-20   
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    2e-20   
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    2e-20   
ref|XP_004957864.1|  PREDICTED: polyadenylate-binding protein RBP...  99.0    2e-20   
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    2e-20   
gb|KJB47423.1|  hypothetical protein B456_008G025400                  97.4    2e-20   
dbj|BAD05744.1|  putative RNA Binding Protein 45                      97.8    2e-20   
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...  97.4    2e-20   
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    2e-20   
tpg|DAA62918.1|  TPA: hypothetical protein ZEAMMB73_604225            98.2    2e-20   
ref|XP_008651136.1|  PREDICTED: hypothetical protein isoform X1       98.2    2e-20   
ref|NP_001142233.1|  hypothetical protein                             98.2    2e-20   
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...  97.4    3e-20   
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    3e-20   
dbj|BAK03410.1|  predicted protein                                    97.4    3e-20   
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...  97.4    3e-20   
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                  97.4    3e-20   
gb|KJB79291.1|  hypothetical protein B456_013G042300                  96.7    4e-20   
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...  96.3    4e-20   
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    4e-20   
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    4e-20   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    5e-20   
gb|KJB47422.1|  hypothetical protein B456_008G025400                  95.9    6e-20   
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...  96.7    6e-20   
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    7e-20   
ref|XP_006850190.1|  hypothetical protein AMTR_s00022p00247520        96.3    8e-20   
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    8e-20   
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                  95.5    1e-19   
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C  95.5    1e-19   
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                95.5    1e-19   
gb|AAM64532.1|  putative DNA binding protein                          95.5    1e-19   
ref|XP_004486967.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    1e-19   
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    1e-19   
ref|XP_010054589.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  94.0    1e-19   
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45              96.7    1e-19   
ref|XP_004486966.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    1e-19   
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...  95.1    2e-19   
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    2e-19   
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    2e-19   
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg              94.7    2e-19   
ref|XP_003543537.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    2e-19   
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    2e-19   
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    3e-19   
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    3e-19   
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    3e-19   
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    3e-19   
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    3e-19   
gb|KDP39118.1|  hypothetical protein JCGZ_00875                       94.0    3e-19   
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    4e-19   
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    4e-19   
gb|ABF94248.1|  RNA recognition motif family protein, expressed       94.0    4e-19   
gb|EEC74608.1|  hypothetical protein OsI_10216                        94.0    4e-19   
ref|NP_001049124.1|  Os03g0174100                                     94.0    5e-19   
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg           93.6    5e-19   
ref|XP_002889883.1|  ATRBP45B                                         93.6    5e-19   
ref|XP_002963882.1|  hypothetical protein SELMODRAFT_80061            92.8    5e-19   
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    5e-19   
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170        93.6    6e-19   
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                 93.2    7e-19   
ref|XP_002522953.1|  nuclear acid binding protein, putative           93.2    7e-19   
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...  93.2    7e-19   
gb|EMT04468.1|  RNA-binding post-transcriptional regulator csx1       92.4    8e-19   
ref|XP_010476097.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    8e-19   
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                 93.2    8e-19   
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    9e-19   
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg           92.4    9e-19   
dbj|BAJ87828.1|  predicted protein                                    92.4    1e-18   
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg           93.2    1e-18   
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B  92.4    1e-18   
ref|XP_010041417.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    1e-18   
gb|KCW44364.1|  hypothetical protein EUGRSUZ_L02167                   91.3    1e-18   
gb|EAY95631.1|  hypothetical protein OsI_17488                        91.3    1e-18   
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g           92.8    1e-18   
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    1e-18   
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    1e-18   
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    1e-18   
ref|XP_002316998.2|  RNA-binding protein 45                           92.4    1e-18   
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    1e-18   
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    2e-18   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    2e-18   



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPF+QYGEIV  KIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSW
Sbjct  318  NVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLSW  377

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++QSRSDF NQW G YYGGHFYDGY YAFP PH+P     AAYGAYP+YGTHQQQ
Sbjct  378  GRNPANKQSRSDFGNQWTGPYYGGHFYDGYGYAFPPPHDPG-MYAAAYGAYPVYGTHQQQ  436

Query  255  VS  250
            VS
Sbjct  437  VS  438



>ref|XP_004238180.1| PREDICTED: polyadenylate-binding protein RBP47-like [Solanum 
lycopersicum]
Length=451

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPF+QYGEIV  KIPVGKGCGFVQFA R DAEEALQKL G  IGKQTVRLSW
Sbjct  331  NVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFAKRNDAEEALQKLNGTAIGKQTVRLSW  390

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q RSDF NQW G YYGGHFYDGY YAFP PH+P     AAYGAYP+YGTHQQQ
Sbjct  391  GRNPANKQPRSDFGNQWTGPYYGGHFYDGYGYAFPQPHDPG-MYAAAYGAYPVYGTHQQQ  449

Query  255  VS  250
            VS
Sbjct  450  VS  451



>ref|XP_009629702.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=456

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPF+QYGEIV  KIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSW
Sbjct  333  NVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLSW  392

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQ  262
            GRNPA++QSR DF NQW G YYGGHFYDGY YAFP PH+P MYA AA          THQ
Sbjct  393  GRNPANKQSRGDFGNQWTGPYYGGHFYDGYGYAFPPPHDPGMYAAAAAAYGAYPMYGTHQ  452

Query  261  QQVS  250
            QQVS
Sbjct  453  QQVS  456



>ref|XP_009765294.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
sylvestris]
Length=456

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPF+QYGEIV  KIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSW
Sbjct  333  NVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLSW  392

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQ  262
            GRNPA++QSR DF NQW G YYGGHFYDGY YAFP  H+P MYA AA          THQ
Sbjct  393  GRNPANKQSRGDFGNQWTGPYYGGHFYDGYGYAFPPQHDPGMYAAAAAAYGAYPIYGTHQ  452

Query  261  QQVS  250
            QQVS
Sbjct  453  QQVS  456



>emb|CBI19566.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AE+ALQKL G VIGKQTVRLSW
Sbjct  204  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSW  263

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R+DF NQW+GAYYGG  YDGY YA P PH+P     AAYGAYP+YG HQQQ
Sbjct  264  GRNPANKQMRADFGNQWSGAYYGGQVYDGYGYALPPPHDPT-MYAAAYGAYPVYGNHQQQ  322

Query  255  VS  250
            VS
Sbjct  323  VS  324



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AE+ALQKL G VIGKQTVRLSW
Sbjct  298  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSW  357

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R+DF NQW+GAYYGG  YDGY YA P PH+P     AAYGAYP+YG HQQQ
Sbjct  358  GRNPANKQMRADFGNQWSGAYYGGQVYDGYGYALPPPHDPT-MYAAAYGAYPVYGNHQQQ  416

Query  255  VS  250
            VS
Sbjct  417  VS  418



>emb|CDP01376.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPF QYGEIV  KIPVGKGCGFVQFANR DAEEALQKL G  IGKQTVRLSW
Sbjct  279  NVSDEDLRQPFLQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTTIGKQTVRLSW  338

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQ  262
            GRNPA++Q R++F NQW GAYYGGHFYDGY YA P PH+P MYA AA          THQ
Sbjct  339  GRNPANKQLRAEFGNQWTGAYYGGHFYDGYGYAMPPPHDPGMYAAAAAAYGAYPMYGTHQ  398

Query  261  QQVS  250
            QQVS
Sbjct  399  QQVS  402



>ref|XP_009605325.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            VSDEDLR PF+QYGEI   KIPVGKGCGFVQFA R DAE+ALQKL G  IGKQTVRLSWG
Sbjct  302  VSDEDLRHPFAQYGEIASVKIPVGKGCGFVQFAKRNDAEKALQKLNGTAIGKQTVRLSWG  361

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQV  253
            RNPA++QSR+DF  QW G YYGGHFY+ Y YAFP PH+P+MYA AAYG YP+YGTHQQQV
Sbjct  362  RNPANKQSRADFMKQWTGPYYGGHFYNAYGYAFPPPHDPSMYAAAAYGTYPIYGTHQQQV  421

Query  252  S  250
            S
Sbjct  422  S  422



>gb|KDP38389.1| hypothetical protein JCGZ_04314 [Jatropha curcas]
Length=437

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIP+GKGCGFVQFANR++AEEALQKL G VIGKQTVRLSW
Sbjct  314  NVTDEDLKQPFSQYGEIVSVKIPLGKGCGFVQFANRSNAEEALQKLNGTVIGKQTVRLSW  373

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp--myGTHQ  262
            GRNPA++Q R+DF NQW+GAYYGG  YDGY YA P PH+P+MYA AA       +YG+HQ
Sbjct  374  GRNPANKQFRADFGNQWSGAYYGGQVYDGYGYALPPPHDPSMYAAAAAAYGAYPVYGSHQ  433

Query  261  QQVS  250
            QQVS
Sbjct  434  QQVS  437



>ref|XP_007017331.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
 gb|EOY14556.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
Length=436

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  313  NVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  372

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
            GRNPA++Q R+D+ NQW+GAYYGG  YDGY YAFP PH+P MYA AA        YG+HQ
Sbjct  373  GRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAFPPPHDPGMYAAAAATYGAYPIYGSHQ  432

Query  261  QQVS  250
            QQVS
Sbjct  433  QQVS  436



>ref|XP_007017329.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
 gb|EOY14554.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
Length=435

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  312  NVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  371

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
            GRNPA++Q R+D+ NQW+GAYYGG  YDGY YAFP PH+P MYA AA        YG+HQ
Sbjct  372  GRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAFPPPHDPGMYAAAAATYGAYPIYGSHQ  431

Query  261  QQVS  250
            QQVS
Sbjct  432  QQVS  435



>ref|XP_007222286.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
 gb|EMJ23485.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
Length=438

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLR PFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  317  NVTDEDLRHPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  376

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R+DF NQWAGAYYGG  YDGY YA P  H+P+MYA AAYGAYP+YGTHQQQ
Sbjct  377  GRNPANKQFRTDFGNQWAGAYYGGPVYDGYGYALPPHHDPSMYAAAAYGAYPVYGTHQQQ  436

Query  255  VS  250
            VS
Sbjct  437  VS  438



>gb|KDO35910.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=189

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI   KIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSW
Sbjct  66   NVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSW  125

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQ  262
            GRNPA++Q R+D+ NQW+GAYYGG  YDGY YA P P++P+MYA AA          +HQ
Sbjct  126  GRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQ  185

Query  261  QQVS  250
            QQVS
Sbjct  186  QQVS  189



>ref|XP_009764865.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
sylvestris]
Length=423

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            VSDEDLRQ F+QYGEI   KIPVGKGCGFVQFA R DAE+ALQKL G  IGKQTVRLSWG
Sbjct  303  VSDEDLRQLFAQYGEIASVKIPVGKGCGFVQFAKRNDAEKALQKLNGTAIGKQTVRLSWG  362

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQV  253
            RNPA++QSR+DF  QW G YYGGHFY+ Y YAFP PH+P+MYA AAYGAYP+YGTHQQQV
Sbjct  363  RNPANKQSRADFMKQWTGPYYGGHFYNAYGYAFPPPHDPSMYAAAAYGAYPIYGTHQQQV  422

Query  252  S  250
            S
Sbjct  423  S  423



>gb|EYU20972.1| hypothetical protein MIMGU_mgv1a018561mg, partial [Erythranthe 
guttata]
Length=125

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEI+  KIPVGKGCGFVQFANR +AEEALQ+L G  IGKQTVRLSW
Sbjct  5    NVSDEDLRQPFSQYGEIISVKIPVGKGCGFVQFANRNEAEEALQQLTGTTIGKQTVRLSW  64

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++QSR D  NQW GAYYG   +DGY YA   PH+P+    AAYGAYPMYGTHQQQ
Sbjct  65   GRNPANKQSRGDLGNQWTGAYYGPPSFDGYGYAVGPPHDPS-MYAAAYGAYPMYGTHQQQ  123

Query  255  VS  250
            VS
Sbjct  124  VS  125



>gb|KDO35914.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
 gb|KDO35915.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=198

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI   KIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSW
Sbjct  75   NVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSW  134

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp--myGTHQ  262
            GRNPA++Q R+D+ NQW+GAYYGG  YDGY YA P P++P+MYA AA       +YG+HQ
Sbjct  135  GRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQ  194

Query  261  QQVS  250
            QQVS
Sbjct  195  QQVS  198



>ref|XP_008220171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=441

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  318  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  377

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQ  262
            GRNPA++Q R+DF NQWAGAYYGG  YDGY YA P  H+P+MYA AA          THQ
Sbjct  378  GRNPANKQFRTDFGNQWAGAYYGGPVYDGYGYALPPHHDPSMYAAAAAAYGAYPVYGTHQ  437

Query  261  QQVS  250
            QQVS
Sbjct  438  QQVS  441



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPVGKGCGFVQFA+R++AEEALQKL G VIGKQTVRLSW
Sbjct  322  NVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFASRSNAEEALQKLNGTVIGKQTVRLSW  381

Query  435  GRNPAHRQS-RSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQ  259
            GRNPA++Q  RSDF NQW GAYYGG  YDGY YA P PH+P+    A YGAYP+YG+HQQ
Sbjct  382  GRNPANKQQLRSDFGNQWGGAYYGGQIYDGYGYALPPPHDPS-MYAAPYGAYPVYGSHQQ  440

Query  258  QVS  250
            QVS
Sbjct  441  QVS  443



>ref|XP_004141245.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160607.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
Length=426

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR DAEEALQKL G VIGKQTVRLSW
Sbjct  302  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTVIGKQTVRLSW  361

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF NQW GAYYGGH YDGY Y   +PH+P+    AAYGAY +YG HQQQ
Sbjct  362  GRNPANKQFR-DFGNQWNGAYYGGHIYDGYGYGLASPHDPS-MYHAAYGAYTVYGNHQQQ  419

Query  255  VS*M  244
            V  M
Sbjct  420  VEQM  423



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPV KGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  309  NVTDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  368

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNP H+Q R+DF++ W GAYYGG  YDGY YA P PH+P+    AAYGAYPMYG HQQQ
Sbjct  369  GRNPGHKQHRADFSSPWNGAYYGGQVYDGYGYALPPPHDPS-TYAAAYGAYPMYGNHQQQ  427

Query  255  VS  250
            VS
Sbjct  428  VS  429



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V DEDLRQPFSQYGEIV  KIP GKGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  303  SVIDEDLRQPFSQYGEIVSVKIPTGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  362

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF NQW GAYYGG  YDGY YA P PH+P+    A+YGAYP+YG+HQQQ
Sbjct  363  GRNPANKQYRGDFGNQWGGAYYGGQVYDGYGYALPPPHDPS-MYAASYGAYPLYGSHQQQ  421

Query  255  VS  250
            V+
Sbjct  422  VN  423



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  306  NVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFANRDNAEEALQKLNGTVIGKQTVRLSW  365

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
            GRNPA++Q R+DF + W GAYYGG  YDGY YA P PH+P+MYA AA        YG+HQ
Sbjct  366  GRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALPPPHDPSMYAAAAAAYGAYPIYGSHQ  425

Query  261  QQVS  250
            QQVS
Sbjct  426  QQVS  429



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGEIV  KIPVGKGCGFVQFA R +AEEALQKL G +IGKQTVRLSW
Sbjct  312  NVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAGRNNAEEALQKLNGTIIGKQTVRLSW  371

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GRNP ++Q R+D+ NQW GAYYGG  YDGY YAFP PHNP
Sbjct  372  GRNPTNKQFRADYGNQWGGAYYGGAVYDGYGYAFPPPHNP  411



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQ FSQYGEIV  KIPVGKGCGFVQ+ANR +AEEALQKL G+VIGKQTVRLSW
Sbjct  299  NVTEEDLRQSFSQYGEIVSVKIPVGKGCGFVQYANRKNAEEALQKLNGMVIGKQTVRLSW  358

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R D+ NQW GAYYGG  YDGY YA P PH+P     AAYG YP+YG+HQQQ
Sbjct  359  GRNPANKQFRGDYGNQWGGAYYGGQVYDGYRYAVPPPHDPG-MYAAAYGTYPIYGSHQQQ  417

Query  255  VS  250
            VS
Sbjct  418  VS  419



>emb|CAN81343.1| hypothetical protein VITISV_008697 [Vitis vinifera]
Length=536

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 102/143 (71%), Gaps = 5/143 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AE+ALQKL G VIGKQTVRLSW
Sbjct  186  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSW  245

