BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051F22

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009111256.1|  PREDICTED: photosystem I reaction center sub...    182   5e-55   Brassica rapa
ref|XP_004134141.1|  PREDICTED: photosystem I reaction center sub...    181   8e-55   Cucumis sativus [cucumbers]
ref|XP_006306434.1|  hypothetical protein CARUB_v10012376mg             181   9e-55   Capsella rubella
ref|XP_009396832.1|  PREDICTED: photosystem I reaction center sub...    183   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY21916.1|  BnaC09g00220D                                          184   1e-54   Brassica napus [oilseed rape]
ref|XP_006288687.1|  hypothetical protein CARUB_v10001997mg             181   1e-54   Capsella rubella
ref|XP_008438687.1|  PREDICTED: photosystem I reaction center sub...    181   1e-54   Cucumis melo [Oriental melon]
ref|XP_009795521.1|  PREDICTED: photosystem I reaction center sub...    180   3e-54   Nicotiana sylvestris
ref|XP_009621208.1|  PREDICTED: photosystem I reaction center sub...    180   3e-54   Nicotiana tomentosiformis
ref|XP_010474926.1|  PREDICTED: photosystem I reaction center sub...    180   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_007050585.1|  Photosystem I subunit D-2                          179   5e-54   
ref|XP_006419899.1|  hypothetical protein CICLE_v10005892mg             179   5e-54   Citrus clementina [clementine]
ref|XP_011071575.1|  PREDICTED: photosystem I reaction center sub...    179   6e-54   Sesamum indicum [beniseed]
ref|XP_010277521.1|  PREDICTED: photosystem I reaction center sub...    179   6e-54   Nelumbo nucifera [Indian lotus]
ref|XP_008376830.1|  PREDICTED: photosystem I reaction center sub...    179   6e-54   Malus domestica [apple tree]
ref|XP_004296896.1|  PREDICTED: photosystem I reaction center sub...    179   7e-54   Fragaria vesca subsp. vesca
ref|XP_010522735.1|  PREDICTED: photosystem I reaction center sub...    179   8e-54   Tarenaya hassleriana [spider flower]
ref|XP_011021547.1|  PREDICTED: photosystem I reaction center sub...    179   8e-54   Populus euphratica
ref|XP_002516772.1|  Photosystem I reaction center subunit II, ch...    179   8e-54   Ricinus communis
gb|ABK96621.1|  unknown                                                 179   9e-54   Populus trichocarpa x Populus deltoides
ref|XP_009400838.1|  PREDICTED: photosystem I reaction center sub...    179   9e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003556041.1|  PREDICTED: photosystem I reaction center sub...    179   9e-54   Glycine max [soybeans]
ref|XP_009344083.1|  PREDICTED: photosystem I reaction center sub...    179   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_010430302.1|  PREDICTED: photosystem I reaction center sub...    179   1e-53   Camelina sativa [gold-of-pleasure]
gb|AGV54746.1|  photosystem I reaction center subunit II chloropl...    178   1e-53   Phaseolus vulgaris [French bean]
ref|NP_001062511.1|  Os08g0560900                                       178   2e-53   
ref|NP_001275862.1|  PSI reaction center subunit II                     178   2e-53   Citrus sinensis [apfelsine]
ref|XP_010422538.1|  PREDICTED: photosystem I reaction center sub...    178   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007143239.1|  hypothetical protein PHAVU_007G055900g             178   2e-53   Phaseolus vulgaris [French bean]
ref|XP_010681150.1|  PREDICTED: photosystem I reaction center sub...    178   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010542866.1|  PREDICTED: photosystem I reaction center sub...    178   2e-53   Tarenaya hassleriana [spider flower]
gb|ABK96248.1|  unknown                                                 176   2e-53   Populus trichocarpa x Populus deltoides
ref|NP_001235355.1|  photosystem I subunit PsaD                         178   3e-53   Glycine max [soybeans]
ref|XP_011026306.1|  PREDICTED: photosystem I reaction center sub...    177   3e-53   Populus euphratica
gb|AFV94477.1|  photosystem I reaction center subunit II                177   3e-53   Saccharum hybrid cultivar GT28
ref|XP_002311618.2|  photosystem I 20kD family protein                  177   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_002315779.1|  photosystem I 20kD family protein                  177   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_008340966.1|  PREDICTED: photosystem I reaction center sub...    177   4e-53   Malus domestica [apple tree]
ref|XP_008224535.1|  PREDICTED: photosystem I reaction center sub...    177   5e-53   Prunus mume [ume]
ref|NP_171812.1|  photosystem I reaction center subunit D-2             177   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009366924.1|  PREDICTED: photosystem I reaction center sub...    177   5e-53   Pyrus x bretschneideri [bai li]
gb|KFK42673.1|  hypothetical protein AALP_AA1G025000                    177   5e-53   Arabis alpina [alpine rockcress]
ref|XP_010481602.1|  PREDICTED: photosystem I reaction center sub...    177   5e-53   
ref|XP_002892148.1|  hypothetical protein ARALYDRAFT_887465             177   6e-53   Arabidopsis lyrata subsp. lyrata
gb|EYU41499.1|  hypothetical protein MIMGU_mgv1a013699mg                177   6e-53   Erythranthe guttata [common monkey flower]
ref|XP_009799304.1|  PREDICTED: photosystem I reaction center sub...    177   6e-53   Nicotiana sylvestris
ref|XP_009588197.1|  PREDICTED: photosystem I reaction center sub...    177   7e-53   Nicotiana tomentosiformis
pdb|3LW5|D  Chain D, Improved Model Of Plant Photosystem I              174   8e-53   unidentified
ref|XP_007226637.1|  hypothetical protein PRUPE_ppa022366mg             176   8e-53   
ref|XP_002520727.1|  Photosystem I reaction center subunit II, ch...    176   9e-53   Ricinus communis
ref|NP_192186.1|  photosystem I subunit D-1                             176   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb|ABK96014.1|  unknown                                                 172   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010256006.1|  PREDICTED: photosystem I reaction center sub...    176   1e-52   Nelumbo nucifera [Indian lotus]
gb|KJB46980.1|  hypothetical protein B456_008G004100                    176   1e-52   Gossypium raimondii
ref|XP_010035248.1|  PREDICTED: photosystem I reaction center sub...    176   1e-52   Eucalyptus grandis [rose gum]
gb|KJB23065.1|  hypothetical protein B456_004G079200                    177   1e-52   Gossypium raimondii
gb|AAM66066.1|  putative photosystem I reaction center subunit II...    176   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872810.1|  hypothetical protein ARALYDRAFT_490280             176   2e-52   
ref|XP_010108011.1|  Photosystem I reaction center subunit II           176   2e-52   
ref|XP_011090732.1|  PREDICTED: photosystem I reaction center sub...    176   2e-52   Sesamum indicum [beniseed]
emb|CDO99040.1|  unnamed protein product                                176   2e-52   Coffea canephora [robusta coffee]
gb|KFK30882.1|  hypothetical protein AALP_AA6G038200                    176   2e-52   Arabis alpina [alpine rockcress]
ref|XP_010474916.1|  PREDICTED: photosystem I reaction center sub...    177   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006356675.1|  PREDICTED: photosystem I reaction center sub...    175   2e-52   Solanum tuberosum [potatoes]
gb|EPS62726.1|  hypothetical protein M569_12065                         175   2e-52   Genlisea aurea
ref|XP_004511355.1|  PREDICTED: photosystem I reaction center sub...    176   2e-52   Cicer arietinum [garbanzo]
ref|XP_006396500.1|  hypothetical protein EUTSA_v10029178mg             176   3e-52   
emb|CAA32182.1|  unnamed protein product                                175   4e-52   Spinacia oleracea
ref|XP_011015859.1|  PREDICTED: photosystem I reaction center sub...    174   4e-52   Populus euphratica
emb|CAA68728.1|  unnamed protein product                                175   4e-52   Spinacia oleracea
ref|XP_002278284.1|  PREDICTED: photosystem I reaction center sub...    174   5e-52   Vitis vinifera
ref|XP_006838247.1|  hypothetical protein AMTR_s00103p00041210          174   5e-52   Amborella trichopoda
ref|XP_004241054.2|  PREDICTED: photosystem I reaction center sub...    174   6e-52   
emb|CAA54744.1|  psaD                                                   174   6e-52   Spinacia oleracea
ref|NP_001104945.1|  photosystem I subunit d1                           171   6e-52   
sp|P12353.2|PSAD_SPIOL  RecName: Full=Photosystem I reaction cent...    174   7e-52   Spinacia oleracea
ref|XP_004981348.1|  PREDICTED: photosystem I reaction center sub...    176   7e-52   
pdb|2WSC|D  Chain D, Improved Model Of Plant Photosystem I              174   7e-52   Spinacia oleracea