Query  435  GRNPAHRQS-----RSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG  271
            GRNPA++Q+     R+DF NQW+GAYYGG  YDGY YA P PH+P MYA A         
Sbjct  246  GRNPANKQANSLFMRADFGNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYGN  305

Query  270  THQQQVS*MSAQEDYLQLRWHFW  202
              QQ++   S  +    L W  W
Sbjct  306  HQQQKMFSGSIHDSNGFLMWLIW  328



>ref|XP_008452518.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=426

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQ+GEIV  KIPVGKGCGFVQFANR DAEEALQKL G VIGKQTVRLSW
Sbjct  302  NVTDEDLRQPFSQHGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTVIGKQTVRLSW  361

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R +F NQW GAYYGGH YDGY Y   +PH+P+    AAYGAY +YG HQQQ
Sbjct  362  GRNPANKQFR-EFGNQWNGAYYGGHIYDGYGYGLASPHDPS-MYHAAYGAYTVYGNHQQQ  419

Query  255  VS*M  244
            V  M
Sbjct  420  VEQM  423



>ref|XP_008220170.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=442

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  318  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  377

Query  435  GRNPAHRQS-RSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--TH  265
            GRNPA++Q  R+DF NQWAGAYYGG  YDGY YA P  H+P+MYA AA          TH
Sbjct  378  GRNPANKQQFRTDFGNQWAGAYYGGPVYDGYGYALPPHHDPSMYAAAAAAYGAYPVYGTH  437

Query  264  QQQVS  250
            QQQVS
Sbjct  438  QQQVS  442



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPV KGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  307  NVTDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  366

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNP ++Q R+DF++ W GAYYGG  YDGY YA P PH+P+    AAYGAYPMYG HQQQ
Sbjct  367  GRNPGNKQHRADFSSPWNGAYYGGQVYDGYGYALPPPHDPS-TYAAAYGAYPMYGNHQQQ  425

Query  255  VS  250
            VS
Sbjct  426  VS  427



>ref|XP_006473363.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Citrus 
sinensis]
Length=433

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI   KIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSW
Sbjct  310  NVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSW  369

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp--myGTHQ  262
            GRNPA++Q R+D+ NQW+GAYYGG  YDGY YA P P++P+MYA AA       +YG+HQ
Sbjct  370  GRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQ  429

Query  261  QQVS  250
            QQVS
Sbjct  430  QQVS  433



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPV KGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  307  NVNDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  366

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNP ++Q R+DF++ W GAYYGG  YDGY YA P PH+P+    AAYGAYPMYG HQQQ
Sbjct  367  GRNPGNKQHRADFSSPWNGAYYGGQVYDGYGYALPPPHDPS-TYAAAYGAYPMYGNHQQQ  425

Query  255  VS  250
            VS
Sbjct  426  VS  427



>ref|XP_006434827.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48067.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=432

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI   KIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSW
Sbjct  309  NVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSW  368

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp--myGTHQ  262
            GRNPA++Q R+D+ NQW+GAYYGG  YDGY YA P P++P+MYA AA       +YG+HQ
Sbjct  369  GRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQ  428

Query  261  QQVS  250
            QQVS
Sbjct  429  QQVS  432



>gb|KHN12758.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSW
Sbjct  198  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSW  257

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF + W GAYYG   YDGY YA P  H+P++YA A        G HQQQ
Sbjct  258  GRNPANKQFRMDFGSPWTGAYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGG-HQQQ  316

Query  255  VS  250
            VS
Sbjct  317  VS  318



>ref|XP_007160823.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
 gb|ESW32817.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
Length=415

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSW
Sbjct  295  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSW  354

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF N W GAYYG   YDGY YA P  H+P+    AAYGAYP+YG HQQQ
Sbjct  355  GRNPANKQFRMDFGNPWTGAYYGAPIYDGYGYALPPRHDPS-IYAAAYGAYPLYGAHQQQ  413

Query  255  VS  250
            VS
Sbjct  414  VS  415



>gb|AGV54251.1| RNA binding post-transcriptional regulator csx1 like protein 
[Phaseolus vulgaris]
Length=416

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSW
Sbjct  296  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSW  355

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF N W GAYYG   YDGY YA P  H+P+    AAYGAYP+YG HQQQ
Sbjct  356  GRNPANKQFRMDFGNPWTGAYYGAPIYDGYGYALPPRHDPS-IYAAAYGAYPLYGAHQQQ  414

Query  255  VS  250
            VS
Sbjct  415  VS  416



>gb|KHN46301.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSW
Sbjct  198  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTSIGKQTVRLSW  257

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF N W GAYYG   YDGY YA    H+P++YA A        G HQQQ
Sbjct  258  GRNPANKQFRMDFGNPWTGAYYGAPMYDGYGYALTPRHDPSIYAAAYGAYPLYGG-HQQQ  316

Query  255  VS  250
            VS
Sbjct  317  VS  318



>ref|XP_008361011.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=443

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  319  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  378

Query  435  GRNPAHRQSRSDFTNQWAGA-YYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--TH  265
            GRNPA++Q RSDF NQW GA YYGG  Y+GY YA P  H+P+MYA AA          TH
Sbjct  379  GRNPANKQFRSDFGNQWGGAXYYGGPVYEGYGYALPPHHDPSMYAAAAAAYGAYPVYGTH  438

Query  264  QQQVS  250
            QQQVS
Sbjct  439  QQQVS  443



>ref|XP_009370172.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Pyrus x bretschneideri]
Length=440

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  316  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  375

Query  435  GRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--TH  265
            GRNPA++Q RSDF NQW G AYYGG  Y+GY YA P  H+P+MYA A+          TH
Sbjct  376  GRNPANKQFRSDFGNQWGGAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGTH  435

Query  264  QQQVS  250
            QQQVS
Sbjct  436  QQQVS  440



>ref|XP_008357395.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Malus domestica]
Length=444

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  320  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  379

Query  435  GRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--TH  265
            GRNPA++Q RSDF NQW G AYYGG  Y+GY YA P  H+P+MYA A+          TH
Sbjct  380  GRNPANKQFRSDFGNQWGGAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGTH  439

Query  264  QQQVS  250
            QQQVS
Sbjct  440  QQQVS  444



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQYGEI+  KIPVGKGCGFVQFANRT+AEEALQKL G VIGKQTVRLSW
Sbjct  299  SVTDEDLRQPFSQYGEIISVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLSW  358

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++  R D  NQW GAYYGG  YDGY Y  P PH+P+MYA A        G HQQQ
Sbjct  359  GRNPANKM-RIDPVNQWNGAYYGGQVYDGYGYVIPPPHDPSMYAAAYGAYPIYGG-HQQQ  416

Query  255  VS  250
            VS
Sbjct  417  VS  418



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQYGEI+  KIPVGKGCGFVQFANRT+AEEALQKL G VIGKQTVRLSW
Sbjct  294  SVTDEDLRQPFSQYGEIISVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLSW  353

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++  R D  NQW GAYYGG  YDGY Y  P PH+P+MYA A        G HQQQ
Sbjct  354  GRNPANKM-RIDPVNQWNGAYYGGQVYDGYGYVIPPPHDPSMYAAAYGAYPIYGG-HQQQ  411

Query  255  VS  250
            VS
Sbjct  412  VS  413



>gb|KHN04518.1| Polyadenylate-binding protein RBP47C, partial [Glycine soja]
Length=376

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+ EDL+QPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQ VRLSW
Sbjct  255  NVTAEDLKQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQMVRLSW  314

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+PA++Q R+DF N W+GAYYGG  YDGY YA P P++P++YA AAYGAYP+YG +QQQ
Sbjct  315  GRSPANKQFRADFGNAWSGAYYGGPVYDGYGYALPPPYDPSIYAAAAYGAYPIYGGYQQQ  374

Query  255  VS  250
            VS
Sbjct  375  VS  376



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANRT+AEEALQKL G VIGKQTVRLSW
Sbjct  287  SVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLSW  346

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTHQQ  259
            GRNPA++  R+D  NQW GAYYGG  YDGY YA P P +P+MYA A       +YG HQQ
Sbjct  347  GRNPANKL-RADPVNQWNGAYYGGQVYDGYGYAVPPPQDPSMYAAATAYGAYPIYGNHQQ  405

Query  258  QVS  250
            QVS
Sbjct  406  QVS  408



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANRT+AEEALQKL G VIGKQTVRLSW
Sbjct  292  SVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLSW  351

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTHQQ  259
            GRNPA++  R+D  NQW GAYYGG  YDGY YA P P +P+MYA A       +YG HQQ
Sbjct  352  GRNPANKL-RADPVNQWNGAYYGGQVYDGYGYAVPPPQDPSMYAAATAYGAYPIYGNHQQ  410

Query  258  QVS  250
            QVS
Sbjct  411  QVS  413



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSW
Sbjct  293  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSW  352

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF + W GAYYG   YDGY YA P  H+P++YA A        G HQQQ
Sbjct  353  GRNPANKQFRMDFGSPWTGAYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGG-HQQQ  411

Query  255  VS  250
            VS
Sbjct  412  VS  413



>ref|XP_004291135.1| PREDICTED: polyadenylate-binding protein RBP47-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 101/125 (81%), Gaps = 3/125 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  320  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGSVIGKQTVRLSW  379

Query  435  GRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTH  265
            GRNPA++Q  R DF NQWAG AYYGG  YDGY YA P  H+P+MYA AA      +YGTH
Sbjct  380  GRNPANKQQFRMDFGNQWAGAAYYGGPVYDGYGYALPPQHDPSMYAAAAAYGAYPVYGTH  439

Query  264  QQQVS  250
            QQQVS
Sbjct  440  QQQVS  444



>ref|XP_003523906.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=409

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+ EDL+QPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQ VRLSW
Sbjct  288  NVTAEDLKQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQMVRLSW  347

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+PA++Q R+DF N W+GAYYGG  YDGY YA P P++P++YA AAYGAYP+YG +QQQ
Sbjct  348  GRSPANKQFRADFGNAWSGAYYGGPVYDGYGYALPPPYDPSIYAAAAYGAYPIYGGYQQQ  407

Query  255  VS  250
            VS
Sbjct  408  VS  409



>ref|XP_011030480.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Populus euphratica]
Length=427

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPVGKGCGFVQFA R +AEEALQ+L G VIGKQTVRLSW
Sbjct  305  NVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAKRDNAEEALQRLNGTVIGKQTVRLSW  364

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
            GRNPA++Q R+DF + W GAYYGG  YDGY YA P PH+P+MYA AA        YG+HQ
Sbjct  365  GRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALP-PHDPSMYAAAAAAYGAYPIYGSHQ  423

Query  261  QQVS  250
            QQVS
Sbjct  424  QQVS  427



>ref|XP_011030472.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Populus euphratica]
Length=428

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPVGKGCGFVQFA R +AEEALQ+L G VIGKQTVRLSW
Sbjct  306  NVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAKRDNAEEALQRLNGTVIGKQTVRLSW  365

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
            GRNPA++Q R+DF + W GAYYGG  YDGY YA P PH+P+MYA AA        YG+HQ
Sbjct  366  GRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALP-PHDPSMYAAAAAAYGAYPIYGSHQ  424

Query  261  QQVS  250
            QQVS
Sbjct  425  QQVS  428



>ref|XP_011030463.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Populus euphratica]
Length=428

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+QPFSQYGEIV  KIPVGKGCGFVQFA R +AEEALQ+L G VIGKQTVRLSW
Sbjct  306  NVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAKRDNAEEALQRLNGTVIGKQTVRLSW  365

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
            GRNPA++Q R+DF + W GAYYGG  YDGY YA P PH+P+MYA AA        YG+HQ
Sbjct  366  GRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALP-PHDPSMYAAAAAAYGAYPIYGSHQ  424

Query  261  QQVS  250
            QQVS
Sbjct  425  QQVS  428



>gb|ABY75165.1| RNA binding protein [Arachis diogoi]
Length=142

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQ FSQYGEIV  K+PVGKGCGFVQFA R +AEEALQKL G VIGKQTVRLSW
Sbjct  21   NVTDEDLRQQFSQYGEIVSVKVPVGKGCGFVQFAIRNNAEEALQKLNGTVIGKQTVRLSW  80

Query  435  GRNPAHRQSRSDF-TNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GRNPA++Q R DF  N W+G YYG   YDGY YA P PH+P+
Sbjct  81   GRNPANKQFRMDFGGNHWSGTYYGAPVYDGYGYALPPPHDPS  122



>ref|XP_008357394.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Malus domestica]
Length=382

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 98/126 (78%), Gaps = 4/126 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  257  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  316

Query  435  GRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--T  268
            GRNPA++Q  RSDF NQW G AYYGG  Y+GY YA P  H+P+MYA A+          T
Sbjct  317  GRNPANKQQFRSDFGNQWGGAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGT  376

Query  267  HQQQVS  250
            HQQQVS
Sbjct  377  HQQQVS  382



>gb|KHN22302.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=411

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+ EDL+QPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQ VRLSW
Sbjct  291  NVTAEDLKQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQMVRLSW  350

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R+DF N W+GAYYGG  YDGY YA P  H+P++YA A        G HQQQ
Sbjct  351  GRNPANKQFRADFGNAWSGAYYGGPVYDGYGYALPPSHDPSIYAAAYGAYPIYGG-HQQQ  409

Query  255  VS  250
            VS
Sbjct  410  VS  411



>ref|XP_006393576.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
 gb|ESQ30862.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
Length=447

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+ YGEIV  KIP+GKGCGFVQF NR DAEEAL+KL G VIGKQTVRLSW
Sbjct  326  SVTDEDLRQPFTAYGEIVSVKIPLGKGCGFVQFVNRPDAEEALEKLNGTVIGKQTVRLSW  385

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+PA++Q R  + NQW G YYGG FY+GY Y  P PH+P MYA   YG YPMYG HQQQ
Sbjct  386  GRSPANKQPRDKYGNQWVGPYYGGQFYNGYGYMVPQPHDPRMYAAGPYGGYPMYGGHQQQ  445

Query  255  VS  250
            VS
Sbjct  446  VS  447



>ref|XP_009367486.1| PREDICTED: polyadenylate-binding protein RBP47-like, partial 
[Pyrus x bretschneideri]
Length=410

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (78%), Gaps = 4/126 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  285  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  344

Query  435  GRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--T  268
            GRNPA++Q  RSDF NQW G AYYGG  Y+GY YA P  H+P+MYA AA          T
Sbjct  345  GRNPANKQQFRSDFGNQWGGAAYYGGPVYEGYGYALPPHHDPSMYAAAAAAYGAYPMYGT  404

Query  267  HQQQVS  250
            HQQQVS
Sbjct  405  HQQQVS  410



>ref|XP_003544447.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=425

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSW
Sbjct  305  NVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTSIGKQTVRLSW  364

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF N W GAYYG   YDGY YA    H+P++YA A        G HQQQ
Sbjct  365  GRNPANKQFRMDFGNPWTGAYYGAPMYDGYGYALTPRHDPSIYAAAYGAYPLYGG-HQQQ  423

Query  255  VS  250
            VS
Sbjct  424  VS  425



>ref|XP_011083821.1| PREDICTED: polyadenylate-binding protein RBP47-like [Sesamum 
indicum]
Length=432

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI+  KIPVGKGCGFVQFANR +AE ALQ+L G  IGKQ VRLSW
Sbjct  312  NVTDEDLRQPFSQYGEILSVKIPVGKGCGFVQFANRNNAEAALQRLSGTTIGKQIVRLSW  371

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+ A++Q R+D+ +QW+GAYYGG F+DGY YA P  H+PN   PAAYGAY +Y THQQQ
Sbjct  372  GRSLANKQLRADYGHQWSGAYYGGTFFDGYGYALPPLHSPN-MYPAAYGAYSIYSTHQQQ  430

Query  255  VS  250
            VS
Sbjct  431  VS  432



>ref|XP_008393835.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=444

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (78%), Gaps = 4/126 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  319  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  378

Query  435  GRNPAHRQS-RSDFTNQWAGA-YYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--T  268
            GRNPA++Q  RSDF NQW GA YYGG  Y+GY YA P  H+P+MYA AA          T
Sbjct  379  GRNPANKQQFRSDFGNQWGGAXYYGGPVYEGYGYALPPHHDPSMYAAAAAAYGAYPVYGT  438