gb|AFK43504.1|  unknown                                                 174   9e-52   Lotus japonicus
ref|NP_001275788.1|  PSI reaction center subunit II                     174   1e-51   Citrus sinensis [apfelsine]
gb|AFW67274.1|  photosystem I reaction center subunit II                174   1e-51   
gb|KDP21451.1|  hypothetical protein JCGZ_21922                         173   1e-51   Jatropha curcas
ref|XP_008802683.1|  PREDICTED: photosystem I reaction center sub...    173   1e-51   Phoenix dactylifera
ref|XP_006444053.1|  hypothetical protein CICLE_v10022248mg             173   1e-51   Citrus clementina [clementine]
gb|KHN02708.1|  Photosystem I reaction center subunit II, chlorop...    174   2e-51   Glycine soja [wild soybean]
ref|XP_007034724.1|  Photosystem I subunit D-2                          173   2e-51   Theobroma cacao [chocolate]
gb|EYU45647.1|  hypothetical protein MIMGU_mgv1a013850mg                173   2e-51   Erythranthe guttata [common monkey flower]
gb|ACG25364.1|  photosystem I reaction center subunit II                173   2e-51   Zea mays [maize]
pdb|2O01|D  Chain D, The Structure Of A Plant Photosystem I Super...    171   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610706.1|  Photosystem I reaction center subunit II           173   2e-51   Medicago truncatula
emb|CAL25356.1|  photosystem I reaction center subunit II               170   2e-51   Platanus x hispanica [London plane tree]
ref|NP_001130880.1|  photosystem I reaction center subunit II           172   3e-51   Zea mays [maize]
ref|XP_003592408.1|  Photosystem I reaction center subunit II           172   3e-51   
ref|XP_010935005.1|  PREDICTED: photosystem I reaction center sub...    172   3e-51   Elaeis guineensis
gb|ACF86694.1|  unknown                                                 168   4e-51   Zea mays [maize]
ref|XP_002281825.1|  PREDICTED: photosystem I reaction center sub...    171   9e-51   Vitis vinifera
sp|P36213.1|PSAD_HORVU  RecName: Full=Photosystem I reaction cent...    171   9e-51   Hordeum vulgare [barley]
emb|CAB52677.1|  photosystem I subunit II precursor                     171   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14162.1|  Photosystem I reaction center subunit II, chlorop...    167   1e-50   
emb|CAN61448.1|  hypothetical protein VITISV_024141                     170   2e-50   Vitis vinifera
gb|ACG41754.1|  photosystem I reaction center subunit II                170   2e-50   Zea mays [maize]
gb|EMS56878.1|  Photosystem I reaction center subunit II, chlorop...    168   3e-50   Triticum urartu
ref|XP_003564108.1|  PREDICTED: photosystem I reaction center sub...    169   4e-50   Brachypodium distachyon [annual false brome]
ref|XP_010456951.1|  PREDICTED: photosystem I reaction center sub...    169   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010424650.1|  PREDICTED: photosystem I reaction center sub...    169   4e-50   Camelina sativa [gold-of-pleasure]
gb|ACN40159.1|  unknown                                                 167   1e-49   Picea sitchensis
ref|XP_010497891.1|  PREDICTED: photosystem I reaction center sub...    164   3e-49   
gb|ABK21314.1|  unknown                                                 167   7e-49   Picea sitchensis
ref|XP_010424649.1|  PREDICTED: photosystem I reaction center sub...    166   2e-48   
pdb|4RKU|D  Chain D, Crystal Structure Of Plant Photosystem I At ...    162   5e-48   Pisum sativum [garden pea]
ref|XP_002991814.1|  hypothetical protein SELMODRAFT_26984              161   2e-47   
gb|ABK21867.1|  unknown                                                 163   2e-47   Picea sitchensis
gb|AAB51150.1|  subunit II of photosystem I                             155   1e-45   Picea abies
ref|XP_002992973.1|  hypothetical protein SELMODRAFT_448960             167   3e-45   
ref|XP_010474917.1|  PREDICTED: photosystem I reaction center sub...    158   4e-45   
gb|KJB28316.1|  hypothetical protein B456_005G042000                    155   3e-44   Gossypium raimondii
gb|ACF05876.1|  chloroplast photosystem I protein                       153   5e-44   Populus tremula [European aspen]
gb|ACF05868.1|  chloroplast photosystem I protein                       153   5e-44   Populus tremula [European aspen]
ref|XP_001751403.1|  predicted protein                                  152   5e-44   
gb|ACF05859.1|  chloroplast photosystem I protein                       152   5e-44   Populus tremula [European aspen]
gb|ACF05855.1|  chloroplast photosystem I protein                       152   5e-44   Populus tremula [European aspen]
gb|ACF05871.1|  chloroplast photosystem I protein                       152   5e-44   Populus tremula [European aspen]
gb|ACF05884.1|  chloroplast photosystem I protein                       152   5e-44   Populus tremula [European aspen]
ref|XP_001768962.1|  predicted protein                                  152   6e-44   
ref|XP_001765579.1|  predicted protein                                  152   9e-44   
ref|XP_001752431.1|  predicted protein                                  152   3e-43   
gb|KDO68707.1|  hypothetical protein CISIN_1g047658mg                   152   5e-43   Citrus sinensis [apfelsine]
ref|XP_005647040.1|  PSI-D1 precursor                                   141   4e-39   Coccomyxa subellipsoidea C-169
ref|YP_005088653.1|  photosystem I subunit II                           138   1e-38   Phaeocystis antarctica
ref|YP_008145427.1|  photosystem I subunit II                           137   2e-38   Phaeocystis globosa
ref|XP_007511428.1|  predicted protein                                  137   1e-37   Bathycoccus prasinos
ref|XP_002953316.1|  hypothetical protein VOLCADRAFT_121148             135   3e-37   Volvox carteri f. nagariensis
gb|KIZ01091.1|  Photosystem I reaction center subunit II, chlorop...    135   4e-37   Monoraphidium neglectum
gb|AFC39948.1|  photosystem I subunit II                                134   5e-37   Porphyra umbilicalis
ref|XP_005847397.1|  hypothetical protein CHLNCDRAFT_35549              135   7e-37   Chlorella variabilis
ref|YP_007947808.1|  photosystem I subunit II                           133   8e-37   Pyropia haitanensis
gb|AIA20054.1|  photosystem I subunit II                                133   8e-37   Pyropia perforata
gb|KIZ02718.1|  Photosystem I reaction center subunit II, chlorop...    134   8e-37   Monoraphidium neglectum
ref|NP_053889.1|  photosystem I subunit II                              133   9e-37   Porphyra purpurea
ref|YP_009027562.1|  photosystem I subunit II                           133   1e-36   Pyropia perforata
ref|YP_008965721.1|  photosystem I reaction center subunit II           133   1e-36   Porphyridium purpureum
gb|AIA21307.1|  photosystem I subunit II                                132   4e-36   Pyropia kanakaensis
ref|WP_008312724.1|  PsaD                                               132   4e-36   Leptolyngbya sp. PCC 6406
ref|XP_011400522.1|  Photosystem I reaction center subunit II, ch...    133   6e-36   Auxenochlorella protothecoides
ref|XP_001697722.1|  photosystem I reaction center subunit II, 20...    132   6e-36   Chlamydomonas reinhardtii
gb|AIA21513.1|  photosystem I subunit II                                131   8e-36   Pyropia fucicola
gb|AHY04349.1|  photosystem I reaction center subunit II                130   1e-35   Chrysochromulina sp. CCMP291
ref|YP_536961.1|  photosystem I subunit II                              130   2e-35   Pyropia yezoensis
ref|YP_008144865.1|  photosystem I reaction center subunit II           130   2e-35   Grateloupia taiwanensis
gb|AJO68451.1|  photosystem I subunit II                                130   2e-35   Gracilariopsis lemaneiformis
ref|YP_007627400.1|  photosystem I subunit II                           129   3e-35   Chondrus crispus [carageen]
emb|CEG01861.1|  Photosystem I PsaD                                     130   3e-35   Ostreococcus tauri
ref|XP_002504652.1|  photosystem I subunit II, chloroplast precursor    130   1e-34   Micromonas commoda
gb|KEI67811.1|  PsaD                                                    126   2e-34   Planktothrix agardhii NIVA-CYA 126/8
ref|YP_009051089.1|  photosystem I subunit II                           127   2e-34   Galdieria sulphuraria
ref|XP_001421350.1|  psaD, PSI-D, subunit II, photosystem I protein     129   2e-34   Ostreococcus lucimarinus CCE9901
ref|XP_003063552.1|  photosystem I subunit II, chloroplast precursor    129   2e-34   Micromonas pusilla CCMP1545
ref|WP_015145740.1|  PsaD                                               127   2e-34   Pleurocapsales
ref|NP_050759.1|  photosystem I subunit II                              127   3e-34   Guillardia theta