Query  267  HQQQVS  250
            HQQQVS
Sbjct  439  HQQQVS  444



>ref|XP_009370171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Pyrus x bretschneideri]
Length=441

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 98/126 (78%), Gaps = 4/126 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEAL KL G VIGKQTVRLSW
Sbjct  316  NVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALPKLNGTVIGKQTVRLSW  375

Query  435  GRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--T  268
            GRNPA++Q  RSDF NQW G AYYGG  Y+GY YA P  H+P+MYA A+          T
Sbjct  376  GRNPANKQQFRSDFGNQWGGAAYYGGPVYEGYGYALPPHHDPSMYAAASAAYGAYPVYGT  435

Query  267  HQQQVS  250
            HQQQVS
Sbjct  436  HQQQVS  441



>ref|XP_007136663.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
 gb|ESW08657.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
Length=420

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+ EDLRQPFSQYGEIV  KIPVGKGCGFVQFA R +AEEALQKL G  IGKQ VRLSW
Sbjct  300  NVTAEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAIRNNAEEALQKLNGTTIGKQMVRLSW  359

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF + W+GAYYGG  YDGY YA P PH+P++YA A        G HQQQ
Sbjct  360  GRNPANKQFRGDFGSPWSGAYYGGPVYDGYGYALPPPHDPSIYAAAYGAYPIYGG-HQQQ  418

Query  255  VS  250
            VS
Sbjct  419  VS  420



>gb|KJB63805.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=431

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGE+V  KIPVGKGCGFV+FANR +AEEALQKL    IGKQTVRLSW
Sbjct  308  NVTEEDLRQPFSQYGELVSVKIPVGKGCGFVRFANRNNAEEALQKLNETNIGKQTVRLSW  367

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
            GRNPA++Q R+D++NQW GAYYGG  YDGY YA P P++  MYA AA        YG+HQ
Sbjct  368  GRNPANKQFRADYSNQWGGAYYGGQVYDGYGYALPPPNSLGMYAAAATAYGAYPIYGSHQ  427

Query  261  QQVS  250
            QQVS
Sbjct  428  QQVS  431



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQPFS+YGEIV  KIPVGKGCGFVQF NR DAEEALQ+L G  IGKQTVRLSW
Sbjct  333  SVTDEELRQPFSEYGEIVSVKIPVGKGCGFVQFVNRNDAEEALQQLSGKTIGKQTVRLSW  392

Query  435  GRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQ  259
            G +PA++QSR D+ +QW G AYYGG ++DGY YA P PH+PN    AAYGAYP YGTHQQ
Sbjct  393  GHSPANKQSRVDYAHQWTGAAYYGGPYFDGYGYALPPPHDPN-MYAAAYGAYPFYGTHQQ  451

Query  258  QVS  250
            QVS
Sbjct  452  QVS  454



>ref|XP_010668311.1| PREDICTED: polyadenylate-binding protein RBP47-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQYGEIV  KIPVGKGCGFVQFANR++AEEAL KL G VIGKQTVRLSW
Sbjct  354  SVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRSNAEEALNKLNGTVIGKQTVRLSW  413

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GRNPA++QSR D+ NQW G YYGG  YDG     P PH+P+
Sbjct  414  GRNPANKQSRGDYGNQWNGGYYGGPMYDGGYGYVPHPHDPS  454



>emb|CAC69852.1| nucleic acid binding protein [Nicotiana tabacum]
Length=456

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSDEDLRQPF QYGEIV  KIPV +     QFANR DAEEALQKL G  IGKQTVRL W
Sbjct  333  NVSDEDLRQPFVQYGEIVSVKIPVEERVWVWQFANRNDAEEALQKLNGTFIGKQTVRLFW  392

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG--THQ  262
            GRNPA++QSR DF NQW G YYGGHFYDGY YAFP  H+P MYA AA          THQ
Sbjct  393  GRNPANKQSRGDFGNQWTGPYYGGHFYDGYGYAFPPQHDPGMYAAAAAAYGAYPIYGTHQ  452

Query  261  QQVS  250
            QQVS
Sbjct  453  QQVS  456



>gb|KCW68770.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=399

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQ FSQYGEIV  KIP GKGCGFVQFANR++AEEALQKL G VIGKQTVRLSW
Sbjct  277  SVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFANRSNAEEALQKLNGTVIGKQTVRLSW  336

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTHQQ  259
            GRNPA++Q R+DF NQW   YYGG  YDGY Y  P  ++P+MYA A   A   +YG+HQQ
Sbjct  337  GRNPANKQFRADFGNQWGPVYYGGQVYDGYGYGVPPHYDPSMYATATAYAAYPVYGSHQQ  396

Query  258  QVS  250
            QV+
Sbjct  397  QVN  399



>ref|XP_010500273.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=444

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFS YGEIV  KIPVGKGCGFVQF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  323  SVTDEDLRQPFSDYGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVIGKQTVRLSW  382

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+PA++Q R  + NQW   YYGG +++GY Y  P PH+P MY  A YG YPMYG HQQQ
Sbjct  383  GRSPANKQPRDKYGNQWVVPYYGGQYFNGYGYMAPQPHDPRMYPAAPYGGYPMYGGHQQQ  442

Query  255  VS  250
            VS
Sbjct  443  VS  444



>ref|XP_004501589.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=413

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N + EDLR+PFS+YGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  IGKQTVRLSW
Sbjct  292  NATAEDLREPFSEYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGATIGKQTVRLSW  351

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY-AFPAPHNPNmyapaaygaypmyGTHQQ  259
            GRNPA++Q R DF + W GAYYGG  YDGY Y A P PH+P+MYA A        G HQQ
Sbjct  352  GRNPANKQFRMDFGSPWNGAYYGGPVYDGYGYAALPHPHDPSMYAAAYGAYPIYGG-HQQ  410

Query  258  QVS  250
            QVS
Sbjct  411  QVS  413



>ref|XP_010061775.1| PREDICTED: polyadenylate-binding protein RBP47-like [Eucalyptus 
grandis]
 gb|KCW68768.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=452

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQ FSQYGEIV  KIP GKGCGFVQFANR++AEEALQKL G VIGKQTVRLSW
Sbjct  330  SVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFANRSNAEEALQKLNGTVIGKQTVRLSW  389

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygayp-myGTHQQ  259
            GRNPA++Q R+DF NQW   YYGG  YDGY Y  P  ++P+MYA A   A   +YG+HQQ
Sbjct  390  GRNPANKQFRADFGNQWGPVYYGGQVYDGYGYGVPPHYDPSMYATATAYAAYPVYGSHQQ  449

Query  258  QVS  250
            QV+
Sbjct  450  QVN  452



>ref|XP_010461546.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFS YGEIV  KIPVGKGCGFVQF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  325  SVTDEDLRQPFSDYGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVIGKQTVRLSW  384

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            G +PA++Q R  + NQW   YYGG +++GY Y  P PH+P MY  A YG YPMYG HQQQ
Sbjct  385  GHSPANKQPRDKYGNQWVVPYYGGQYFNGYGYMAPQPHDPRMYPAAPYGGYPMYGGHQQQ  444

Query  255  VS  250
            VS
Sbjct  445  VS  446



>ref|XP_010479152.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFS YGEIV  KIPVGKGCGFVQF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  325  SVTDEDLRQPFSDYGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVIGKQTVRLSW  384

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+PA++Q R  + NQW   YYGG +++GY Y  P P +P MY    YG YPMYG HQQQ
Sbjct  385  GRSPANKQPRDKYGNQWVVPYYGGQYFNGYGYMAPQPLDPRMYPATPYGGYPMYGGHQQQ  444

Query  255  VS  250
            VS
Sbjct  445  VS  446



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQ FSQYGEI   KIPVGKGCGFVQFANR +AEEALQKL G +IGKQTVRLSW
Sbjct  306  NVTDEDLRQAFSQYGEIASVKIPVGKGCGFVQFANRNNAEEALQKLNGTMIGKQTVRLSW  365

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R DF   WAG Y+    YDGY YA P+PH+     P AYG YP YG HQQQ
Sbjct  366  GRNPANKQFRFDF-GSWAGPYFPSPIYDGYGYAMPSPHHDPNMYPLAYGGYPFYGGHQQQ  424

Query  255  VS  250
            VS
Sbjct  425  VS  426



>ref|NP_175181.1| RNA-binding protein 47C' [Arabidopsis thaliana]
 sp|Q9SX80.1|R47CP_ARATH RecName: Full=Polyadenylate-binding protein RBP47C'; Short=Poly(A)-binding 
protein RBP47C'; AltName: Full=RNA-binding protein 
47C'; Short=AtRBP47C prime; Short=AtRBP47C' [Arabidopsis 
thaliana]
 gb|AAD46037.1|AC007519_22 Contains 3 PF|00076 RNA recognition motif domains. EST gb|T20424 
comes from this gene [Arabidopsis thaliana]
 dbj|BAE99410.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABN04767.1| At1g47500 [Arabidopsis thaliana]
 gb|AEE32178.1| RNA-binding protein 47C' [Arabidopsis thaliana]
Length=434

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDL+QPFS++GEIV  KIPVGKGCGFVQF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  316  SVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVIGKQTVRLSW  375

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  325
            GRNPA++Q R  + NQW   YYGG FY+GY Y  P P
Sbjct  376  GRNPANKQPRDKYGNQWVDPYYGGQFYNGYGYMVPQP  412



>ref|XP_006423054.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
 gb|ESR36294.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
Length=445

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDLR+PFSQ+GEI+  KIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLSW
Sbjct  334  DVSDEDLREPFSQFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSW  393

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GRNP ++Q R D +N W GA+YGG  Y G  YAFP   +PN
Sbjct  394  GRNPGNKQWRGDHSNHWNGAHYGGQGYSGNGYAFPPNQDPN  434



>ref|XP_006480131.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Citrus 
sinensis]
 gb|KDO49117.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=449

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDLR+PFSQ+GEI+  KIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLSW
Sbjct  338  DVSDEDLREPFSQFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSW  397

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GRNP ++Q R D +N W GA+YGG  Y G  YAFP   +PN
Sbjct  398  GRNPGNKQWRGDHSNHWNGAHYGGQGYSGNGYAFPPNQDPN  438



>ref|XP_003603009.1| RNA-binding protein [Medicago truncatula]
 gb|AES73260.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=420

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            + + EDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G  +GKQTVRLSW
Sbjct  302  SATAEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTVGKQTVRLSW  361

Query  435  GRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQ  259
            GRNPA++Q RS+F + W G AYYGG  YDGY YA P P++          AYPMYG HQQ
Sbjct  362  GRNPANKQFRSEFGSPWNGPAYYGGPAYDGYGYAMPHPYD----QSMYAAAYPMYGGHQQ  417

Query  258  QVS  250
            QVS
Sbjct  418  QVS  420



>ref|NP_175180.1| RNA-binding protein 47C [Arabidopsis thaliana]
 sp|Q9SX79.1|RB47C_ARATH RecName: Full=Polyadenylate-binding protein RBP47C; Short=Poly(A)-binding 
protein RBP47C; AltName: Full=RNA-binding protein 
47C; Short=AtRBP47C [Arabidopsis thaliana]
 gb|AAD46038.1|AC007519_23 Contains 3 PF|00076 RNA recognition motif domains. ESTs gb|R30092, 
gb|R30093, gb|AA394338, gb|N65719 and gb|AA597577 come 
from this gene [Arabidopsis thaliana]
 gb|AAK06876.1|AF344325_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK59684.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL33806.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE32174.1| RNA-binding protein 47C [Arabidopsis thaliana]
Length=432

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDL+QPF+++GEIV  KIPVGKGCGFVQF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  314  SVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVIGKQTVRLSW  373

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  325
            GRNPA++Q R  + NQW   YYGG FY+GY Y  P P
Sbjct  374  GRNPANKQPRDKYGNQWVDPYYGGQFYNGYGYMVPQP  410



>gb|EPS64859.1| nucleic acid binding protein, partial [Genlisea aurea]
Length=377

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 78/91 (86%), Gaps = 1/91 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQYGEIV  KIP G+GCGFVQFANR DAEEAL+ L GL IG QTVRLSW
Sbjct  286  SVTDEDLRQPFSQYGEIVSIKIPPGRGCGFVQFANRGDAEEALKNLTGLTIGNQTVRLSW  345

Query  435  GRNPAHRQSRSDFTNQWAGA-YYGGHFYDGY  346
            GRNPA++QSRSD+ NQW GA YYGG FYD Y
Sbjct  346  GRNPANKQSRSDYGNQWTGASYYGGGFYDPY  376



>gb|KEH40058.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=425

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+Q FSQYGEI   KIPVGKGCGFVQFANR +AEEALQKL G +IGKQTVRLSW
Sbjct  305  NVTDEDLKQTFSQYGEIASVKIPVGKGCGFVQFANRNNAEEALQKLNGTMIGKQTVRLSW  364

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R D    WAG Y+    YDGY YA P+PH+     P AYG YP+YG H QQ
Sbjct  365  GRNPAYKQFRLD-VGSWAGPYFPSPIYDGYGYAMPSPHHDPSMYPLAYGGYPIYGGHSQQ  423

Query  255  VS  250
            VS
Sbjct  424  VS  425



>gb|AFK35123.1| unknown [Medicago truncatula]
Length=425

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+Q FSQYGEI   KIPVGKGCGFVQFANR +AEEALQKL G +IGKQTVRLSW
Sbjct  305  NVTDEDLKQTFSQYGEIASVKIPVGKGCGFVQFANRNNAEEALQKLNGTMIGKQTVRLSW  364

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R D    WAG Y+    YDGY YA P+PH+     P AYG YP+YG H QQ
Sbjct  365  GRNPAYKQFRLD-VGSWAGPYFPSPIYDGYGYAMPSPHHDPSMYPLAYGGYPIYGGHSQQ  423

Query  255  VS  250
            VS
Sbjct  424  VS  425



>ref|XP_003528246.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Glycine 
max]
Length=410

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRT----DAEEALQKLKGLVIGKQTV  448
            NV+ EDL+QPFSQYGEIV  KIPVGKGCGF    +R+    +AEEALQKL G  IGKQ V
Sbjct  286  NVTAEDLKQPFSQYGEIVSVKIPVGKGCGFTICNSRSPGPKNAEEALQKLNGTTIGKQMV  345

Query  447  RLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGT  268
            RLSWGRNPA++Q R+DF N W+GAYYGG  YDGY YA P  H+P++YA A        G 
Sbjct  346  RLSWGRNPANKQFRADFGNAWSGAYYGGPVYDGYGYALPPSHDPSIYAAAYGAYPIYGG-  404

Query  267  HQQQVS  250
            HQQQVS
Sbjct  405  HQQQVS  410



>ref|XP_009391347.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+++DL Q FSQYGEI   KIPVGK CGFVQF  R +AEEALQ+L G VIG QTVRLSW
Sbjct  285  NVNEDDLNQTFSQYGEIASVKIPVGKQCGFVQFVQRNNAEEALQRLNGTVIGNQTVRLSW  344

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  325
            GRNPA++Q RSD +NQW G YYGG FY+GY YA P P
Sbjct  345  GRNPANKQLRSDSSNQWNGMYYGGPFYNGYMYAAPVP  381



>gb|KDO49116.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=450

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFAN-RTDAEEALQKLKGLVIGKQTVRLS  439
            +VSDEDLR+PFSQ+GEI+  KIPVGKGCGFVQFAN R DAE ALQKL+G  IGKQTVRLS
Sbjct  338  DVSDEDLREPFSQFGEILSVKIPVGKGCGFVQFANSRKDAEVALQKLQGTAIGKQTVRLS  397

Query  438  WGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            WGRNP ++Q R D +N W GA+YGG  Y G  YAFP   +PN
Sbjct  398  WGRNPGNKQWRGDHSNHWNGAHYGGQGYSGNGYAFPPNQDPN  439



>ref|XP_009417617.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DL++ FS YGEI   KIPVGK CGFVQF  R +AEEALQ L G VIGKQTVRLSW
Sbjct  282  NVSEDDLKRTFSLYGEIASVKIPVGKQCGFVQFVQRNNAEEALQGLNGTVIGKQTVRLSW  341