ref|WP_026795097.1|  MULTISPECIES: Photosystem I reaction center ...    127   3e-34   Planktothrix
ref|WP_009769007.1|  PsaD protein                                       127   3e-34   Oscillatoriales cyanobacterium JSC-12
ref|YP_001936347.1|  photosystem I subunit II                           127   3e-34   Heterosigma akashiwo
ref|WP_039725494.1|  MULTISPECIES: Photosystem I reaction center ...    126   6e-34   Lyngbya confervoides
ref|YP_277398.1|  photosystem I subunit II                              126   7e-34   Emiliania huxleyi
ref|YP_001293570.1|  photosystem I subunit II                           125   8e-34   Rhodomonas salina
ref|YP_063618.1|  photosystem I subunit II                              125   8e-34   Gracilaria tenuistipitata var. liui
ref|YP_009019626.1|  photosystem I reaction center subunit II           125   8e-34   Gracilaria salicornia
ref|WP_035996822.1|  Photosystem I reaction center subunit II           125   8e-34   [Leptolyngbya] sp. JSC-1
ref|WP_018400163.1|  Photosystem I reaction center subunit II           125   2e-33   filamentous cyanobacterium ESFC-1
ref|WP_010871317.1|  photosystem I subunit II                           124   2e-33   Synechocystis
sp|Q9T4W8.1|PSAD_CYAPA  RecName: Full=Photosystem I reaction cent...    126   4e-33   Cyanophora paradoxa
ref|WP_026788324.1|  MULTISPECIES: Photosystem I reaction center ...    124   4e-33   Planktothrix
gb|AJH65942.1|  photosystem I reaction center subunit II                124   4e-33   Vertebrata lanosa
ref|YP_003734986.1|  photosystem I protein subunit II                   124   5e-33   Durinskia baltica
ref|WP_017304392.1|  Photosystem I reaction center subunit II           124   5e-33   Spirulina subsalsa
ref|WP_015173693.1|  photosystem I protein PsaD                         124   6e-33   Geitlerinema sp. PCC 7407
ref|WP_017292752.1|  Photosystem I reaction center subunit II           124   6e-33   Geminocystis herdmanii
ref|YP_003734548.1|  ferredoxin-binding protein II                      123   6e-33   Kryptoperidinium foliaceum
ref|WP_028947468.1|  Photosystem I reaction center subunit II           123   9e-33   Synechocystis sp. PCC 6714
ref|WP_016924991.1|  Photosystem I reaction center subunit II           122   1e-32   Prochlorothrix hollandica
ref|WP_015222401.1|  photosystem I protein PsaD                         122   1e-32   
ref|WP_015221061.1|  photosystem I protein PsaD                         122   1e-32   Cyanobacterium aponinum
ref|YP_003002181.1|  photosystem I reaction center subunit II           122   1e-32   Aureoumbra lagunensis
ref|WP_006616635.1|  MULTISPECIES: photosystem I protein PsaD           122   1e-32   Arthrospira
ref|YP_009029026.1|  photosystem I reaction center subunit II           122   1e-32   Cylindrotheca closterium
ref|YP_004376584.1|  photosystem I ferredoxin-binding protein           122   2e-32   Fistulifera solaris
ref|YP_009092872.1|  photosystem I subunit II                           122   2e-32   Chaetoceros simplex
ref|YP_009093339.1|  photosystem I subunit II                           122   2e-32   Cerataulina daemon
ref|YP_009028878.1|  photosystem I reaction center subunit II           122   3e-32   Coscinodiscus radiatus
ref|YP_005089671.1|  psaD gene product                                  122   3e-32   Ulnaria acus
gb|KCW60797.1|  hypothetical protein EUGRSUZ_H03534                     123   3e-32   Eucalyptus grandis [rose gum]
ref|WP_013323038.1|  photosystem I protein PsaD                         122   3e-32   Cyanothece sp. PCC 7822
ref|WP_019505782.1|  Photosystem I reaction center subunit II           121   4e-32   Pleurocapsa sp. PCC 7319
ref|YP_009059209.1|  photosystem I reaction center subunit II           121   5e-32   Eunotia naegelii
ref|WP_006910658.1|  photosystem I reaction center subunit II           121   5e-32   Cyanobium sp. PCC 7001
ref|WP_006530712.1|  PsaD                                               121   5e-32   Gloeocapsa sp. PCC 73106
ref|YP_002327575.1|  PSI reaction center subunit II                     121   5e-32   Vaucheria litorea
ref|YP_874394.1|  photosystem I ferredoxin-binding protein              121   6e-32   Phaeodactylum tricornutum
ref|WP_026032399.1|  Photosystem I reaction center subunit II           121   6e-32   
ref|YP_009093018.1|  photosystem I subunit II                           120   6e-32   Rhizosolenia imbricata
ref|WP_036530202.1|  Photosystem I reaction center subunit II           120   6e-32   Neosynechococcus sphagnicola
ref|NP_043647.1|  photosystem I subunit II                              120   7e-32   Trieres chinensis
ref|YP_007878240.1|  photosystem I subunit II                           120   8e-32   Calliarthron tuberculosum
ref|WP_038547798.1|  Photosystem I reaction center subunit II           120   8e-32   Synechococcus sp. KORDI-100
ref|WP_028953660.1|  Photosystem I reaction center subunit II           120   8e-32   Synechococcus sp. CC9616
ref|WP_023068767.1|  photosystem I reaction center subunit II           120   1e-31   Lyngbya aestuarii
ref|WP_032521962.1|  Photosystem I reaction center subunit II           120   1e-31   Prochlorococcus marinus
ref|WP_011377212.1|  photosystem I protein PsaD                         120   1e-31   Prochlorococcus marinus
ref|YP_009029191.1|  photosystem I reaction center subunit II           120   1e-31   Didymosphenia geminata
ref|WP_009787700.1|  photosystem I subunit II                           120   1e-31   Lyngbya sp. PCC 8106
ref|WP_019477882.1|  MULTISPECIES: Photosystem I reaction center ...    120   1e-31   
gb|AII42441.1|  Photosystem I reaction center subunit II                120   2e-31   Synechococcus sp. KORDI-100
ref|WP_008189408.1|  PsaD                                               119   2e-31   Moorea producens
ref|YP_009029445.1|  photosystem I reaction center subunit II           119   2e-31   Lithodesmium undulatum
ref|YP_009028619.1|  photosystem I reaction center subunit II           119   2e-31   Asterionella formosa
ref|WP_028824843.1|  Photosystem I reaction center subunit II           119   2e-31   
ref|WP_019474331.1|  MULTISPECIES: Photosystem I reaction center ...    119   2e-31   
ref|WP_025900916.1|  Photosystem I reaction center subunit II           118   2e-31   
ref|WP_025954911.1|  Photosystem I reaction center subunit II           119   3e-31   
gb|EDX77926.1|  photosystem I reaction center subunit II                119   3e-31   Coleofasciculus chthonoplastes PCC 7420
ref|WP_041622790.1|  Photosystem I reaction center subunit II           119   3e-31   Oscillatoria nigro-viridis
ref|WP_044204978.1|  Photosystem I reaction center subunit II           119   3e-31   Coleofasciculus chthonoplastes
ref|WP_015124443.1|  PsaD                                               119   3e-31   Synechococcus sp. PCC 6312
sp|O96800.1|PSAD_SKECO  RecName: Full=Photosystem I reaction cent...    119   3e-31   Skeletonema costatum
ref|WP_007305646.1|  Photosystem I protein PsaD                         119   3e-31   Crocosphaera watsonii
gb|AFR24825.1|  photosystem I reaction center subunit II                119   3e-31   uncultured Pelagomonas
ref|WP_025927078.1|  Photosystem I reaction center subunit II           119   3e-31   
ref|WP_011863680.1|  MULTISPECIES: photosystem I protein PsaD           119   3e-31   Prochlorococcus
ref|NP_849051.1|  photosystem I subunit II                              119   3e-31   Cyanidioschyzon merolae strain 10D
gb|ABE11137.1|  photosystem I protein PsaD                              119   3e-31   uncultured Prochlorococcus marinus clone HF10-11H11
ref|YP_874547.1|  photosystem I ferredoxin-binding protein              119   3e-31   Thalassiosira pseudonana
ref|WP_025915179.1|  Photosystem I reaction center subunit II           119   4e-31   
ref|YP_003002042.1|  photosystem I reaction center subunit II           119   4e-31   Aureococcus anophagefferens
ref|WP_025956224.1|  Photosystem I reaction center subunit II           119   4e-31   
ref|WP_025889562.1|  MULTISPECIES: Photosystem I reaction center ...    119   4e-31   Prochlorococcus sp. HOT208_60m_810B23
gb|AFZ10051.1|  photosystem I protein PsaD                              119   4e-31   Oscillatoria nigro-viridis PCC 7112
ref|WP_032513725.1|  Photosystem I reaction center subunit II           119   4e-31   Prochlorococcus marinus
ref|WP_025937671.1|  MULTISPECIES: Photosystem I reaction center ...    119   5e-31   Prochlorococcus
ref|WP_017288063.1|  Photosystem I reaction center subunit II           118   6e-31   Leptolyngbya boryana
ref|YP_009093464.1|  photosystem I subunit II                           118   6e-31   Conticribra weissflogii
ref|WP_012593753.1|  MULTISPECIES: photosystem I protein PsaD           118   6e-31   Cyanothece
ref|WP_032526300.1|  Photosystem I reaction center subunit II           118   7e-31   Prochlorococcus marinus
ref|WP_032517906.1|  Photosystem I reaction center subunit II           118   7e-31   Prochlorococcus marinus
ref|WP_010314860.1|  photosystem I protein PsaD                         118   7e-31   Synechococcus sp. CB0205
ref|WP_042851104.1|  Photosystem I reaction center subunit II           118   7e-31   Prochlorococcus sp. MIT 0604
ref|WP_006042180.1|  photosystem I reaction center subunit II (PsaD)    118   7e-31   Synechococcus sp. WH 7805
ref|YP_009093191.1|  photosystem I subunit II                           118   8e-31   Roundia cardiophora
ref|WP_011819190.1|  photosystem I protein PsaD                         118   9e-31   Prochlorococcus marinus
ref|WP_017715328.1|  Photosystem I reaction center subunit II           118   1e-30   Oscillatoria sp. PCC 10802
ref|WP_010311728.1|  photosystem I protein PsaD                         117   1e-30   Synechococcus sp. CB0101
ref|WP_002738785.1|  photosystem I reaction center subunit II           117   1e-30   Microcystis aeruginosa
ref|WP_025930967.1|  Photosystem I reaction center subunit II           117   1e-30   
ref|WP_025928909.1|  Photosystem I reaction center subunit II           117   1e-30   
ref|WP_006173380.1|  photosystem I reaction center subunit II (PsaD)    117   1e-30   Synechococcus sp. WH 5701
ref|WP_038000832.1|  Photosystem I reaction center subunit II           117   1e-30   Synechococcus sp. RS9917
ref|YP_009029302.1|  photosystem I reaction center subunit II           117   1e-30   Leptocylindrus danicus
gb|EAQ68518.1|  photosystem I reaction center subunit II (PsaD)         117   1e-30   Synechococcus sp. RS9917
ref|YP_002049251.1|  Photosystem I reaction center subunit II (PsaD)    117   1e-30   Paulinella chromatophora
dbj|GAL93034.1|  photosystem I subunit II (PsaD)                        117   1e-30   Microcystis aeruginosa NIES-44
ref|WP_002796771.1|  Photosystem I reaction center subunit II           117   1e-30   Microcystis
ref|WP_025943071.1|  Photosystem I reaction center subunit II           117   2e-30   
ref|WP_006509381.1|  PsaD                                               117   2e-30   Xenococcus sp. PCC 7305
ref|WP_007099913.1|  photosystem I reaction center subunit II (PsaD)    117   2e-30   Synechococcus sp. RS9916
gb|AIR75448.1|  photosystem I subunit II                                117   2e-30   Cyclotella sp. L04_2
ref|WP_011377824.1|  MULTISPECIES: photosystem I reaction center ...    117   2e-30   Synechococcus
ref|WP_017662216.1|  Photosystem I reaction center subunit II           117   2e-30   Geitlerinema sp. PCC 7105
ref|WP_036900706.1|  Photosystem I reaction center subunit II           116   3e-30   Prochlorococcus sp. MIT 0601
ref|WP_009544162.1|  MULTISPECIES: photosystem I protein PsaD           116   3e-30   Cyanothece
ref|WP_007356552.1|  MULTISPECIES: photosystem I protein PsaD           116   3e-30   Kamptonema
ref|WP_015195039.1|  photosystem I protein PsaD                         116   4e-30   Stanieria cyanosphaera
ref|WP_017300022.1|  Photosystem I reaction center subunit II           116   4e-30   Nodosilinea nodulosa
ref|WP_011932371.1|  photosystem I reaction center subunit II           116   4e-30   Synechococcus sp. WH 7803
ref|WP_015231048.1|  PsaD                                               116   4e-30   Dactylococcopsis salina
ref|NP_045207.1|  photosystem I subunit II                              116   4e-30   Cyanidium caldarium
ref|WP_011613167.1|  photosystem I protein PsaD                         116   4e-30   Trichodesmium erythraeum
gb|AIA61184.1|  photosystem I subunit II (chloroplast)                  116   4e-30   Cyanidiaceae sp. MX-AZ01
gb|ACB50691.1|  photosystem I reaction center subunit II                116   5e-30   Cyanothece sp. ATCC 51142
ref|WP_002740397.1|  MULTISPECIES: photosystem I reaction center ...    116   5e-30   Microcystis
ref|WP_025943458.1|  Photosystem I reaction center subunit II           115   6e-30   
ref|WP_002807018.1|  MULTISPECIES: photosystem I reaction center ...    115   7e-30   
ref|WP_025934063.1|  Photosystem I reaction center subunit II           115   8e-30   
ref|WP_025781322.1|  Photosystem I reaction center subunit II           115   9e-30   
ref|WP_011133206.1|  photosystem I protein PsaD                         115   9e-30   
ref|WP_011821058.1|  photosystem I protein PsaD                         115   9e-30   
ref|WP_035831507.1|  Photosystem I reaction center subunit II           115   1e-29   
ref|WP_015224168.1|  photosystem I protein PsaD                         115   1e-29   
ref|YP_004072560.1|  photosystem I reaction center subunit II           115   1e-29   
ref|WP_015956499.1|  photosystem I protein PsaD                         115   1e-29   
ref|WP_043694980.1|  Photosystem I reaction center subunit II           115   1e-29   
ref|YP_009028747.1|  photosystem I reaction center subunit II           115   1e-29   
ref|WP_017309650.1|  Photosystem I reaction center subunit II           115   2e-29   
ref|WP_012629607.1|  photosystem I protein PsaD                         114   2e-29   
ref|WP_006632802.1|  photosystem I protein PsaD                         114   2e-29   
gb|AHF62815.1|  photosystem I reaction center subunit II (PsaD)         114   2e-29   
ref|WP_011363412.1|  MULTISPECIES: photosystem I reaction center ...    114   2e-29   
ref|WP_026721381.1|  Photosystem I reaction center subunit II           114   3e-29   
ref|WP_025935474.1|  Photosystem I reaction center subunit II           114   3e-29   
ref|WP_016872271.1|  MULTISPECIES: Photosystem I reaction center ...    114   3e-29   
ref|WP_015109263.1|  PsaD                                               114   3e-29   
ref|WP_011618423.1|  photosystem I reaction center subunit II           114   3e-29   
ref|WP_025939988.1|  MULTISPECIES: Photosystem I reaction center ...    112   4e-29   
ref|WP_009788961.1|  photosystem I reaction center subunit II (PsaD)    114   4e-29   
gb|EHC11738.1|  photosystem I protein PsaD                              114   4e-29   
ref|WP_011360689.1|  photosystem I reaction center subunit II (PsaD)    114   4e-29   
ref|WP_012196249.1|  photosystem I protein PsaD                         113   5e-29   
ref|WP_041225999.1|  Photosystem I reaction center subunit II           113   6e-29   
ref|WP_024124772.1|  photosystem I subunit II PsaD                      113   8e-29   
ref|WP_036477609.1|  Photosystem I reaction center subunit II           113   8e-29   
gb|AFZ12711.1|  photosystem I protein PsaD                              113   8e-29   
gb|EDX84590.1|  photosystem I reaction center subunit II                113   9e-29   
ref|WP_038016768.1|  Photosystem I reaction center subunit II           112   1e-28   
ref|WP_015164131.1|  photosystem I protein PsaD                         112   1e-28   
ref|WP_041430107.1|  Photosystem I reaction center subunit II           112   1e-28   
gb|AFY74121.1|  PsaD                                                    113   1e-28   
ref|WP_008272575.1|  photosystem I subunit II                           112   1e-28   
ref|WP_011128902.1|  photosystem I reaction center subunit II (PsaD)    112   2e-28   
ref|WP_019502597.1|  hypothetical protein                               112   2e-28   
ref|WP_036919402.1|  MULTISPECIES: Photosystem I reaction center ...    112   2e-28   
ref|WP_011936501.1|  photosystem I reaction center subunit II           112   2e-28   
ref|WP_016876091.1|  Photosystem I reaction center subunit II           112   2e-28   
ref|WP_026733629.1|  Photosystem I reaction center subunit II           112   2e-28   
ref|WP_023071664.1|  photosystem i protein                              112   2e-28   
sp|P23076.3|PSAD_SYNP6  RecName: Full=Photosystem I reaction cent...    111   3e-28   
ref|WP_016866973.1|  Photosystem I reaction center subunit II           111   3e-28   
ref|WP_022606580.1|  PsaD                                               111   4e-28   
ref|WP_015182846.1|  PsaD                                               111   4e-28   
pdb|1JB0|D  Chain D, Crystal Structure Of Photosystem I: A Photos...    111   4e-28   
ref|WP_011131077.1|  photosystem I protein PsaD                         111   4e-28   
ref|WP_009626149.1|  photosystem I protein PsaD                         111   5e-28   
ref|WP_015151596.1|  PsaD                                               111   5e-28   
ref|WP_011057561.1|  photosystem I subunit II                           110   5e-28   
ref|WP_010468189.1|  photosystem I protein PsaD                         110   5e-28   
ref|WP_012165369.1|  photosystem I protein PsaD                         110   6e-28   