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  325
            GRNPA++Q RSD  NQW G YYGG FY+GY YA P P
Sbjct  342  GRNPANKQLRSDLGNQWNGMYYGGQFYNGYVYAAPVP  378



>ref|XP_006845939.1| hypothetical protein AMTR_s00157p00079360 [Amborella trichopoda]
 gb|ERN07614.1| hypothetical protein AMTR_s00157p00079360 [Amborella trichopoda]
Length=176

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+++DLR+ FS+YG+I   KIPV KGCGFVQFANR++AEEALQ L G VIGK T+RLSW
Sbjct  46   SVTEDDLREAFSKYGDIASVKIPVNKGCGFVQFANRSNAEEALQGLNGTVIGKVTIRLSW  105

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GRNP ++Q R+D  NQW G+YYGG  YDGY YA   P +P
Sbjct  106  GRNPGNKQPRADAANQWNGSYYGGQVYDGYGYA-AQPQDP  144



>gb|KDO35911.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=176

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 88/124 (71%), Gaps = 15/124 (12%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI   KIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+     
Sbjct  66   NVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSF----  121

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypm--yGTHQ  262
                     R+D+ NQW+GAYYGG  YDGY YA P P++P+MYA AA        YG+HQ
Sbjct  122  ---------RADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQ  172

Query  261  QQVS  250
            QQVS
Sbjct  173  QQVS  176



>ref|XP_006442703.1| hypothetical protein CICLE_v10022585mg [Citrus clementina]
 gb|ESR55943.1| hypothetical protein CICLE_v10022585mg [Citrus clementina]
Length=166

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSD+DLR+ FS +GEI+  KIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLSW
Sbjct  57   NVSDKDLRELFSHFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSW  116

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
            G NP ++Q R D  N W GA+YGG  Y G  YA+
Sbjct  117  GHNPGNKQWRGDHINHWNGAHYGGQGYSGNGYAW  150



>ref|XP_008797245.1| PREDICTED: polyadenylate-binding protein RBP47-like [Phoenix 
dactylifera]
Length=393

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIP GK CGFVQF  R +AEEALQ L G VIGKQ VRLSW
Sbjct  275  NVSEDDLRQVFSQYGEIASVKIPSGKQCGFVQFVQRNNAEEALQALNGTVIGKQPVRLSW  334

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  325
            GRNPA++Q R D +N W G YYG  FY+GY YA P P
Sbjct  335  GRNPANKQLRGDPSNLWNGVYYGAQFYNGYGYAAPVP  371



>ref|XP_008813036.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=398

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +A+EALQ L G VIGKQ VRLSW
Sbjct  280  NVSEDDLRQAFSQYGEIASVKIPVGKQCGFVQFVQRNNAQEALQALNGTVIGKQQVRLSW  339

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  325
            GRNPA++Q R D  NQW   YYG  FY+GY YA P P
Sbjct  340  GRNPANKQLRGDHGNQWNNFYYGAPFYNGYGYAAPFP  376



>gb|ABR25993.1| nucleic acid binding protein [Oryza sativa Indica Group]
Length=128

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  10   NVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  69

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR+D  ++    YYG  FY GY YA P PH PN
Sbjct  70   GRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPVPH-PN  109



>gb|KFK36144.1| hypothetical protein AALP_AA4G083000 [Arabis alpina]
Length=426

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            VSDEDLRQPF+ YGEIV  KIPVGKGCGFVQF +R DAEEAL+KL G VIGKQTVRLSWG
Sbjct  306  VSDEDLRQPFANYGEIVSVKIPVGKGCGFVQFVSRPDAEEALEKLNGTVIGKQTVRLSWG  365

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQV  253
            RNP ++Q R  + NQWAG YYGG +Y+GY Y  P PH+P MYA A YG Y MYG HQQQV
Sbjct  366  RNPGNKQPRDKYGNQWAGPYYGGQYYNGYGYMVPQPHDPRMYAAAPYGGYQMYGGHQQQV  425

Query  252  S  250
            S
Sbjct  426  S  426



>gb|ABR25764.1| nucleic acid binding protein [Oryza sativa Indica Group]
Length=151

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  33   NVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  92

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR+D  ++    YYG  FY GY YA P PH PN
Sbjct  93   GRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPVPH-PN  132



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+EDL+Q FSQYGE+   KIPVGK CGFVQF +R +AEEALQ+L G  IGKQ VRLSW
Sbjct  630  NVSEEDLKQAFSQYGELASVKIPVGKQCGFVQFVHRNNAEEALQQLNGTAIGKQVVRLSW  689

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GRNP ++Q R+D  + W GAYYGG  Y+GY Y  PA H+P
Sbjct  690  GRNPTNKQLRTDPGSHWNGAYYGGQVYNGYGYVLPA-HDP  728



>ref|XP_008444645.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=429

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+Q FSQ+GEIV  KIPVGKGCGF+QFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  308  NVTDEDLKQLFSQHGEIVSVKIPVGKGCGFIQFANRKNAEEALQKLNGTVIGKQTVRLSW  367

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+P ++Q R+D+ N W+GAYYGG  Y GY YA P P++P     AAYGAYPMYGTHQQQ
Sbjct  368  GRSPTNKQYRADYGNHWSGAYYGGQMYGGYGYALPLPYDPPTMYAAAYGAYPMYGTHQQQ  427

Query  255  VS  250
            V+
Sbjct  428  VN  429



>ref|XP_010907889.1| PREDICTED: polyadenylate-binding protein RBP47 [Elaeis guineensis]
Length=402

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FS +G+I   KIPVGK CGFVQF  R +AEEALQ L G VIGKQ VRLSW
Sbjct  284  NVSEDDLRQAFSPFGDIASVKIPVGKQCGFVQFVQRNNAEEALQALNGAVIGKQQVRLSW  343

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAP  325
            GRNPA++Q R D  NQW G YYG  FY+GY YA P P
Sbjct  344  GRNPANKQLRGDHGNQWNGFYYGAPFYNGYGYAAPFP  380



>ref|XP_008782322.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Phoenix 
dactylifera]
Length=168

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DL+Q FSQYGE+   KIPVGK CGFVQF +R +AEEALQ+L G VIGKQ VRLSW
Sbjct  50   NVSEDDLKQAFSQYGEVASVKIPVGKQCGFVQFVHRNNAEEALQQLNGTVIGKQLVRLSW  109

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GRNP ++Q R+     W G Y+GG  ++GY Y  PA H+P+
Sbjct  110  GRNPTNKQLRARPGGHWNGVYHGGQVHNGYGYVLPA-HDPS  149



>ref|XP_004152729.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160013.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 gb|KGN62542.1| hypothetical protein Csa_2G360590 [Cucumis sativus]
Length=429

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDL+Q FSQ+GEIV  KIPVGKGCGF+QFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  308  NVTDEDLKQLFSQHGEIVSVKIPVGKGCGFIQFANRKNAEEALQKLNGTVIGKQTVRLSW  367

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+P ++Q R D+ N W+GAYYGG  Y GY YA P P++P     AAYGAYPMYGTHQQQ
Sbjct  368  GRSPTNKQYRGDYGNHWSGAYYGGQVYGGYGYALPLPYDPPTMYAAAYGAYPMYGTHQQQ  427

Query  255  VS  250
            V+
Sbjct  428  VN  429



>ref|XP_006423626.1| hypothetical protein CICLE_v10030115mg, partial [Citrus clementina]
 gb|ESR36866.1| hypothetical protein CICLE_v10030115mg, partial [Citrus clementina]
Length=191

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSD+DLR+ FS +GEI+  KIPVGKGCGFVQFANR DAE    KL+G  IGKQTVRLSW
Sbjct  84   NVSDKDLRELFSHFGEILSVKIPVGKGCGFVQFANRKDAE----KLQGTAIGKQTVRLSW  139

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            G NP ++Q R D  N W  A+YGG  Y G  YAFP   +PN
Sbjct  140  GHNPRNKQWRGDHINHWNRAHYGGQGYSGNGYAFPPNQDPN  180



>ref|XP_006446580.1| hypothetical protein CICLE_v10017127mg [Citrus clementina]
 gb|ESR59820.1| hypothetical protein CICLE_v10017127mg [Citrus clementina]
Length=137

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  603  EDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNP  424
             DLR+ FS +GEI+  KI VGKGCGFVQFANR D E ALQKL+G  IGKQTVRLSWG NP
Sbjct  36   RDLREFFSHFGEILSVKIHVGKGCGFVQFANRKDVEVALQKLQGTAIGKQTVRLSWGHNP  95

Query  423  AHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
             ++Q R D  N W GA+YGG  Y G  YAFP   +PN
Sbjct  96   GNKQWRGDHINHWNGAHYGGLGYSGNGYAFPPNRDPN  132



>gb|KDO38218.1| hypothetical protein CISIN_1g038175mg, partial [Citrus sinensis]
Length=155

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSD+DLR+ FS +GEI+  KIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLSW
Sbjct  73   NVSDKDLRELFSHFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSW  132

Query  435  GRNPAHRQSRSDFTNQWAGAYYG  367
            G NP ++Q R D  N W GA+YG
Sbjct  133  GHNPGNKQWRGDHINHWNGAHYG  155



>ref|XP_010525621.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Tarenaya 
hassleriana]
Length=434

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPF+ YG+IV  KIP GKGCGFVQF NRT AEEAL KL G+VIGKQTVRLSW
Sbjct  313  NVTDEDLRQPFADYGDIVSVKIPTGKGCGFVQFVNRTSAEEALDKLNGVVIGKQTVRLSW  372

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GR+PA++Q R +F NQW G YYGG +Y+GY Y  P PH+P MY  A YGAYPMYG  QQQ
Sbjct  373  GRSPANKQVRGEFGNQWVGPYYGGQYYNGYGYMIPPPHDPIMYTAAPYGAYPMYGGDQQQ  432

Query  255  VS  250
            VS
Sbjct  433  VS  434



>ref|XP_006653468.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=409

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  291  NVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  350

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR+D  N+    YYG  FY GY YA P PH PN
Sbjct  351  GRSPSHKQSRADSGNRRNNMYYGTPFYGGYGYASPVPH-PN  390



>ref|XP_006487135.1| PREDICTED: uncharacterized protein LOC102626638 [Citrus sinensis]
Length=508

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVSD++LR+PFS  GEI+  KI +GK CGFVQFANR DAE ALQKL+G  IGKQTVRLSW
Sbjct  397  NVSDKNLREPFSHLGEILSVKIHIGKRCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSW  456

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            G NP ++Q R D  N W G +Y G  Y G  YAFP   +PN
Sbjct  457  GHNPGNKQWRGDHINHWNGEHYRGQGYSGNGYAFPPNQDPN  497



>ref|XP_002446570.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
 gb|EES10898.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
Length=423

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQFA+RTDAEEALQ L G +IGKQ VRLSW
Sbjct  305  NVSEDELRKAFAKYGDLASVKIPLGKQCGFVQFASRTDAEEALQGLNGSLIGKQAVRLSW  364

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR D  N+    YYG  FY GY YA P PH PN
Sbjct  365  GRSPSHKQSRGDSGNRRNNMYYGTPFYGGYGYASPVPH-PN  404



>dbj|BAJ85933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=152

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQ+ NRTDAEEALQ L G VIGKQ VRLSW
Sbjct  32   NVSEDELRKSFAKYGDVASVKIPLGKQCGFVQYVNRTDAEEALQGLNGAVIGKQAVRLSW  91

Query  435  GRNPAHRQSRSD--FTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR D          YYG  FY GY YA P PH PN
Sbjct  92   GRSPSHKQSRGDSGNRRNNNNMYYGTPFYGGYGYASPVPH-PN  133



>ref|XP_011088289.1| PREDICTED: polyadenylate-binding protein RBP47 [Sesamum indicum]
Length=423

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ FS +G++V  KIP GKGCGFVQFANR++AE+A+Q+L G VIGKQTVRLSW
Sbjct  311  DVTDEELRQSFSPFGDVVSVKIPAGKGCGFVQFANRSNAEDAIQRLNGTVIGKQTVRLSW  370

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPH  322
            GRN  ++QSR D  +QW GAYYG   Y+GY Y   A +
Sbjct  371  GRNMGNKQSRVDPNSQWNGAYYGRQGYNGYGYGAVAAY  408



>ref|XP_010539063.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010539064.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X2 [Tarenaya hassleriana]
Length=426

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF++YG+I+  KIP GKGCGFVQF NRT AEEAL+KL G VIG+QTVRLSW
Sbjct  304  SVTDEDLRQPFAEYGDIISVKIPSGKGCGFVQFVNRTSAEEALEKLNGSVIGQQTVRLSW  363

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GRNPA++Q R +F NQW G YYGG +Y+GY Y  P PH+P
Sbjct  364  GRNPANKQHRGEFRNQWVGPYYGGEYYNGYGYMIPPPHDP  403



>ref|XP_006307520.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
 gb|EOA40418.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
Length=443

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF++YGEIV  KIPVGKGCGFVQF +R  AE+AL+KL G VIGKQTVRLSW
Sbjct  322  SVTDEDLRQPFAEYGEIVSVKIPVGKGCGFVQFVSRPSAEDALEKLNGTVIGKQTVRLSW  381

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R  + NQW   YYGG +Y+GY Y  P PH+P MY  A YG YPMYG HQQQ
Sbjct  382  GRNPANKQPRDKYGNQWVVPYYGGQYYNGYGYMAPQPHDPRMYPAAPYGGYPMYGGHQQQ  441

Query  255  VS  250
            VS
Sbjct  442  VS  443



>gb|EEE61093.1| hypothetical protein OsJ_14988 [Oryza sativa Japonica Group]
Length=373

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  255  NVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  314

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR+D  ++    YYG  FY GY YA P PH PN
Sbjct  315  GRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPVPH-PN  354



>ref|XP_010540323.1| PREDICTED: polyadenylate-binding protein RBP47B [Tarenaya hassleriana]
Length=410

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 6/101 (6%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLRQPFSQ+GE+V  KIP+GKGCGF+Q +NR +AEEA+QKL G VIGK TVRLSWG
Sbjct  304  VTDEDLRQPFSQFGEVVSVKIPLGKGCGFIQLSNRKNAEEAIQKLNGTVIGKNTVRLSWG  363

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFY---DGYT---YAFPA  328
            RNP ++Q RSD ++QW G Y  G  +   +GYT   YA PA
Sbjct  364  RNPGNKQWRSDTSHQWNGGYARGQGFNNGNGYTNQDYASPA  404



>ref|NP_001052934.2| Os04g0449900 [Oryza sativa Japonica Group]
 dbj|BAF14848.2| Os04g0449900 [Oryza sativa Japonica Group]
Length=387

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  269  NVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  328

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR+D  ++    YYG  FY GY YA P PH PN
Sbjct  329  GRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPVPH-PN  368



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DL+Q FSQYGE+   KIPVGK CGFVQF +R +AEEALQ+L G VIGKQ VRLSW
Sbjct  291  NVSEDDLKQAFSQYGEVASVKIPVGKQCGFVQFVHRNNAEEALQQLNGTVIGKQLVRLSW  350

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GRNP ++Q R+   + W G Y+GG  ++GY Y  PA H+P+
Sbjct  351  GRNPTNKQLRARPGSHWNGVYHGGQVHNGYGYVLPA-HDPS  390



>gb|EAY94326.1| hypothetical protein OsI_16094 [Oryza sativa Indica Group]
Length=426

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  308  NVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  367

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR+D  ++    YYG  FY GY YA P PH PN
Sbjct  368  GRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPVPH-PN  407



>emb|CAH67097.1| H0818E04.14 [Oryza sativa Indica Group]
Length=426

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  308  NVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  367

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR+D  ++    YYG  FY GY YA P PH PN
Sbjct  368  GRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASPVPH-PN  407



>gb|EEE69858.1| hypothetical protein OsJ_29658 [Oryza sativa Japonica Group]
Length=310

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  189  NVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSW  248

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYAFPAPHNP  316
            GRNPA++Q RSD  +QW  G YY    FY GY Y  P P +P
Sbjct  249  GRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADP  290



>ref|XP_009628458.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+D++LRQ F+Q+G +V  KIP GKGCGFVQF++R+ AE+A+QKL G VIGKQTVRLSW
Sbjct  294  DVTDDELRQSFNQFGNVVSVKIPAGKGCGFVQFSDRSAAEDAIQKLNGAVIGKQTVRLSW  353