ref|WP_041918842.1|  Photosystem I reaction center subunit II           110   6e-28   
ref|WP_035986603.1|  Photosystem I reaction center subunit II           110   7e-28   
ref|WP_036911259.1|  MULTISPECIES: Photosystem I reaction center ...    110   7e-28   
ref|WP_011826874.1|  photosystem I protein PsaD                         110   8e-28   
gb|AFZ29137.1|  photosystem I protein PsaD                              111   8e-28   
ref|WP_016859046.1|  Photosystem I reaction center subunit II           110   1e-27   
ref|WP_011125882.1|  MULTISPECIES: photosystem I protein PsaD           109   2e-27   
ref|WP_017321535.1|  Photosystem I reaction center subunit II           109   2e-27   
prf||1510177A  photosystem II                                           109   2e-27
ref|WP_040933357.1|  Photosystem I reaction center subunit II           109   2e-27   
ref|YP_007476277.1|  photosystem I reaction center subunit II (fe...    109   2e-27   
ref|WP_040944569.1|  Photosystem I reaction center subunit II           109   2e-27   
ref|WP_041039117.1|  Photosystem I reaction center subunit II           108   3e-27   
ref|WP_015157762.1|  PsaD                                               108   3e-27   
ref|WP_011433827.1|  photosystem I reaction center subunit II           108   4e-27   
ref|WP_010994505.1|  photosystem I reaction center subunit II           108   4e-27   
ref|WP_017317314.1|  Photosystem I reaction center subunit II           108   5e-27   
gb|KIE10409.1|  Photosystem I reaction center subunit II                108   5e-27   
ref|WP_039754673.1|  Photosystem I reaction center subunit II           108   6e-27   
ref|WP_038014855.1|  Photosystem I reaction center subunit II           107   9e-27   
ref|WP_027844942.1|  Photosystem I reaction center subunit II           107   1e-26   
ref|WP_040938870.1|  Photosystem I reaction center subunit II           107   2e-26   
ref|WP_017744641.1|  Photosystem I reaction center subunit II           106   2e-26   
ref|WP_011321384.1|  photosystem I protein PsaD                         106   2e-26   
sp|P56596.1|PSAD_NOSS8  RecName: Full=Photosystem I reaction cent...    104   1e-25   
gb|AAD38699.1|AF148503_2  photosystem I accessory protein D             104   1e-25   
ref|WP_024544608.1|  Photosystem I reaction center subunit II           104   1e-25   
ref|WP_006516877.1|  PsaD protein                                       103   3e-25   
ref|YP_003289238.1|  Photosystem I reaction center subunit II           103   3e-25   
ref|WP_015112247.1|  photosystem I protein PsaD                         103   4e-25   
ref|YP_006639027.1|  photosystem I ferredoxin-binding protein           102   6e-25   
ref|YP_005090043.1|  psaD gene product                                  102   7e-25   
gb|KIJ85471.1|  Photosystem I reaction center subunit II                102   7e-25   
ref|WP_015156676.1|  MULTISPECIES: photosystem I protein PsaD           102   8e-25   
ref|WP_015136451.1|  PsaD                                               102   1e-24   
ref|WP_012306311.1|  MULTISPECIES: photosystem I subunit II             102   2e-24   
ref|WP_006198574.1|  photosystem I reaction center subunit II           101   2e-24   
ref|WP_009633578.1|  PsaD                                               100   6e-24   
ref|WP_029637180.1|  Photosystem I reaction center subunit II [         100   6e-24   
ref|WP_044290906.1|  Photosystem I reaction center subunit II           100   8e-24   
gb|AFY55101.1|  PsaD                                                    100   1e-23   
ref|WP_013192195.1|  photosystem I protein PsaD                       99.4    1e-23   
ref|WP_019493410.1|  Photosystem I reaction center subunit II         99.0    2e-23   
ref|WP_015208523.1|  PsaD                                             99.0    2e-23   
sp|P23808.1|PSAD_MICDP  RecName: Full=Photosystem I reaction cent...  97.8    6e-23   
ref|WP_037220235.1|  Photosystem I reaction center subunit II         97.4    7e-23   
emb|CDN13363.1|  photosystem I subunit II (PsaD)                      97.1    8e-23   
ref|WP_015215982.1|  photosystem I protein PsaD                       97.4    9e-23   
ref|WP_016953057.1|  Photosystem I reaction center subunit II         97.1    1e-22   
ref|WP_017651861.1|  Photosystem I reaction center subunit II         96.7    2e-22   
gb|ABC98753.1|  photosystem I reaction center subunit II              96.3    2e-22   
ref|WP_041438839.1|  Photosystem I reaction center subunit II         96.3    2e-22   
ref|WP_035155503.1|  Photosystem I reaction center subunit II         96.3    3e-22   
ref|WP_015134252.1|  photosystem I protein PsaD                       95.9    3e-22   
ref|WP_006275750.1|  MULTISPECIES: Photosystem I protein PsaD         95.5    4e-22   
ref|WP_015127985.1|  photosystem I protein PsaD                       95.1    5e-22   
ref|WP_017327440.1|  hypothetical protein                             95.1    6e-22   
ref|WP_028083790.1|  Photosystem I reaction center subunit II         94.4    1e-21   
ref|WP_028090681.1|  Photosystem I reaction center subunit II         94.0    2e-21   
ref|YP_003795447.1|  photosystem I subunit II                         92.8    3e-21   
gb|AGI04047.1|  photosystem I subunit II                              92.4    3e-21   
gb|ABQ52922.1|  photosystem I reaction center subunit II              91.3    4e-21   
gb|ABQ52911.1|  photosystem I reaction center subunit II              91.3    4e-21   
gb|ABQ52912.1|  photosystem I reaction center subunit II              91.3    4e-21   
gb|ABQ52930.1|  photosystem I reaction center subunit II              91.3    4e-21   
gb|ABQ52913.1|  photosystem I reaction center subunit II              90.9    5e-21   
ref|WP_015079642.1|  MULTISPECIES: photosystem I protein PsaD         92.4    6e-21   
gb|ABQ52919.1|  photosystem I reaction center subunit II              90.5    7e-21   
gb|ABQ52926.1|  photosystem I reaction center subunit II              90.5    8e-21   
ref|WP_012411433.1|  photosystem I protein PsaD                       92.0    1e-20   
gb|ABQ52927.1|  photosystem I reaction center subunit II              89.7    1e-20   
ref|WP_011143690.1|  photosystem I reaction centre subunit II         91.7    2e-20   
ref|WP_040054753.1|  Photosystem I reaction center subunit II         91.3    2e-20   
ref|WP_023171757.1|  photosystem I protein PsaD                       90.9    3e-20   
gb|ABQ52910.1|  photosystem I reaction center subunit II              89.0    3e-20   
ref|WP_011295494.1|  photosystem I protein PsaD                       90.5    3e-20   
gb|ABQ52932.1|  photosystem I reaction center subunit II              88.6    4e-20   
ref|WP_038654413.1|  Photosystem I reaction center subunit II         90.5    4e-20   
gb|ABQ52924.1|  photosystem I reaction center subunit II              88.2    6e-20   
gb|ABQ52929.1|  photosystem I reaction center subunit II              88.2    6e-20   
gb|ABQ52931.1|  photosystem I reaction center subunit II              88.2    6e-20   
ref|YP_007317065.1|  photosystem I reaction center subunit II         89.0    1e-19   
ref|YP_008519723.1|  photosystem I reaction center subunit II         89.0    1e-19   
ref|WP_012953669.1|  photosystem I reaction center subunit II PsaD    88.6    2e-19   
ref|WP_015196995.1|  photosystem I protein PsaD                       87.8    3e-19   
ref|YP_008519970.1|  photosystem I reaction center subunit II         87.0    8e-19   
ref|YP_008520096.1|  photosystem I reaction center subunit II         87.0    8e-19   
ref|WP_008235951.1|  photosystem I subunit II (PsaD)                  85.5    3e-18   
ref|WP_008224714.1|  photosystem I subunit II (PsaD)                  85.1    4e-18   
ref|WP_025921633.1|  hypothetical protein                             83.2    4e-18   
gb|ACF24542.1|  photosystem I reaction center subunit II              82.0    3e-16   
ref|WP_029980174.1|  Photosystem I reaction center subunit II         77.4    5e-16   
gb|AAP79147.1|  photosystem I protein PsaD                            81.3    6e-16   
gb|ACO90365.1|  PsaD                                                  69.3    3e-12   
ref|XP_003083423.1|  Photosystem I subunit II, chloroplast precur...  65.1    2e-10   
gb|ACG50087.1|  PsaD                                                  63.5    4e-10   
pir||PL0034  photosystem I chain II - Synechococcus sp. (PCC 6301...  62.4    5e-10
emb|CDY22079.1|  BnaA09g01080D                                        60.5    6e-09   
emb|CBI26230.3|  unnamed protein product                              53.1    2e-06   
gb|ACT34029.1|  PsaD                                                  49.3    3e-05   



>ref|XP_009111256.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Brassica rapa]
Length=208

 Score =   182 bits (462),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK NA
Sbjct  118  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANA  177

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  178  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  208



>ref|XP_004134141.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Cucumis sativus]
 sp|P32869.1|PSAD_CUCSA RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=PS I subunit 5; AltName: Full=Photosystem 
I 20 kDa subunit; Short=PSI-D; Flags: Precursor [Cucumis 
sativus]
 gb|KGN56995.1| hypothetical protein Csa_3G147780 [Cucumis sativus]
 prf||1710320A photosystem I 20kD protein
Length=207

 Score =   181 bits (460),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  177  GREGVGQNFRSIGKNVSPIEVKFTGKQVYDL  207



>ref|XP_006306434.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
 gb|EOA39332.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
Length=206

 Score =   181 bits (460),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  116  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANP  175

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  176  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  206



>ref|XP_009396832.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=259

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  169  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  228

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQNMRSIGKN+SPI VKFTGKQVYDL
Sbjct  229  GRQGVGQNMRSIGKNVSPIEVKFTGKQVYDL  259



>emb|CDY21916.1| BnaC09g00220D [Brassica napus]
Length=281

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK NA
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANA  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  180  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  210



>ref|XP_006288687.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
 gb|EOA21585.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
Length=202

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  112  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANP  171

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  172  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  202



>ref|XP_008438687.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Cucumis melo]
Length=207

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  177  GREGVGQNFRSIGKNVSPIEVKFTGKQVYDL  207



>ref|XP_009795521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana sylvestris]
 sp|P29302.1|PSAD_NICSY RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Nicotiana sylvestris]
 emb|CAA42623.1| PSI-D2 [Nicotiana sylvestris]
Length=204

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREGANLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  114  AIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNA  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYDL
Sbjct  174  GRQGVGQNFRSIGKNKSPIEVKFTGKQVYDL  204



>ref|XP_009621208.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana tomentosiformis]
Length=207

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREGANLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  117  AIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNA  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYDL
Sbjct  177  GRQGVGQNFRSIGKNKSPIEVKFTGKQVYDL  207



>ref|XP_010474926.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Camelina sativa]
Length=207

 Score =   180 bits (456),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  177  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  207



>ref|XP_007050585.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOX94742.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=204

 Score =   179 bits (455),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  114  AIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  174  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  204



>ref|XP_006419899.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 ref|XP_006489366.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Citrus sinensis]
 dbj|BAF80470.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80477.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR33139.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 gb|KDO74646.1| hypothetical protein CISIN_1g028581mg [Citrus sinensis]
Length=207

 Score =   179 bits (455),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  177  GREGVGQNYRSIGKNVSPIEVKFTGKQVYDL  207



>ref|XP_011071575.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=213

 Score =   179 bits (455),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  123  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  182

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR GVGQNMRSIGKN+SPI VKFTGKQVYDL
Sbjct  183  GRTGVGQNMRSIGKNVSPIEVKFTGKQVYDL  213



>ref|XP_010277521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=213

 Score =   179 bits (455),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  123  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  182

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  183  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  213



>ref|XP_008376830.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=212

 Score =   179 bits (455),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  122  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  181

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYD+
Sbjct  182  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI  212



>ref|XP_004296896.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=205

 Score =   179 bits (454),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  115  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  174

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYD+
Sbjct  175  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI  205



>ref|XP_010522735.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Tarenaya hassleriana]
Length=207

 Score =   179 bits (454),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQNMRSIGKN SPI VKFTGKQVYDL
Sbjct  177  GRQGVGQNMRSIGKNASPIEVKFTGKQVYDL  207



>ref|XP_011021547.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=201

 Score =   179 bits (453),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  111  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  170

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  171  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  201



>ref|XP_002516772.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF45386.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=208

 Score =   179 bits (454),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  118  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  177

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  178  GREGVGQNFRSIGKNVSPIEVKFTGKQVYDL  208



>gb|ABK96621.1| unknown [Populus trichocarpa x Populus deltoides]
Length=201

 Score =   179 bits (453),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  111  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  170

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  171  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  201



>ref|XP_009400838.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=207

 Score =   179 bits (454),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQNMRSIGKN+SPI VKFTGKQVYDL
Sbjct  177  GRQGVGQNMRSIGKNVSPIEVKFTGKQVYDL  207



>ref|XP_003556041.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Glycine max]
 gb|KHN15781.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=203

 Score =   179 bits (453),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  113  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  172

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  173  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  203



>ref|XP_009344083.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=210

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYD+
Sbjct  180  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI  210



>ref|XP_010430302.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=213

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  123  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  182

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  183  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  213



>gb|AGV54746.1| photosystem I reaction center subunit II chloroplastic-like protein 
[Phaseolus vulgaris]
Length=207

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  177  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  207



>ref|NP_001062511.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|AAO72568.1| chloroplast photosystem I reaction center subunit II precursor-like 
protein [Oryza sativa Japonica Group]
 dbj|BAD13214.1| putative photosystem I reaction center subunit II, chloroplast 
precursor (Photosystem I 20 kDa subunit) (PSI-D) [Oryza sativa 
Japonica Group]
 dbj|BAF24425.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|EAZ08015.1| hypothetical protein OsI_30281 [Oryza sativa Indica Group]
 gb|EAZ43663.1| hypothetical protein OsJ_28289 [Oryza sativa Japonica Group]
 dbj|BAG88105.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99984.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  113  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  172

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGK V+D+
Sbjct  173  GRQGVGQNFRSIGKNVSPIEVKFTGKNVFDI  203



>ref|NP_001275862.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80475.1| PSI reaction center subunit II [Citrus sinensis]
Length=207

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN+SPI VKFTGKQVYD+
Sbjct  177  GREGVGQNYRSIGKNVSPIEVKFTGKQVYDV  207



>ref|XP_010422538.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Camelina sativa]
Length=210

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  180  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  210



>ref|XP_007143239.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
 gb|ESW15233.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
Length=207

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  177  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  207



>ref|XP_010681150.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=217

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  127  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  186

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  187  GRQGVGQNMRSIGKNVSPIEVKFTGKQAYDL  217



>ref|XP_010542866.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Tarenaya hassleriana]
Length=206

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  116  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANP  175

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  176  GRQGVGQNMRSIGKNVSPIEVKFTGKQPYDL  206