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GRNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  354  GRNPANKQLRTDSGSQWNGGYYGRQNYGGYGY  385



>dbj|BAD33940.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
 dbj|BAD38554.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=316

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  195  NVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSW  254

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYAFPAPHNP  316
            GRNPA++Q RSD  +QW  G YY    FY GY Y  P P +P
Sbjct  255  GRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADP  296



>ref|XP_010442131.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=432

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+ +G+IV  KIP+G+GCGF+QF NR +AEEAL+KL G +IGKQTVRLSW
Sbjct  309  SVTDEDLRQPFTAFGDIVSVKIPIGRGCGFIQFVNRENAEEALEKLNGSLIGKQTVRLSW  368

Query  435  GRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAPH  322
            G N  ++Q R ++   W    YYGG FY+GY Y  P PH
Sbjct  369  GHNTGNKQPRGEYAEHWVDHPYYGGQFYNGYGYMVP-PH  406



>ref|XP_009114049.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Brassica 
rapa]
Length=419

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE LRQPF+ +GEIV  KIPVGKGCGF+QF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  294  DVTDEVLRQPFAGFGEIVSVKIPVGKGCGFIQFVNRENAEEALEKLNGSVIGKQTVRLSW  353

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA-FPAPHNP  316
            GRN  ++Q R  + +QW   +Y G +Y+GY Y   P P +P
Sbjct  354  GRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGYMPLPPPIDP  394



>emb|CDY52067.1| BnaA09g53390D [Brassica napus]
Length=419

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE LRQPF+ +GEIV  KIPVGKGCGF+QF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  294  DVTDEVLRQPFAGFGEIVSVKIPVGKGCGFIQFVNRENAEEALEKLNGSVIGKQTVRLSW  353

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA-FPAPHNP  316
            GRN  ++Q R  + +QW   +Y G +Y+GY Y   P P +P
Sbjct  354  GRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGYMPLPPPIDP  394



>ref|XP_006349627.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Solanum 
tuberosum]
Length=428

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ FSQ+G +V  KIP GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSW
Sbjct  306  DVTDEELRQSFSQFGNVVSVKIPAGKGCGFVQFSERSAAEDAIEKLNGTVIGTQTVRLSW  365

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GRNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  366  GRNPANKQFRTDSGSQWNGGYYGRQNYGGYGY  397



>ref|XP_006349628.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Solanum 
tuberosum]
Length=424

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ FSQ+G +V  KIP GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSW
Sbjct  302  DVTDEELRQSFSQFGNVVSVKIPAGKGCGFVQFSERSAAEDAIEKLNGTVIGTQTVRLSW  361

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GRNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  362  GRNPANKQFRTDSGSQWNGGYYGRQNYGGYGY  393



>gb|KDO35913.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=152

 Score =   124 bits (310),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI   KIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSW
Sbjct  66   NVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSW  125

Query  435  GRNPAHRQ-SRSDFTN  391
            GRNPA++Q S S FT+
Sbjct  126  GRNPANKQASLSPFTS  141



>emb|CDX95176.1| BnaC09g16940D [Brassica napus]
Length=419

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE LRQPF+ +GEIV  KIP+GKGCGF+QF NR +AEEAL+KL G VIGKQTVRLSW
Sbjct  294  DVTDEVLRQPFAGFGEIVSVKIPIGKGCGFIQFVNRENAEEALEKLNGSVIGKQTVRLSW  353

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA-FPAPHNP  316
            GRN  ++Q R  + +QW   +Y G +Y+GY Y   P P +P
Sbjct  354  GRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGYMPLPPPIDP  394



>ref|XP_009783555.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nicotiana sylvestris]
Length=437

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+D++LRQ F+Q G +V  KIP GKGCGFVQF++R++AE+A+QKL G VIGKQTVRLSW
Sbjct  314  DVTDDELRQSFNQCGNVVSVKIPAGKGCGFVQFSDRSEAEDAIQKLNGAVIGKQTVRLSW  373

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GRNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  374  GRNPANKQLRTDSGSQWNGGYYGRQNYGGYGY  405



>gb|EMT27298.1| Putative RNA-binding protein [Aegilops tauschii]
Length=302

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N+S+++LR+ F +YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  184  NISEDELRKAFVKYGDVASVKIPVGKQCGFVQFVNRADAEEALQGLSGSTIGKQAVRLSW  243

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++  G YYG  FY GY Y  P PH PN
Sbjct  244  GRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYGSPVPH-PN  283



>ref|XP_003579863.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=428

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP GK CGFVQ+ NRTDAEEALQ L G VIGKQ VRLSW
Sbjct  308  NVSEDELRKSFAKYGDVASVKIPQGKQCGFVQYVNRTDAEEALQGLNGSVIGKQAVRLSW  367

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+Q R D  N+    YYG  FY GY YA P PH PN
Sbjct  368  GRSPSHKQPRGDSGNRRNNMYYGTPFYGGYGYASPVPH-PN  407



>ref|XP_010481964.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=434

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+ +G+IV  KIP+G+GCGF+QF NR +AEEAL+KL G +IGKQTVRLSW
Sbjct  311  SVTDEDLRQPFAAFGDIVSVKIPIGRGCGFIQFVNRENAEEALEKLNGSLIGKQTVRLSW  370

Query  435  GRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAPH  322
            G N   +Q R ++   W    YYGG FY+GY Y  P PH
Sbjct  371  GHNTGKKQPRGEYAEHWVDHPYYGGQFYNGYGYMVP-PH  408



>ref|XP_010494212.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=428

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+ +GEIV  KIP+G+GCGF+QF NR +AEEAL KL G +IGKQTVRLSW
Sbjct  305  SVTDEDLRQPFAAFGEIVSVKIPIGRGCGFIQFVNRENAEEALGKLNGSLIGKQTVRLSW  364

Query  435  GRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAPH  322
            G N  ++Q R ++   W    YYGG FY+GY Y  P PH
Sbjct  365  GHNTGNKQPRGEYAEHWVDHPYYGGQFYNGYGYMVP-PH  402



>emb|CBI32444.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLRQ FSQ+GE+V  KIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWG
Sbjct  232  VTDEDLRQSFSQFGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWG  291

Query  432  RNPAHRQSRSDFTNQW  385
            RNPA +Q R+D  NQW
Sbjct  292  RNPASKQWRNDSNNQW  307



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  224  NVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSW  283

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYAFPAPHNP  316
            GRNPA++Q RSD  +QW  G YY    FY GY Y  P P +P
Sbjct  284  GRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADP  325



>ref|NP_001047180.1| Os02g0567900 [Oryza sativa Japonica Group]
 dbj|BAF09094.1| Os02g0567900, partial [Oryza sativa Japonica Group]
Length=259

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N ++++LR+ F++YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  141  NATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEALQGLNGSTIGKQAVRLSW  200

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  201  GRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  240



>ref|NP_001275430.1| DNA-binding protein-like [Solanum tuberosum]
 gb|ABB86246.1| DNA-binding protein-like [Solanum tuberosum]
Length=423

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ FSQ+G +V  KIP GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSW
Sbjct  301  DVTDEELRQSFSQFGNVVSVKIPAGKGCGFVQFSERSAAEDAIEKLNGTVIGTQTVRLSW  360

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GRNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  361  GRNPANKQFRTDSGSQWNGGYYGRQNYGGYGY  392



>gb|KCW63816.1| hypothetical protein EUGRSUZ_G01492 [Eucalyptus grandis]
Length=432

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDLRQ FSQ+GE+V  KIP GKGCGFV FA+R +AEEA+Q L G  IGKQ+VRLSW
Sbjct  324  DVSDEDLRQTFSQFGEVVSVKIPAGKGCGFVHFADRKNAEEAMQDLNGTTIGKQSVRLSW  383

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
            GR+PA++Q R++ +NQW G+Y+GG + +GY
Sbjct  384  GRSPANKQWRTERSNQWNGSYHGG-YANGY  412



>ref|XP_006660711.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=344

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  222  NVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFIQRKNAEDALQGLNGSTIGKQTVRLSW  281

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYAFPAPHNP  316
            GRNPA++Q RSD  +QW  G YY    FY GY Y  P P +P
Sbjct  282  GRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADP  323



>ref|XP_010066047.1| PREDICTED: polyadenylate-binding protein RBP47 [Eucalyptus grandis]
Length=445

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDLRQ FSQ+GE+V  KIP GKGCGFV FA+R +AEEA+Q L G  IGKQ+VRLSW
Sbjct  337  DVSDEDLRQTFSQFGEVVSVKIPAGKGCGFVHFADRKNAEEAMQDLNGTTIGKQSVRLSW  396

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
            GR+PA++Q R++ +NQW G+Y+GG + +GY
Sbjct  397  GRSPANKQWRTERSNQWNGSYHGG-YANGY  425



>ref|XP_009390905.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+++DL++ FS+YGE+   KIPVGK CGFV F +R +AEEA+Q+L G +IGKQTVRLSW
Sbjct  286  DVNEDDLKEAFSRYGEVASVKIPVGKQCGFVLFVHRNNAEEAMQQLNGTIIGKQTVRLSW  345

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GRNPA +QSR++   +W GAYYGG  YDGY+     PH P
Sbjct  346  GRNPAKKQSRAERGKRWNGAYYGGQVYDGYSL---PPHYP  382



>ref|XP_010327389.1| PREDICTED: DNA-binding protein isoform X1 [Solanum lycopersicum]
Length=424

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DE+LRQ FSQ+G +V  KIP GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWG
Sbjct  303  VTDEELRQSFSQFGNVVSVKIPAGKGCGFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWG  362

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            RNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  363  RNPANKQFRTDSGSQWNGGYYGRQNYGGYGY  393



>ref|XP_010327390.1| PREDICTED: DNA-binding protein isoform X2 [Solanum lycopersicum]
Length=423

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DE+LRQ FSQ+G +V  KIP GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWG
Sbjct  302  VTDEELRQSFSQFGNVVSVKIPAGKGCGFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWG  361

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            RNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  362  RNPANKQFRTDSGSQWNGGYYGRQNYGGYGY  392



>ref|NP_001234487.1| DNA-binding protein [Solanum lycopersicum]
 gb|AAR91698.1| DNA-binding protein [Solanum lycopersicum]
Length=428

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DE+LRQ FSQ+G +V  KIP GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWG
Sbjct  307  VTDEELRQSFSQFGNVVSVKIPAGKGCGFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWG  366

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            RNPA++Q R+D  +QW G YYG   Y GY Y
Sbjct  367  RNPANKQFRTDSGSQWNGGYYGRQNYGGYGY  397



>ref|XP_010647773.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Vitis vinifera]
Length=414

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLRQ FSQ+GE+V  KIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWG
Sbjct  304  VTDEDLRQSFSQFGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWG  363

Query  432  RNPAHRQSRSDFTNQW  385
            RNPA +Q R+D  NQW
Sbjct  364  RNPASKQWRNDSNNQW  379



>ref|XP_002285031.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Vitis vinifera]
Length=416

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLRQ FSQ+GE+V  KIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWG
Sbjct  306  VTDEDLRQSFSQFGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWG  365

Query  432  RNPAHRQSRSDFTNQW  385
            RNPA +Q R+D  NQW
Sbjct  366  RNPASKQWRNDSNNQW  381



>gb|EMS68577.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=314

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQ+ NRTDAEEALQ L G VIGKQ VRLSW
Sbjct  194  NVSEDELRKSFAKYGDVASVKIPLGKQCGFVQYVNRTDAEEALQGLNGAVIGKQAVRLSW  253

Query  435  GRNPAHRQSRSD--FTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR D          YYG  FY GY YA P PH PN
Sbjct  254  GRSPSHKQSRGDSGNRRNNNNMYYGTPFYGGYGYASPVPH-PN  295



>ref|XP_009404023.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            VS++DL++ FSQYGEI   KIPVGK CGFV FA+R +AEEALQ+L G +IGKQTVRLSWG
Sbjct  289  VSEDDLKEAFSQYGEITSVKIPVGKQCGFVLFAHRNNAEEALQQLNGTIIGKQTVRLSWG  348

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            RNPA RQSR++ + +W G Y+GG  YDG  Y  P PH P
Sbjct  349  RNPA-RQSRAERSKRWNGVYFGGQAYDG--YGLP-PHYP  383



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  312  NVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  371

Query  435  GRNPAHRQS  409
            GRNPA++QS
Sbjct  372  GRNPANKQS  380



>ref|XP_004975779.1| PREDICTED: polyadenylate-binding protein RBP47-like [Setaria 
italica]
Length=420

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQF +RTDAEEALQ L G VIGKQ VRLSW
Sbjct  302  NVSEDELRKAFAKYGDLASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSVIGKQAVRLSW  361

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR D  N+    YYG  FY GY YA P PH PN
Sbjct  362  GRSPSHKQSRGDSGNR-RNMYYGTPFYGGYGYASPVPH-PN  400



>gb|KDO35916.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=161

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DEDLRQPFSQYGEI   KIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+VRLSW
Sbjct  75   NVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSW  134

Query  435  GRNPAHRQ-SRSDFTN  391
            GRNPA++Q S S FT+
Sbjct  135  GRNPANKQASLSPFTS  150



>gb|EEC73442.1| hypothetical protein OsI_07730 [Oryza sativa Indica Group]
Length=312

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N ++++LR+ F++YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  194  NATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEALQGLNGSTIGKQAVRLSW  253

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  254  GRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  293



>gb|KDP23018.1| hypothetical protein JCGZ_01681 [Jatropha curcas]
Length=429

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            ++SDEDLRQPFSQ+GE+V  KIPVGKGCGFVQFANR +AE+ALQ L G  IGKQTVRLSW
Sbjct  318  DISDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFANRKNAEDALQSLNGTTIGKQTVRLSW  377

Query  435  GRNPAHRQSRSDFTNQWAGA  376
            GR+PA++Q R D  +QW GA
Sbjct  378  GRSPANKQWRGDHHSQWNGA  397



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  320  NVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSW  379

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYAFPAPHNP  316
            GRNPA++Q RSD  +QW  G YY    FY GY Y  P P +P
Sbjct  380  GRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADP  421



>ref|XP_003575198.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Brachypodium 
distachyon]
Length=421

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  303  NVSEDELRKTFAKYGDVASVKIPVGKQCGFVQFVNRADAEEALQALSGSTIGKQAVRLSW  362

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +Q R D  ++  G YYG  FY GY YA P PH PN
Sbjct  363  GRSPASKQPRGDSGHRRNGMYYGTPFYGGYGYASPVPH-PN  402



>gb|EEC84714.1| hypothetical protein OsI_31675 [Oryza sativa Indica Group]
Length=377

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  256  NVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSW  315

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYAFPAPHNP  316
            GRNPA++Q RSD  +QW  G +Y    FY GY Y  P P +P
Sbjct  316  GRNPANKQLRSDNGSQWNNGMFYAASPFYSGYGYPAPFPADP  357



>ref|XP_009590296.1| PREDICTED: polyadenylate-binding protein RBP47 [Nicotiana tomentosiformis]
Length=430

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSW
Sbjct  307  DVTDEELRQSFNQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSW  366

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GR+PA++Q R+D  +QW G Y G   Y GY Y
Sbjct  367  GRSPANKQMRADSGSQWNGGYNGRQNYGGYGY  398



>emb|CAN74486.1| hypothetical protein VITISV_029928 [Vitis vinifera]
Length=434

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLRQ FSQ+GE+V  KIPVGKGCGFVQFANR  AE+ALQ+L G VIGKQTVRLSWG
Sbjct  324  VTDEDLRQSFSQFGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWG  383

Query  432  RNPAHRQSRSDFTNQW  385
            RNPA +Q R+D  NQW
Sbjct  384  RNPASKQWRNDSNNQW  399



>ref|XP_009794615.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWG
Sbjct  280  VTDEELRQSFNQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWG  339

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            R+PA++Q R+D  +QW G Y G   Y GY Y
Sbjct  340  RSPANKQMRTDSGSQWNGGYNGRQNYGGYGY  370



>gb|ACF83065.1| unknown [Zea mays]
 tpg|DAA61809.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=320

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+EDLRQ FSQYGEI   KIP+GK CGFVQFA R +AE+ALQ L G  IGKQ VRLSW
Sbjct  196  NVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQGLNGSTIGKQNVRLSW  255

Query  435  GRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYTYAFPAP  325
            GRNPA++Q R D  NQW   G YY    FY+GY Y   AP
Sbjct  256  GRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAP  295



>ref|XP_009794616.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nicotiana 
sylvestris]
Length=431

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWG
Sbjct  309  VTDEELRQSFNQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWG  368

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            R+PA++Q R+D  +QW G Y G   Y GY Y
Sbjct  369  RSPANKQMRTDSGSQWNGGYNGRQNYGGYGY  399



>gb|AAB92518.1| putative RNA binding protein [Nicotiana tabacum]
Length=482

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSW
Sbjct  359  DVTDEELRQSFNQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSW  418

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GR+PA++Q R+D  +QW G Y G   Y GY Y
Sbjct  419  GRSPANKQMRADSGSQWNGGYNGRQNYGGYGY  450



>sp|Q9LEB3.1|RBP47_NICPL RecName: Full=Polyadenylate-binding protein RBP47; Short=Poly(A)-binding 
protein RBP47; AltName: Full=RNA-binding protein 
47; Short=NplRBP47 [Nicotiana plumbaginifolia]
 emb|CAC01238.1| RNA Binding Protein 47 [Nicotiana plumbaginifolia]
Length=428

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSWG
Sbjct  306  VTDEELRQSFNQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSWG  365

Query  432  RNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            R+PA++Q R+D  +QW G Y G   Y GY Y
Sbjct  366  RSPANKQMRTDSGSQWNGGYNGRQNYGGYGY  396



>ref|XP_010523211.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Tarenaya 
hassleriana]
Length=449

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+G++V  KIP+GKGCGFVQFA+R  AEEA+Q L G VIGK TVRLSW
Sbjct  339  DVTDEDLRQPFSQFGDVVSVKIPIGKGCGFVQFADRKSAEEAIQTLNGTVIGKNTVRLSW  398

Query  435  GRNPAHRQSRSDFTNQWAGAYY-GGHFYDGYTYAF  334
            GR+P ++Q RSD ++QW G Y  GG  Y+  + A+
Sbjct  399  GRSPGNKQWRSDSSHQWNGGYTRGGQGYNNNSNAY  433



>emb|CDY06734.1| BnaA10g05130D [Brassica napus]
Length=305

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 3/122 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+ EDL+QPFS YGEIV   IP+GK CGFVQF NR +AEEAL+KL G VI  + VRL+W
Sbjct  184  SVTSEDLKQPFSAYGEIVSVNIPLGKECGFVQFVNRQNAEEALKKLNGTVIRNRRVRLAW  243

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            G+N   +  R ++ NQW GAY+GG  Y+GY Y  P PH+P +YA A YG YP+Y   QQQ
Sbjct  244  GQN---KLPRYNYGNQWFGAYFGGQHYNGYGYMVPQPHDPRVYAVAPYGGYPVYSDPQQQ  300

Query  255  VS  250
            VS
Sbjct  301  VS  302



>ref|XP_009380242.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VS++DL++ FSQYGEI   KIP GK CGFV F +R +AEEA+ +L G VIGKQTVRLSW
Sbjct  288  DVSEDDLKEAFSQYGEIASVKIPFGKQCGFVLFIHRNNAEEAMNQLNGTVIGKQTVRLSW  347

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GRNPA++QSR++   +W G YYGG  YDG  Y  P PH P
Sbjct  348  GRNPANKQSRAERGKRWNGMYYGGQMYDG--YGLP-PHYP  384



>ref|XP_007017330.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
 gb|EOY14555.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
Length=394

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  312  NVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  371

Query  435  GRNPAHRQ  412
            GRNPA++Q
Sbjct  372  GRNPANKQ  379



>ref|XP_004957051.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Setaria 
italica]
Length=437

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+EDLRQ FSQYGEI   KIPVGK CGFVQFA R +AE+ALQ L G  IGKQTVRLSW
Sbjct  315  NVSEEDLRQTFSQYGEISSVKIPVGKQCGFVQFAQRKNAEDALQGLNGSTIGKQTVRLSW  374

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTY---AFPAP  325
            GRNPA++Q R D  NQW  G YY    FY+GY Y    FP P
Sbjct  375  GRNPANKQFRGDNGNQWNNGMYYAASPFYNGYGYPAAPFPDP  416



>gb|EMS62393.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=384

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DL+Q FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  263  NVSEDDLKQTFSQYGEISSVKIPVGKQCGFVQFLQRKNAEDALQGLNGSTIGKQTVRLSW  322

Query  435  GRNPAHRQSRSDFTNQW-AGAYYG-GHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQ  262
            GRNPA++Q RSD  NQW  G YY    FY+GY Y  PA   P+    AA         +Q
Sbjct  323  GRNPANKQLRSDNGNQWNNGMYYAPSPFYNGYGY--PAAPFPDPGMYAAAYGAYPVYGNQ  380

Query  261  QQVS  250
            QQVS
Sbjct  381  QQVS  384



>ref|XP_004952707.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Setaria 
italica]
Length=428

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+E+LR+ F++YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  308  NVSEEELRKAFAKYGDLASVKIPVGKQCGFVQFVNRADAEEALQGLNGSTIGKQAVRLSW  367

Query  435  GRNPAHRQSRSDFTNQ--WAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++    G YYG  FY GY YA P PH PN
Sbjct  368  GRSPASKQSRGDSGHRRNGNGMYYGTPFYGGYGYASPVPH-PN  409



>gb|EEE57226.1| hypothetical protein OsJ_07197 [Oryza sativa Japonica Group]
Length=459

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N ++++LR+ F++YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  341  NATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEALQGLNGSTIGKQAVRLSW  400

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  401  GRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  440



>dbj|BAD17764.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=396

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N ++++LR+ F++YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  278  NATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEALQGLNGSTIGKQAVRLSW  337

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++  G YYG  FY GY YA P PH PN
Sbjct  338  GRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-PN  377



>ref|XP_011004995.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=434

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGKGC FVQFANR +AE+ALQ L G  IGKQTVRLSW
Sbjct  323  DVTDEDLRQPFSQFGEVVSVKIPVGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSW  382

Query  435  GRNPAHRQSRSDFTNQW  385
            GR PA++Q R D  NQW
Sbjct  383  GRTPANKQGRGDHGNQW  399



>ref|XP_003578248.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=431

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DLRQ FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  309  NVSEDDLRQSFSQYGEISSVKIPVGKQCGFVQFLQRKNAEDALQGLNGSTIGKQTVRLSW  368

Query  435  GRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTY---AFPAP  325
            GRNPA++Q RSD  NQW  G YY    FY+GY Y    FP P
Sbjct  369  GRNPANKQLRSDNGNQWNNGMYYAASPFYNGYGYPAAPFPDP  410



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+EDLRQ FSQYGEI   KIP+GK CGFVQFA R +AE+ALQ L G  IGKQ VRLSW
Sbjct  309  NVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQGLNGSTIGKQNVRLSW  368

Query  435  GRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYTYAFPAP  325
            GRNPA++Q R D  NQW   G YY    FY+GY Y   AP
Sbjct  369  GRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAP  408



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+EDLRQ FSQYGEI   KIP+GK CGFVQFA R +AE+ALQ L G  IGKQ VRLSW
Sbjct  312  NVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQGLNGSTIGKQNVRLSW  371

Query  435  GRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYTYAFPAP  325
            GRNPA++Q R D  NQW   G YY    FY+GY Y   AP
Sbjct  372  GRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAP  411



>ref|XP_002313840.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE87795.2| RNA-binding protein 47 [Populus trichocarpa]
Length=435

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  K+P GKGC FVQFANR +AE+ALQ L G  IGKQTVRLSW
Sbjct  324  DVTDEDLRQPFSQFGEVVSVKMPTGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSW  383

Query  435  GRNPAHRQSRSDFTNQWAGA  376
            GR PA++Q R D  NQW GA
Sbjct  384  GRTPANKQWRGDHGNQWHGA  403



>gb|KHN31058.1| Polyadenylate-binding protein RBP47 [Glycine soja]
Length=266

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            + SDEDLRQPF Q+GE+V  KIPVGKGCGFVQFA+R +AEEA+  L G VIGKQTVRLSW
Sbjct  159  DTSDEDLRQPFLQFGEVVSVKIPVGKGCGFVQFADRKNAEEAIHALNGTVIGKQTVRLSW  218

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P ++  RSD      G Y+GG  Y G+ +A
Sbjct  219  GRSPGNKHWRSDSN----GGYFGGQSYGGHGFA  247



>ref|XP_011000065.1| PREDICTED: polyadenylate-binding protein RBP47 [Populus euphratica]
Length=436

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  K+P GKGC FVQFANR +AE+ALQ L G  IGKQTVRLSW
Sbjct  325  DVTDEDLRQPFSQFGEVVSVKMPTGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSW  384

Query  435  GRNPAHRQSRSDFTNQWAGA  376
            GR PA++Q R D  NQW GA
Sbjct  385  GRTPANKQWRGDHGNQWHGA  404



>ref|XP_002891364.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67623.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+D+DLRQPFS++GEIV  KIPVGKGCGFVQF NR  AEEAL+KL G VIGKQTVRLSW
Sbjct  322  SVTDDDLRQPFSEFGEIVSVKIPVGKGCGFVQFVNRPSAEEALEKLNGTVIGKQTVRLSW  381

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRN A++Q R  + NQW   YYGG +Y+GY Y  P P      A    G Y MYG HQQQ
Sbjct  382  GRNQANKQPRDKYGNQWVAPYYGGQYYNGYGYMVPQPDPRMYPATPYGGGYRMYGGHQQQ  441

Query  255  VS  250
            VS
Sbjct  442  VS  443



>gb|EMT16295.1| Putative RNA-binding protein [Aegilops tauschii]
Length=481

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DL+Q F+QYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  360  NVSEDDLKQTFTQYGEISSVKIPVGKQCGFVQFLQRKNAEDALQGLNGSTIGKQTVRLSW  419

Query  435  GRNPAHRQSRSDFTNQWA-GAYYG-GHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQ  262
            GRNPA++Q RSD  NQW  G YY    FY+GY Y  PA   P+    AA         +Q
Sbjct  420  GRNPANKQLRSDNGNQWTNGMYYAPSPFYNGYGY--PAAPFPDPGMYAAAYGAYPVYGNQ  477

Query  261  QQVS  250
            QQVS
Sbjct  478  QQVS  481



>ref|XP_009356988.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=445

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLRQPFS +GE+V  KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWG
Sbjct  336  VNDEDLRQPFSHFGEVVSVKIPVGKACGFVQFANRKDAENAIQMLNGTVIGKQTVRLSWG  395

Query  432  RNPAHRQSRSDFTNQWAGAY  373
            R+  ++Q RSD +NQW GA+
Sbjct  396  RSQGNKQWRSDSSNQWNGAH  415



>ref|XP_007199852.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
 gb|EMJ01051.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
Length=449

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSW
Sbjct  338  DVNDEDLRQPFSQFGEVVSVKIPVGKACGFVQFANRKDAENAMQMLNGTVIGKQTVRLSW  397

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+  ++Q RSD +NQW
Sbjct  398  GRSQGNKQWRSDSSNQW  414



>ref|XP_008236618.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=446

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSW
Sbjct  335  DVNDEDLRQPFSQFGEVVSVKIPVGKACGFVQFANRKDAENAMQMLNGTVIGKQTVRLSW  394

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+  ++Q RSD +NQW
Sbjct  395  GRSQGNKQWRSDSSNQW  411



>gb|KFK39248.1| hypothetical protein AALP_AA3G219800 [Arabis alpina]
Length=436

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+G++V  KIPVGKGCGFVQFANR  AE+A+Q L G VIGK TVRLSW
Sbjct  331  DVTDEDLRQPFSQFGDVVSVKIPVGKGCGFVQFANRNGAEDAIQNLNGTVIGKNTVRLSW  390

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P  +Q R D   QW G Y  G  Y+   YA
Sbjct  391  GRSPNKQQWRGDSGQQWNGGYSRGQGYNNGGYA  423



>ref|XP_007017332.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
 gb|EOY14557.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
Length=387

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGEIV  KIPVGKGCGFVQFANR +AEEALQKL G VIGKQTVRLSW
Sbjct  312  NVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSW  371

Query  435  GRNPAH  418
            GRNPA+
Sbjct  372  GRNPAN  377



>ref|XP_006384437.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
 gb|ERP62234.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
Length=435

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGKGC FVQFANR +AE+ALQ L G  IGKQTVRLSW
Sbjct  324  DVTDEDLRQPFSQFGEVVSVKIPVGKGCAFVQFANRKNAEDALQSLNGTTIGKQTVRLSW  383

Query  435  GRNPAHRQSRSDFTNQW  385
            GR PA++Q R D  NQW
Sbjct  384  GRTPANKQWRGDHGNQW  400



>ref|XP_002518798.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43723.1| nuclear acid binding protein, putative [Ricinus communis]
Length=438

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            ++SDEDLRQPFSQ+GE+V  KIP GKGCGFVQFA+R  AE+ALQ L G  IGKQTVRLSW
Sbjct  327  DISDEDLRQPFSQFGEVVSVKIPAGKGCGFVQFADRKSAEDALQSLNGTTIGKQTVRLSW  386

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+PA++Q R D  NQW
Sbjct  387  GRSPANKQWRGDHNNQW  403



>ref|XP_008236617.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=450

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSW
Sbjct  339  DVNDEDLRQPFSQFGEVVSVKIPVGKACGFVQFANRKDAENAMQMLNGTVIGKQTVRLSW  398

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+  ++Q RSD +NQW
Sbjct  399  GRSQGNKQWRSDSSNQW  415



>dbj|BAJ85879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS++DL+Q FSQYGEI   KIPVGK CGFVQF  R +AE+ALQ L G  IGKQTVRLSW
Sbjct  358  NVSEDDLKQTFSQYGEISSVKIPVGKQCGFVQFLQRKNAEDALQGLNGSTIGKQTVRLSW  417

Query  435  GRNPAHRQSRSDFTNQW-AGAYYG-GHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQ  262
            GRNPA++Q RSD  NQW  G YY    FY+GY Y  PA   P+    AA         +Q
Sbjct  418  GRNPANKQLRSDNGNQWNNGMYYAPSPFYNGYGY--PAAPFPDPGMYAAAYGAYPLYGNQ  475

Query  261  QQVS  250
            QQVS
Sbjct  476  QQVS  479



>ref|XP_006648763.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=378

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++++LR+ F++YG++   KIPVGK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  259  NVTEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAEEALQGLNGSTIGKQAVRLSW  318

Query  435  GRNPAHRQSRSDFTNQWAGAYYGG-HFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++  G YYG   FY GY YA P PH PN
Sbjct  319  GRSPASKQSRGDSGHRRNGMYYGTPPFYGGYGYASPLPH-PN  359



>ref|XP_004230808.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum lycopersicum]
Length=413

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G VIGKQ VRLSW
Sbjct  297  DVTDEELRQSFTQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAVIGKQAVRLSW  356

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GR+P+++Q RSD  N   G YYG   Y GY Y
Sbjct  357  GRSPSNKQMRSDSGN--GGGYYGRQNYGGYGY  386



>ref|XP_006346456.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum tuberosum]
Length=420

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSW
Sbjct  304  DVTDEELRQSFTQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSW  363

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GR+PA++Q R+D  N   G YYG   Y GY Y
Sbjct  364  GRSPANKQMRTDSGN--GGGYYGRQNYGGYGY  393



>ref|XP_002863750.1| hypothetical protein ARALYDRAFT_331131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40009.1| hypothetical protein ARALYDRAFT_331131 [Arabidopsis lyrata subsp. 
lyrata]
Length=400

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+D+DLRQPF+ YGEIV  KIPVGKGCGF+QF NR +AEEAL+KL G +IGKQTVRLSW
Sbjct  277  SVTDDDLRQPFAGYGEIVSVKIPVGKGCGFIQFVNRENAEEALEKLNGSMIGKQTVRLSW  336

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GRNP ++Q R ++ +QW   YYGG +Y+GY Y  P P +P
Sbjct  337  GRNPGNKQPRGEYADQWVEPYYGGQYYNGYGYMMPPPVDP  376