>gb|ABK96248.1| unknown [Populus trichocarpa x Populus deltoides]
Length=166

 Score =   176 bits (447),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  76   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  135

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  136  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  166



>ref|NP_001235355.1| photosystem I subunit PsaD [Glycine max]
 gb|ABQ63097.1| photosystem I subunit PsaD [Glycine max]
 gb|ACU14192.1| unknown [Glycine max]
Length=210

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  180  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  210



>ref|XP_011026306.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  113  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  172

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYDL
Sbjct  173  GRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  203



>gb|AFV94477.1| photosystem I reaction center subunit II [Saccharum hybrid cultivar 
GT28]
Length=200

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  110  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  169

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGK  +D+
Sbjct  170  GRQGVGQNFRSIGKNVSPIEVKFTGKNTFDI  200



>ref|XP_002311618.2| photosystem I 20kD family protein [Populus trichocarpa]
 gb|EEE88985.2| photosystem I 20kD family protein [Populus trichocarpa]
Length=204

 Score =   177 bits (449),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  114  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYDL
Sbjct  174  GRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  204



>ref|XP_002315779.1| photosystem I 20kD family protein [Populus trichocarpa]
 gb|ABK95430.1| unknown [Populus trichocarpa]
 gb|ABK95668.1| unknown [Populus trichocarpa]
 gb|EEF01950.1| photosystem I 20kD family protein [Populus trichocarpa]
Length=201

 Score =   177 bits (449),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  111  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  170

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  171  GRQGVGQNFRSIGKNVSPIEVKFTGKQAYDL  201



>ref|XP_008340966.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=213

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  123  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  182

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN++PI VKFTGKQVYD+
Sbjct  183  GRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  213



>ref|XP_008224535.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Prunus mume]
Length=213

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  123  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  182

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN++PI VKFTGKQVYD+
Sbjct  183  GRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  213



>ref|NP_171812.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
 sp|Q9SA56.1|PSAD2_ARATH RecName: Full=Photosystem I reaction center subunit II-2, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 2; Short=PSI-D2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD25795.1|AC006550_3 Strong similarity to gb|X14017 photosystem I reaction centre 
subunit II precursor (psaD) from Spinacia oleracea. ESTs gb|R30423, 
gb|T42998, gb|Z18178, gb|T14133, gb|N65521, gb|T42498, 
gb|T41918, gb|N38024, gb|R65109, gb|T43849, gb|AA394388, 
gb|T20925 and gb|N65696 come from this gene [Arabidopsis thaliana]
 gb|AAG40059.1|AF324708_1 At1g03130 [Arabidopsis thaliana]
 gb|AAG48776.1|AF332413_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK62620.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AAM63823.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAN38693.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AEE27534.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
Length=204

 Score =   177 bits (448),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  114  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  174  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  204



>ref|XP_009366924.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=213

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  123  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  182

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN++PI VKFTGKQVYD+
Sbjct  183  GRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  213



>gb|KFK42673.1| hypothetical protein AALP_AA1G025000 [Arabis alpina]
Length=204

 Score =   177 bits (448),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  114  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  174  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  204



>ref|XP_010481602.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
[Camelina sativa]
Length=206

 Score =   177 bits (448),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GREGVGQNMRSIGKN+SPI VKFTGKQ YD
Sbjct  177  GREGVGQNMRSIGKNVSPIEVKFTGKQSYD  206



>ref|XP_002892148.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68407.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
Length=205

 Score =   177 bits (448),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  115  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  174

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  175  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  205



>gb|EYU41499.1| hypothetical protein MIMGU_mgv1a013699mg [Erythranthe guttata]
Length=212

 Score =   177 bits (448),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  122  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  181

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR GVG NMRSIGKN SPI VKFTGKQVYDL
Sbjct  182  GRTGVGLNMRSIGKNASPIEVKFTGKQVYDL  212



>ref|XP_009799304.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA02871.1| PSI-D1 precursor [Nicotiana sylvestris]
Length=214

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  124  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNP  183

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYD+
Sbjct  184  GRQGVGQNFRSIGKNKSPIEVKFTGKQVYDI  214



>ref|XP_009588197.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=209

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  119  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYD+
Sbjct  179  GRQGVGQNFRSIGKNKSPIEVKFTGKQVYDI  209



>pdb|3LW5|D Chain D, Improved Model Of Plant Photosystem I
Length=138

 Score =   174 bits (441),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  48   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  107

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  108  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  138



>ref|XP_007226637.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
 gb|EMJ27836.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
Length=192

 Score =   176 bits (446),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            +IMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  102  SIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  161

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN++PI VKFTGKQVYD+
Sbjct  162  GRQGVGQNFRSIGKNVNPIEVKFTGKQVYDI  192



>ref|XP_002520727.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF41689.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=209

 Score =   176 bits (447),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  119  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYD+
Sbjct  179  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI  209



>ref|NP_192186.1| photosystem I subunit D-1 [Arabidopsis thaliana]
 sp|Q9S7H1.1|PSAD1_ARATH RecName: Full=Photosystem I reaction center subunit II-1, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 1; Short=PSI-D1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG40026.1|AF324675_1 AT4g02770 [Arabidopsis thaliana]
 gb|AAG41469.1|AF326887_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK63862.1|AF389290_1 AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAD15351.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 emb|CAB52676.1| photosystem I subunit II precursor [Arabidopsis thaliana]
 emb|CAB77762.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAL32590.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10233.1| unknown protein [Arabidopsis thaliana]
 gb|AAM26726.1| AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAM44987.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AEE82228.1| photosystem I subunit D-1 [Arabidopsis thaliana]
Length=208

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  118  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  177

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  178  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  208



>gb|ABK96014.1| unknown [Populus trichocarpa]
Length=97

 Score =   172 bits (436),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  7    AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  66

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYDL
Sbjct  67   GRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  97



>ref|XP_010256006.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=212

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  122  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  181

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  182  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  212



>gb|KJB46980.1| hypothetical protein B456_008G004100 [Gossypium raimondii]
Length=210

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  120  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  180  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  210



>ref|XP_010035248.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84226.1| hypothetical protein EUGRSUZ_B01088 [Eucalyptus grandis]
Length=214

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  124  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNK  183

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  184  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  214



>gb|KJB23065.1| hypothetical protein B456_004G079200 [Gossypium raimondii]
Length=250

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  160  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  219

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQVYDL
Sbjct  220  GRQGVGQNFRSIGKNVSPIEVKFTGKQVYDL  250



>gb|AAM66066.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
Length=208

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  118  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  177

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  178  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  208



>ref|XP_002872810.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49069.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  116  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  175

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  176  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  206



>ref|XP_010108011.1| Photosystem I reaction center subunit II [Morus notabilis]
 gb|EXC17576.1| Photosystem I reaction center subunit II [Morus notabilis]
Length=215

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  125  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  184

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  185  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  215



>ref|XP_011090732.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=215

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 87/94 (93%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  122  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  181

Query  192  GREGVG---QNMRSIGKNISPIGVKFTGKQVYDL  100
            GR GVG   QNMRSIGKN+SPI VKFTGKQVYDL
Sbjct  182  GRTGVGQNMQNMRSIGKNVSPIEVKFTGKQVYDL  215



>emb|CDO99040.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI+YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  115  AIMRQGPNLLKLARKEQCLALGTRLRSKYKISYQFYRVFPNGEVQYLHPKDGVYPEKVNP  174

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N+RSIGKNISPI VKFTGKQVY+L
Sbjct  175  GRQGVGLNLRSIGKNISPIEVKFTGKQVYEL  205



>gb|KFK30882.1| hypothetical protein AALP_AA6G038200 [Arabis alpina]
Length=207

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  177  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  207



>ref|XP_010474916.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=247

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMRE  NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  157  AIMRERPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  216

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQNMRSIGKN+SPI VKFTGKQ YDL
Sbjct  217  GREGVGQNMRSIGKNVSPIEVKFTGKQSYDL  247



>ref|XP_006356675.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Solanum tuberosum]
 emb|CAD89270.1| putative photosystem I reaction centre PSI-D subunit precursor 
[Solanum tuberosum]
Length=207

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  117  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  176

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN S I VKFTGKQVYD+
Sbjct  177  GREGVGQNFRSIGKNKSAIEVKFTGKQVYDI  207



>gb|EPS62726.1| hypothetical protein M569_12065 [Genlisea aurea]
Length=196

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHP+DGVYPEKVNA
Sbjct  106  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPRDGVYPEKVNA  165

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR GVGQN RSIGKN+SPI VKFTGKQ YD+
Sbjct  166  GRTGVGQNFRSIGKNVSPIEVKFTGKQTYDV  196