>emb|CDO97156.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LR+ FSQ+GE+V  KIP GKGCGFVQF+NR++AE+A+Q+L G  IGKQ VRLSW
Sbjct  322  DVTDEELRESFSQFGEVVSVKIPSGKGCGFVQFSNRSNAEDAMQRLNGAAIGKQMVRLSW  381

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
            GRNP ++Q R D + Q  G+ YG    +GY Y  P
Sbjct  382  GRNPVNKQLRMDSSYQLNGSNYGRQGQNGYGYPMP  416



>gb|ACG32072.1| nucleic acid binding protein [Zea mays]
 gb|ACG34530.1| nucleic acid binding protein [Zea mays]
 gb|AFW58432.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=369

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++Y ++   KIP+GK CGFVQF +RTDAEEALQ L G +IGKQ VRLSW
Sbjct  252  NVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSLIGKQAVRLSW  310

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
             R+P+H+QSR D  N+    YYG  FY GY YA P PH PN
Sbjct  311  VRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASPVPH-PN  350



>gb|KJB58433.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=385

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV++EDLRQPFSQYGEIV  KIPVGKGCGFVQFA R +AEEALQKL G +IGKQTVRLSW
Sbjct  312  NVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAGRNNAEEALQKLNGTIIGKQTVRLSW  371

Query  435  GRNPAHRQ  412
            GRNP ++Q
Sbjct  372  GRNPTNKQ  379



>gb|ACN40970.1| unknown [Picea sitchensis]
Length=430

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 74/107 (69%), Gaps = 9/107 (8%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N +DEDLRQ F QYGE+V  KIPVGKGCGFVQF NR  AEEALQ+L G VI +QTVRLSW
Sbjct  307  NATDEDLRQVFGQYGELVSVKIPVGKGCGFVQFGNRASAEEALQRLHGTVIRQQTVRLSW  366

Query  435  GRNPAHRQSRSDFT-------NQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GR+PA++Q             NQW GAYY G  Y+ Y YA P P +P
Sbjct  367  GRSPANKQQPQPQGQQPQSDPNQWNGAYY-GQGYESYGYA-PPPQDP  411



>ref|XP_002452313.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
 gb|EES05289.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
Length=435

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 5/105 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP GK CGFVQF NR DAEEALQ L G  IGKQ VRLSW
Sbjct  313  NVSEDELRKAFAKYGDLASVKIPFGKQCGFVQFVNRADAEEALQGLNGATIGKQAVRLSW  372

Query  435  GRNPAHRQSRSDFTNQW----AGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++      G YYG  FY GY YA P PH PN
Sbjct  373  GRSPASKQSRGDSGHRRNGNGNGMYYGTPFYSGYGYASPVPH-PN  416



>gb|ACN39849.1| unknown [Picea sitchensis]
Length=429

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 74/107 (69%), Gaps = 9/107 (8%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N +DEDLRQ F QYGE+V  KIPVGKGCGFVQF NR  AEEALQ+L G VI +QTVRLSW
Sbjct  306  NATDEDLRQVFGQYGELVSVKIPVGKGCGFVQFGNRASAEEALQRLHGTVIRQQTVRLSW  365

Query  435  GRNPAHRQSRSDFT-------NQWAGAYYGGHFYDGYTYAFPAPHNP  316
            GR+PA++Q             NQW GAYY G  Y+ Y YA P P +P
Sbjct  366  GRSPANKQQPQPQGQQPQSDPNQWNGAYY-GQGYESYGYA-PPPQDP  410



>gb|ACF85767.1| unknown [Zea mays]
 gb|AFW58431.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=420

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++Y ++   KIP+GK CGFVQF +RTDAEEALQ L G +IGKQ VRLSW
Sbjct  303  NVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSLIGKQAVRLSW  361

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
             R+P+H+QSR D  N+    YYG  FY GY YA P PH PN
Sbjct  362  VRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASPVPH-PN  401



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            + SDEDLRQPF Q+GE+V  KIPVGKGCGFVQFA+R +AEEA+  L G VIGKQTVRLSW
Sbjct  324  DTSDEDLRQPFLQFGEVVSVKIPVGKGCGFVQFADRKNAEEAIHALNGTVIGKQTVRLSW  383

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P ++  RSD      G Y+GG  Y G+ +A
Sbjct  384  GRSPGNKHWRSDSN----GGYFGGQSYGGHGFA  412



>ref|NP_001150649.1| nucleic acid binding protein [Zea mays]
 gb|ACG39896.1| nucleic acid binding protein [Zea mays]
Length=420

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++Y ++   KIP+GK CGFVQF +RTDAEEALQ L G +IGKQ VRLSW
Sbjct  303  NVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVSRTDAEEALQGLNGSLIGKQAVRLSW  361

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
             R+P+H+QSR D  N+    YYG  FY GY YA P PH PN
Sbjct  362  VRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASPVPH-PN  401



>ref|XP_006279885.1| hypothetical protein CARUB_v100264670mg, partial [Capsella rubella]
 gb|EOA12783.1| hypothetical protein CARUB_v100264670mg, partial [Capsella rubella]
Length=307

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+ +GEIV  KIP+G+GCGF+QF NR +AEEAL+KL G +IGKQTVRLSW
Sbjct  185  SVTDEDLRQPFAGFGEIVSVKIPIGRGCGFIQFVNRENAEEALEKLNGSMIGKQTVRLSW  244

Query  435  GRNPAHRQSRSDFTNQWA  382
            GRNP ++Q R ++T+ W 
Sbjct  245  GRNPGNKQPRGEYTDPWV  262



>ref|XP_009358068.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=390

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLRQPFS +GE+V  KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWG
Sbjct  280  VNDEDLRQPFSHFGEVVSVKIPVGKACGFVQFANRKDAENAIQMLNGTVIGKQTVRLSWG  339

Query  432  RNPAHRQSRSDFTNQW  385
            R+  ++Q RSD +NQW
Sbjct  340  RSQGNKQWRSDSSNQW  355



>gb|KCW68769.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=428

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQ FSQYGEIV  KIP GKGCGFVQFANR++AEEALQKL G VIGKQTVRLSW
Sbjct  330  SVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFANRSNAEEALQKLNGTVIGKQTVRLSW  389

Query  435  GRNPAHRQSR  406
            GRNPA++Q R
Sbjct  390  GRNPANKQVR  399



>ref|XP_006406535.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
 gb|ESQ47988.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
Length=436

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSW
Sbjct  333  DVTDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSW  392

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P ++Q R D   QW G Y  G  Y+   YA
Sbjct  393  GRSP-NKQWRGDSGQQWNGGYSRGQGYNNGGYA  424



>ref|XP_010519119.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47C-like [Tarenaya hassleriana]
Length=424

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF +YG+IV    P GKGCGFVQF NRT AEEAL+KL G VIGKQTVRLSW
Sbjct  305  SVTDEDLRQPFIEYGDIV--SXPAGKGCGFVQFVNRTSAEEALEKLNGTVIGKQTVRLSW  362

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyGTHQQQ  256
            GRNPA++Q R  F NQW G YYGG +Y+GY Y  P P +P MY+PAAYGAYP+Y  +QQQ
Sbjct  363  GRNPANKQLRGGFGNQWVGPYYGGQYYNGYGYMIPPPLDPIMYSPAAYGAYPVYVGNQQQ  422

Query  255  VS  250
            VS
Sbjct  423  VS  424



>gb|KFK39249.1| hypothetical protein AALP_AA3G219800 [Arabis alpina]
Length=435

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+G++V  KIPVGKGCGFVQFANR  AE+A+Q L G VIGK TVRLSW
Sbjct  331  DVTDEDLRQPFSQFGDVVSVKIPVGKGCGFVQFANRNGAEDAIQNLNGTVIGKNTVRLSW  390

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P ++Q R D   QW G Y  G  Y+   YA
Sbjct  391  GRSP-NKQWRGDSGQQWNGGYSRGQGYNNGGYA  422



>gb|AAC49850.1| DNA binding protein ACBF [Nicotiana tabacum]
Length=428

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSW
Sbjct  305  DVTDEELRQSFNQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSW  364

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
            GR  A++Q R+D  +QW G Y G   Y GY Y
Sbjct  365  GR-TANKQMRADSGSQWNGGYNGRQNYGGYGY  395



>ref|XP_002894197.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70456.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE+V  KIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSW
Sbjct  342  DVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSW  401

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  402  GRSP-NKQWRSDTGNQWNGGYSRGQGYN  428



>ref|XP_008678713.1| PREDICTED: polyadenylate-binding protein RBP47-like [Zea mays]
 gb|AFW62691.1| hypothetical protein ZEAMMB73_026342 [Zea mays]
Length=430

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP GK CGFVQF NR DAEEAL  L G  IGKQ VRLSW
Sbjct  308  NVSEDELRKAFAKYGDLASVKIPFGKQCGFVQFVNRVDAEEALHGLNGSTIGKQAVRLSW  367

Query  435  GRNPAHRQSRSDFTNQ----WAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+PA +QSR D  ++      G YYG  FY GY YA P PH PN
Sbjct  368  GRSPASKQSRGDSGHRRNGNCNGMYYGTPFYGGYGYASPIPH-PN  411



>gb|KFK31829.1| hypothetical protein AALP_AA6G163800 [Arabis alpina]
Length=410

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDLR+PF+++GEI   KIP+GKGCGF+QF NR DAEEAL+KL G VIGKQTVRLSW
Sbjct  290  SVSDEDLREPFAKFGEITSVKIPIGKGCGFIQFVNRGDAEEALEKLNGSVIGKQTVRLSW  349

Query  435  GRNPAHRQSRSDFTNQW  385
            GRNPA +  R +F +QW
Sbjct  350  GRNPA-KLPRGEFADQW  365



>gb|KFK31830.1| hypothetical protein AALP_AA6G163800 [Arabis alpina]
Length=409

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDLR+PF+++GEI   KIP+GKGCGF+QF NR DAEEAL+KL G VIGKQTVRLSW
Sbjct  289  SVSDEDLREPFAKFGEITSVKIPIGKGCGFIQFVNRGDAEEALEKLNGSVIGKQTVRLSW  348

Query  435  GRNPAHRQSRSDFTNQW  385
            GRNPA +  R +F +QW
Sbjct  349  GRNPA-KLPRGEFADQW  364



>ref|NP_001130489.1| uncharacterized protein LOC100191587 [Zea mays]
 gb|ACF78722.1| unknown [Zea mays]
Length=417

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP GK CGFVQF NR DAEEALQ L G  IGKQ +RLSW
Sbjct  297  NVSEDELRKAFAKYGDLASVKIPFGKQCGFVQFVNRVDAEEALQGLNGSTIGKQAIRLSW  356

Query  435  GRNPAHRQSRSDFTNQW--AGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P  +QSR D+ ++    G YYG  FY GY YA P  H PN
Sbjct  357  GRSPTSKQSRGDYGHRRNGNGMYYGTPFYGGYGYASPVAH-PN  398



>ref|XP_009420609.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 4/102 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N++D+ LRQ FS YGEIV  KIPVGK CGFVQFANR  AEEAL+ L G ++G Q++RLSW
Sbjct  307  NITDDHLRQVFSAYGEIVYVKIPVGKRCGFVQFANRASAEEALRMLNGTLLGGQSIRLSW  366

Query  435  GRNPAHRQSRSDFTNQWAGAYYG-GHFYDGYTYAFPAPHNPN  313
            GR+PA++Q + D  NQW G+YYG    YD  TY +  P +PN
Sbjct  367  GRSPANKQPQQD-PNQWNGSYYGYTQSYD--TYGYAPPQDPN  405



>ref|XP_008392304.1| PREDICTED: polyadenylate-binding protein RBP47 [Malus domestica]
Length=443

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  612  VSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG  433
            V+DEDLR PFS +GE+V  KIPVGK CGFVQFANR DAE A+Q L G VIGKQTVRLSWG
Sbjct  333  VNDEDLRLPFSHFGEVVSVKIPVGKACGFVQFANRKDAENAIQMLNGTVIGKQTVRLSWG  392

Query  432  RNPAHRQSRSDFTNQW  385
            R+  ++Q RSD +NQW
Sbjct  393  RSQGNKQWRSDSSNQW  408



>ref|XP_009147873.1| PREDICTED: polyadenylate-binding protein RBP47A [Brassica rapa]
Length=431

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE+V  KIPVGKGCGFVQF NR  AEEA+  L G VIGK TVRLSW
Sbjct  322  DVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQFGNRQSAEEAIGSLNGTVIGKNTVRLSW  381

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P +RQ R D  +QW G Y  G  Y+   YA
Sbjct  382  GRSP-NRQWRGDSGHQWNGGYSRGQGYNNNGYA  413



>emb|CDY50959.1| BnaA06g37550D [Brassica napus]
Length=430

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE+V  KIPVGKGCGFVQF NR  AEEA+  L G VIGK TVRLSW
Sbjct  321  DVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQFGNRQSAEEAIGNLNGTVIGKNTVRLSW  380

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P +RQ R D  +QW G Y  G  Y+   YA
Sbjct  381  GRSP-NRQWRGDSGHQWNGGYSRGQGYNNNGYA  412



>gb|ABK24911.1| unknown [Picea sitchensis]
Length=397

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 9/105 (9%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            N +DEDLRQ F  +GEIV  KIPVGKGCGFVQF NR+ AEEALQKL G +IG+Q++RLSW
Sbjct  273  NATDEDLRQVFGPFGEIVYVKIPVGKGCGFVQFTNRSSAEEALQKLHGTIIGQQSIRLSW  332

Query  435  GRNPAHRQSRS------DFTNQW--AGAYYG-GHFYDGYTYAFPA  328
            GR+PA++Q+ S         NQW   GAYY  G  Y+ Y YA PA
Sbjct  333  GRSPANKQTASWGVQPQPDPNQWNGGGAYYSYGQGYEAYGYAPPA  377



>ref|XP_006297697.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
 gb|EOA30595.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
Length=439

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSW
Sbjct  334  DVTDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSW  393

Query  435  GRNPAHRQSR-SDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P  +Q R  D   QW G Y  G  Y+   YA
Sbjct  394  GRSPNKQQWRGGDSGQQWNGGYSRGQGYNNGGYA  427



>ref|NP_001275480.1| DNA binding protein ACBF-like [Solanum tuberosum]
 gb|ABB86267.1| DNA binding protein ACBF-like [Solanum tuberosum]
Length=372

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE+LRQ F+Q+GE+V  KIP GKGCGFVQF++R+ A+EA+QKL G +IGKQ VRLSW
Sbjct  254  DVTDEELRQSFTQFGEVVSVKIPAGKGCGFVQFSDRSSAQEAIQKLSGAIIGKQAVRLSW  313

Query  435  GRNPAHRQSRSDFTNQWAGAYYG  367
            GR+PA++Q R+D  N   G YYG
Sbjct  314  GRSPANKQMRTDSGN--GGGYYG  334



>ref|XP_009406502.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=437

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DE LRQ FS YGEIV  KIPVGK CGFVQF NR +AEEALQ L G ++G Q VRLSW
Sbjct  315  NVTDEHLRQVFSPYGEIVYIKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLSW  374

Query  435  GRNPAHRQSRSDFTNQWAGAYYG-GHFYDGYTYAFPAPHNPN  313
            GR+P ++Q + D  NQW G YYG    YD Y YA   P +PN
Sbjct  375  GRSPTNKQPQQD-PNQWNGNYYGYTQSYDAYGYA--PPQDPN  413



>ref|XP_009406503.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=430

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DE LRQ FS YGEIV  KIPVGK CGFVQF NR +AEEALQ L G ++G Q VRLSW
Sbjct  308  NVTDEHLRQVFSPYGEIVYIKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLSW  367

Query  435  GRNPAHRQSRSDFTNQWAGAYYG-GHFYDGYTYAFPAPHNPN  313
            GR+P ++Q + D  NQW G YYG    YD Y YA   P +PN
Sbjct  368  GRSPTNKQPQQD-PNQWNGNYYGYTQSYDAYGYA--PPQDPN  406



>gb|AAG13046.1|AC011807_5 Putative RNA binding protein [Arabidopsis thaliana]
Length=468

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFS +GE+V  KIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSW
Sbjct  360  DVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSW  419

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  420  GRSP-NKQWRSDSGNQWNGGYSRGQGYN  446



>ref|NP_175383.1| RNA-binding protein 47A [Arabidopsis thaliana]
 sp|F4I3B3.1|RB47A_ARATH RecName: Full=Polyadenylate-binding protein RBP47A; Short=Poly(A)-binding 
protein RBP47A; AltName: Full=RNA-binding protein 
47A; Short=AtRBP47A [Arabidopsis thaliana]
 gb|AEE32448.1| RNA-binding protein 47A [Arabidopsis thaliana]
Length=445

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFS +GE+V  KIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSW
Sbjct  337  DVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSW  396

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  397  GRSP-NKQWRSDSGNQWNGGYSRGQGYN  423



>ref|XP_006307519.1| hypothetical protein CARUB_v10009142mg [Capsella rubella]
 gb|EOA40417.1| hypothetical protein CARUB_v10009142mg [Capsella rubella]
Length=443

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE++  KIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSW
Sbjct  335  DVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSW  394

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q R D  NQW G Y  G  Y+
Sbjct  395  GRSP-NKQWRGDSGNQWNGGYSRGQGYN  421



>ref|XP_006297696.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
 gb|EOA30594.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
Length=438

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGKGCGFVQFA+R  AE+A++ L G VIGK TVRLSW
Sbjct  334  DVTDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSW  393

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P  +    D   QW G Y  G  Y+   YA
Sbjct  394  GRSPNKQWRGGDSGQQWNGGYSRGQGYNNGGYA  426



>ref|XP_010500505.1| PREDICTED: polyadenylate-binding protein RBP47A-like [Camelina 
sativa]
Length=447

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE++  KIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSW
Sbjct  339  DVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSW  398

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q R D  NQW G Y  G  Y+
Sbjct  399  GRSP-NKQWRGDSGNQWNGGYSRGQGYN  425



>ref|XP_010461802.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X1 [Camelina sativa]
 ref|XP_010461803.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X2 [Camelina sativa]
Length=455

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE++  KIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSW
Sbjct  347  DVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSW  406

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q R D  NQW G Y  G  Y+
Sbjct  407  GRSP-NKQWRGDSGNQWNGGYSRGQGYN  433



>ref|XP_010479396.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X1 [Camelina 
sativa]
 ref|XP_010479397.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X2 [Camelina 
sativa]
Length=454

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE++  KIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSW
Sbjct  346  DVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSW  405

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q R D  NQW G Y  G  Y+
Sbjct  406  GRSP-NKQWRGDSGNQWNGGYSRGQGYN  432



>gb|AFK41944.1| unknown [Medicago truncatula]
Length=411

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DE L+Q F+QYGE+V  KIP GK CGFVQFA+R+ AEEAL+ L G ++G Q VRLSW
Sbjct  284  NVTDEHLKQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLSW  343

Query  435  GRNPAHRQSRSDFTNQWAG--AYYGGHF--YDGYTYAFPAPHNPN  313
            GR+PA++Q++ D  NQW G  +Y+GG+   Y+ Y YA PA  +PN
Sbjct  344  GRSPANKQTQQD-PNQWNGSSSYFGGYAQGYENYAYAPPAGQDPN  387



>ref|XP_003610417.1| RNA-binding protein [Medicago truncatula]
 gb|AES92614.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=411

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DE L+Q F+QYGE+V  KIP GK CGFVQFA+R+ AEEAL+ L G ++G Q VRLSW
Sbjct  284  NVTDEHLKQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLSW  343

Query  435  GRNPAHRQSRSDFTNQWAG--AYYGGHF--YDGYTYAFPAPHNPN  313
            GR+PA++Q++ D  NQW G  +Y+GG+   Y+ Y YA PA  +PN
Sbjct  344  GRSPANKQTQQD-PNQWNGSSSYFGGYAQGYENYAYAPPAGQDPN  387



>ref|XP_004294842.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=454

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDLRQPFSQ+GE++  KIPVGK CGFVQFANR DAE A+  L   VIGKQTVRLSW
Sbjct  342  DVNEEDLRQPFSQFGEVISVKIPVGKACGFVQFANRKDAENAMNMLNATVIGKQTVRLSW  401

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+  ++Q RSD  NQW
Sbjct  402  GRSQGNKQWRSDSNNQW  418



>gb|AEW68341.1| putative nuclear acid binding protein [Medicago sativa]
Length=409

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NV+DE L+Q F+QYGE+V  KIP GK CGFVQFA+R+ AEEAL+ L G ++G Q VRLSW
Sbjct  282  NVTDEHLKQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLSW  341

Query  435  GRNPAHRQSRSDFTNQWAGA--YYGGHF--YDGYTYAFPAPHNPN  313
            GR+PA++Q++ D  NQW G+  Y+GG+   Y+ Y YA PA  +PN
Sbjct  342  GRSPANKQTQQD-PNQWNGSSGYFGGYAQGYENYAYAPPAGQDPN  385



>ref|XP_011461514.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=448

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDLRQPFSQ+GE++  KIPVGK CGFVQFANR DAE A+  L   VIGKQTVRLSW
Sbjct  336  DVNEEDLRQPFSQFGEVISVKIPVGKACGFVQFANRKDAENAMNMLNATVIGKQTVRLSW  395

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+  ++Q RSD  NQW
Sbjct  396  GRSQGNKQWRSDSNNQW  412



>ref|XP_011092727.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Sesamum indicum]
Length=387

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 9/96 (9%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE LR+ F+ YGE+V  KIP GKGCGFVQFANR++AE+A+Q+L G VIGKQTVRLSW
Sbjct  285  DVTDEQLRESFTPYGEVVSVKIPAGKGCGFVQFANRSNAEDAIQRLNGTVIGKQTVRLSW  344

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  328
            GRN  ++Q+         GAYYG   Y+GY YA  A
Sbjct  345  GRNLGNKQN---------GAYYGRQGYNGYGYAGAA  371



>ref|XP_011092726.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Sesamum indicum]
Length=403

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 9/96 (9%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DE LR+ F+ YGE+V  KIP GKGCGFVQFANR++AE+A+Q+L G VIGKQTVRLSW
Sbjct  301  DVTDEQLRESFTPYGEVVSVKIPAGKGCGFVQFANRSNAEDAIQRLNGTVIGKQTVRLSW  360

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  328
            GRN  ++Q+         GAYYG   Y+GY YA  A
Sbjct  361  GRNLGNKQN---------GAYYGRQGYNGYGYAGAA  387



>gb|EMT05029.1| Putative RNA-binding protein [Aegilops tauschii]
Length=310

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 72/103 (70%), Gaps = 7/103 (7%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            NVS+++LR+ F++YG++   KIP+GK CGFVQ    TDAEEALQ L G VIGKQ VRLSW
Sbjct  194  NVSEDELRKSFAKYGDVASVKIPLGKQCGFVQ----TDAEEALQGLNGAVIGKQAVRLSW  249

Query  435  GRNPAHRQSRSD--FTNQWAGAYYGGHFYDGYTYAFPAPHNPN  313
            GR+P+H+QSR D          YYG  FY GY YA P PH PN
Sbjct  250  GRSPSHKQSRGDSGNRRNNNNMYYGTPFYGGYGYASPVPH-PN  291



>emb|CDY28101.1| BnaC06g02820D [Brassica napus]
Length=429

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+++DL QPFSQ+GE+V  KIPVGKGCGFVQF NR  AEEA+  L G VIGK TVRLSW
Sbjct  320  DVTEDDLMQPFSQFGEVVSVKIPVGKGCGFVQFGNRQSAEEAIGSLNGTVIGKNTVRLSW  379

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR+P +RQ R D  +QW G Y  G  Y+   YA
Sbjct  380  GRSP-NRQWRGDSGHQWNGGYSRGQGYNNNGYA  411



>gb|ACL54800.1| unknown [Zea mays]
 tpg|DAA40261.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=322

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 72/100 (72%), Gaps = 5/100 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VS+EDLRQ FSQYGEI   KIPVGK CGFVQFA R +AE+ALQ L G  IGKQ VRLSW
Sbjct  196  DVSEEDLRQAFSQYGEISSVKIPVGKQCGFVQFAQRKNAEDALQGLNGSTIGKQAVRLSW  255

Query  435  GRNPAHRQSRSDFTN-QW--AGAYYGG-HFYDGYTYAFPA  328
            GRNPA++Q R D  N QW   G YY    FY+G  Y +PA
Sbjct  256  GRNPANKQFRGDNGNMQWKNGGVYYAAPPFYNG-GYGYPA  294



>gb|KDO36653.1| hypothetical protein CISIN_1g037126mg, partial [Citrus sinensis]
Length=192

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSD+DLR+PFS +GEI+  KIPVGKGCGFVQFANR DAE ALQKL+G  IGKQTVRLS 
Sbjct  97   DVSDKDLREPFSHFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSS  156

Query  435  GRNPAHRQSRSDFTNQWAGA  376
            G NP ++Q R D  N  A A
Sbjct  157  GHNPGNKQWRGDHINLIALA  176



>emb|CDY68866.1| BnaCnng60840D [Brassica napus]
Length=415

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFS +GE+V  KIPVGKGCGF+QF NR  AEEA+  L G VIGK TVRLSW
Sbjct  307  DVTEEDLMQPFSHFGEVVSVKIPVGKGCGFIQFGNRQSAEEAIGSLNGTVIGKNTVRLSW  366

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
            GR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  367  GRSP-NKQWRSDSGNQWNGGYSRGQGYN  393



>gb|KHN37491.1| Polyadenylate-binding protein RBP47 [Glycine soja]
Length=321

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            + SDEDLRQPF Q+GE+V  KIPVGKGCGFVQFA+R +AEEA+Q L G VIGKQTVRLSW
Sbjct  213  DTSDEDLRQPFLQFGEVVSVKIPVGKGCGFVQFADRKNAEEAIQGLNGTVIGKQTVRLSW  272

Query  435  GRNPAHRQSRSD  400
            GR+P ++  RSD
Sbjct  273  GRSPGNKHWRSD  284



>emb|CDX95462.1| BnaC01g33540D [Brassica napus]
Length=434

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+++GE+V  KIPVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSW
Sbjct  332  DVTDEDLRQPFTEFGEVVSVKIPVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSW  391

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR P   + R D   QW G Y  G  Y+   YA
Sbjct  392  GRTP--NKWRGDSGQQWNGGYSRGQGYNNGGYA  422



>ref|XP_009112131.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X2 [Brassica rapa]
Length=434

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+++GE+V  KIPVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSW
Sbjct  332  DVTDEDLRQPFTEFGEVVSVKIPVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSW  391

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR P   + R D   QW G Y  G  Y+   YA
Sbjct  392  GRTP--NKWRGDSGQQWNGGYSRGQGYNNGGYA  422



>emb|CDY18570.1| BnaA01g26250D [Brassica napus]
Length=434

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPF+++GE+V  KIPVGKGCGFVQFANR  A++A+Q L G VIGK TVRLSW
Sbjct  332  DVTDEDLRQPFTEFGEVVSVKIPVGKGCGFVQFANRKSADDAIQSLNGTVIGKNTVRLSW  391

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
            GR P   + R D   QW G Y  G  Y+   YA
Sbjct  392  GRTP--NKWRGDSGQQWNGGYSRGQGYNNGGYA  422



>ref|XP_008667171.1| PREDICTED: uncharacterized protein LOC100193409 isoform X1 [Zea 
mays]
 tpg|DAA40260.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=424

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 72/100 (72%), Gaps = 5/100 (5%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VS+EDLRQ FSQYGEI   KIPVGK CGFVQFA R +AE+ALQ L G  IGKQ VRLSW
Sbjct  298  DVSEEDLRQAFSQYGEISSVKIPVGKQCGFVQFAQRKNAEDALQGLNGSTIGKQAVRLSW  357

Query  435  GRNPAHRQSRSDFTN-QW--AGAYYGG-HFYDGYTYAFPA  328
            GRNPA++Q R D  N QW   G YY    FY+G  Y +PA
Sbjct  358  GRNPANKQFRGDNGNMQWKNGGVYYAAPPFYNG-GYGYPA  396



>ref|XP_007156542.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28536.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=367

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            ++SDEDLRQPF Q+GE+V  KIPVGKGCGFVQFA+R +AE+A+Q L G VIGKQTVRLSW
Sbjct  258  DISDEDLRQPFLQFGEVVSVKIPVGKGCGFVQFADRKNAEDAIQALNGTVIGKQTVRLSW  317

Query  435  GRNPAHRQSRSD  400
            GR+P ++  RSD
Sbjct  318  GRSPGNKHWRSD  329



>ref|XP_002885294.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61553.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
Length=435

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V+DEDLRQPFSQ+GE+V  KIPVGKGCGFVQFA R  AE+A++ L G VIGK TVRLSW
Sbjct  331  DVTDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFAERKSAEDAIETLNGTVIGKNTVRLSW  390

Query  435  GRNPAHRQSRSDFTNQWAGAY  373
            GR+P ++Q R D   QW G Y
Sbjct  391  GRSP-NKQWRGDSGQQWNGGY  410



>ref|XP_007156541.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28535.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=363

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            ++SDEDLRQPF Q+GE+V  KIPVGKGCGFVQFA+R +AE+A+Q L G VIGKQTVRLSW
Sbjct  254  DISDEDLRQPFLQFGEVVSVKIPVGKGCGFVQFADRKNAEDAIQALNGTVIGKQTVRLSW  313

Query  435  GRNPAHRQSRSD  400
            GR+P ++  RSD
Sbjct  314  GRSPGNKHWRSD  325



>emb|CDY16528.1| BnaA08g02390D [Brassica napus]
Length=424

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE+V  KIPVGKGCGFVQF NR  AEEA++ L G VIGK TVRLSW
Sbjct  316  DVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQFGNRKSAEEAIENLNGTVIGKNTVRLSW  375

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFY-DGY  346
            GR+P +RQ R +  +QW G Y  G  Y +GY
Sbjct  376  GRSP-NRQWRGEAGHQWNGGYSRGQGYSNGY  405



>ref|XP_009107272.1| PREDICTED: polyadenylate-binding protein RBP47A-like [Brassica 
rapa]
Length=424

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +V++EDL QPFSQ+GE+V  KIPVGKGCGFVQF NR  AEEA++ L G VIGK TVRLSW
Sbjct  316  DVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQFGNRKSAEEAIENLNGTVIGKNTVRLSW  375

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFY-DGY  346
            GR+P +RQ R +  +QW G Y  G  Y +GY
Sbjct  376  GRSP-NRQWRGEAGHQWNGGYSRGQGYSNGY  405



>ref|XP_004168889.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=437

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDL+Q FS++G++V  KIP+GKGCGFVQFANR +AE+A+Q L G VIGKQTVRLSW
Sbjct  321  DVSDEDLKQAFSKFGDVVSVKIPIGKGCGFVQFANRKNAEDAIQGLNGTVIGKQTVRLSW  380

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+  ++Q R D  NQW
Sbjct  381  GRSTGNKQWRGDSNNQW  397



>ref|XP_004145357.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=436

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDEDL+Q FS++G++V  KIP+GKGCGFVQFANR +AE+A+Q L G VIGKQTVRLSW
Sbjct  320  DVSDEDLKQAFSKFGDVVSVKIPIGKGCGFVQFANRKNAEDAIQGLNGTVIGKQTVRLSW  379

Query  435  GRNPAHRQSRSDFTNQW  385
            GR+  ++Q R D  NQW
Sbjct  380  GRSTGNKQWRGDSNNQW  396



>gb|EPS57677.1| hypothetical protein M569_17140 [Genlisea aurea]
Length=414

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -2

Query  615  NVSDEDLRQPFSQYGEIVPXKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSW  436
            +VSDE+LRQ F+ YGEIV  KIP GKGCGFVQF +R +AE+AL++L G VIGKQ VRLSW
Sbjct  311  DVSDEELRQCFTPYGEIVSVKIPPGKGCGFVQFTDRINAEDALERLNGSVIGKQAVRLSW  370

Query  435  GRNPAHRQSRSDFTNQWAGAYYGGHFYDG  349
            GRN A++QSRS   N    AYYG  F+DG
Sbjct  371  GRNMANKQSRSSDGNGVV-AYYGRQFHDG  398



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090