>ref|XP_004511355.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Cicer arietinum]
Length=215

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  125  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  184

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN++PI VKFTGKQ YD+
Sbjct  185  GREGVGQNFRSIGKNVNPIEVKFTGKQPYDV  215



>ref|XP_006396500.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
 gb|ESQ37953.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
Length=237

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  147  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANP  206

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  207  GREGVGLNMRSIGKNVSPIEVKFTGKQSYDL  237



>emb|CAA32182.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  122  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNP  181

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  182  GRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  212



>ref|XP_011015859.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   174 bits (442),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKE CLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  113  AIMREGPNLLKLARKELCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  172

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN SPI VKFTGKQVYDL
Sbjct  173  GRQGVGQNFRSIGKNASPIEVKFTGKQVYDL  203



>emb|CAA68728.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  122  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNP  181

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  182  GRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  212



>ref|XP_002278284.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CBI28699.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   174 bits (442),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  114  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  174  GRQGVGQNFRSIGKNVSPIEVKFTGKQAYDL  204



>ref|XP_006838247.1| hypothetical protein AMTR_s00103p00041210 [Amborella trichopoda]
 gb|ERN00816.1| hypothetical protein AMTR_s00103p00041210 [Amborella trichopoda]
Length=202

 Score =   174 bits (441),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  112  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  171

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RS+GKNISPI VKFTGKQVYD+
Sbjct  172  GRQGVGLNFRSVGKNISPIEVKFTGKQVYDV  202



>ref|XP_004241054.2| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Solanum lycopersicum]
 sp|P12372.1|PSAD_SOLLC RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA34185.1| photosystem I subunit II protein precursor [Solanum lycopersicum]
 prf||1601516A photosystem I reaction center II
Length=208

 Score =   174 bits (442),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  118  AIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  177

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREGVGQN RSIGKN S I VKFTGKQVYD+
Sbjct  178  GREGVGQNFRSIGKNKSAIEVKFTGKQVYDI  208



>emb|CAA54744.1| psaD [Spinacia oleracea]
Length=211

 Score =   174 bits (442),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  121  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNP  180

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  181  GRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  211



>ref|NP_001104945.1| photosystem I subunit d1 [Zea mays]
 gb|AAF67002.1|AF147726_1 ferredoxin-binding subunit [Zea mays]
Length=108

 Score =   171 bits (433),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  19   AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNP  78

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GREGVGQN RSIGKN++PI VKFTGK  +D
Sbjct  79   GREGVGQNFRSIGKNVNPIDVKFTGKSTFD  108



>sp|P12353.2|PSAD_SPIOL RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Spinacia oleracea]
Length=212

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  122  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNP  181

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  182  GRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  212



>ref|XP_004981348.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Setaria italica]
Length=275

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  185  AIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  244

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGK  +D+
Sbjct  245  GRQGVGQNFRSIGKNVSPIEVKFTGKNTFDI  275



>pdb|2WSC|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSE|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSF|D Chain D, Improved Model Of Plant Photosystem I
Length=212

 Score =   174 bits (441),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  122  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNP  181

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  182  GRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  212



>gb|AFK43504.1| unknown [Lotus japonicus]
Length=210

 Score =   174 bits (441),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTG+Q YD+
Sbjct  180  GRQGVGQNFRSIGKNVSPIEVKFTGRQPYDV  210



>ref|NP_001275788.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80479.1| PSI reaction center subunit II [Citrus sinensis]
Length=209

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  119  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN+SPI VKFTGKQVYDL
Sbjct  179  GRQGVGLNYRSIGKNVSPIEVKFTGKQVYDL  209



>gb|AFW67274.1| photosystem I reaction center subunit II [Zea mays]
Length=236

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  147  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNP  206

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GREGVGQN RSIGKN++PI VKFTGK  +D
Sbjct  207  GREGVGQNFRSIGKNVNPIDVKFTGKSTFD  236



>gb|KDP21451.1| hypothetical protein JCGZ_21922 [Jatropha curcas]
Length=205

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  115  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  174

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN+SPI VKFTGKQVYD+
Sbjct  175  GRQGVGLNFRSIGKNVSPIEVKFTGKQVYDI  205



>ref|XP_008802683.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Phoenix dactylifera]
Length=209

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGV+PEKVN 
Sbjct  119  AIMRQGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVFPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN SPI VKFTGKQVYDL
Sbjct  179  GRQGVGVNFRSIGKNASPIEVKFTGKQVYDL  209



>ref|XP_006444053.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
 dbj|BAF80471.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80473.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR57293.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
Length=209

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  119  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN+SPI VKFTGKQVYDL
Sbjct  179  GRQGVGVNYRSIGKNVSPIEVKFTGKQVYDL  209



>gb|KHN02708.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=241

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  74   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  133

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ YDL
Sbjct  134  GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL  164


 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -1

Query  330  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGK  151
            KEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIGK
Sbjct  165  KEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGK  224

Query  150  NISPIGVKFTGKQVYDL  100
            N+SPI VKFTGKQ YDL
Sbjct  225  NVSPIEVKFTGKQPYDL  241



>ref|XP_007034724.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOY05650.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=210

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  120  AIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N R+IGKN++PI VKFTGKQVYDL
Sbjct  180  GRQGVGLNFRNIGKNVNPIEVKFTGKQVYDL  210



>gb|EYU45647.1| hypothetical protein MIMGU_mgv1a013850mg [Erythranthe guttata]
Length=209

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGT+LRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  119  AIMRQGPNLLKLARKEQCLALGTKLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR GVG NMRSIGKN+SPI VKFTGKQVY+L
Sbjct  179  GRTGVGLNMRSIGKNVSPIEVKFTGKQVYEL  209



>gb|ACG25364.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACG45485.1| photosystem I reaction center subunit II [Zea mays]
Length=204

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  115  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNP  174

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GREGVGQN RSIGKN++PI VKFTGK  +D
Sbjct  175  GREGVGQNFRSIGKNVNPIDVKFTGKSTFD  204



>pdb|2O01|D Chain D, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=138

 Score =   171 bits (432),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  48   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNP  107

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG NMRSIGKN+SPI VKFTGKQ YDL
Sbjct  108  GRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL  138



>ref|XP_003610706.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES93664.1| photosystem I reaction center subunit II [Medicago truncatula]
 gb|AFK47938.1| unknown [Medicago truncatula]
Length=209

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  119  AIMREGPNLLKLARKEQCLALGNRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGKQ +D+
Sbjct  179  GRQGVGQNFRSIGKNVSPIEVKFTGKQPFDV  209



>emb|CAL25356.1| photosystem I reaction center subunit II [Platanus x acerifolia]
Length=122

 Score =   170 bits (431),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  32   AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  91

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN +PI VKFTGKQVYDL
Sbjct  92   GRQGVGQNFRSIGKNANPIEVKFTGKQVYDL  122



>ref|NP_001130880.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACF79256.1| unknown [Zea mays]
 gb|ACG34065.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACR35291.1| unknown [Zea mays]
 tpg|DAA52067.1| TPA: photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   172 bits (436),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  110  AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNP  169

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GREGVGQN RSIGKN++PI VKFTGK  +D
Sbjct  170  GREGVGQNFRSIGKNVNPIDVKFTGKATFD  199



>ref|XP_003592408.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES62659.1| photosystem I reaction center subunit II [Medicago truncatula]
Length=193

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  103  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNL  162

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN  SIGKN+SPI VKF+GKQVY+L
Sbjct  163  GRQGVGQNFGSIGKNVSPIEVKFSGKQVYEL  193



>ref|XP_010935005.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Elaeis guineensis]
Length=210

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  120  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN+SPI VKFTGK+V+DL
Sbjct  180  GRQGVGLNFRSIGKNVSPIEVKFTGKRVFDL  210



>gb|ACF86694.1| unknown [Zea mays]
Length=96

 Score =   168 bits (426),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  7    AIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNP  66

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GREGVGQN RSIGKN++PI VKFTGK  +D
Sbjct  67   GREGVGQNFRSIGKNVNPIDVKFTGKSTFD  96



>ref|XP_002281825.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CAN62373.1| hypothetical protein VITISV_036477 [Vitis vinifera]
Length=204

 Score =   171 bits (434),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  114  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN++PI VKFTGKQ YDL
Sbjct  174  GRQGVGVNFRSIGKNVNPIEVKFTGKQAYDL  204



>sp|P36213.1|PSAD_HORVU RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Hordeum vulgare]
 gb|AAA18567.1| PSI-D subunit [Hordeum vulgare subsp. vulgare]
 dbj|BAK07564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   171 bits (434),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  115  AIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNA  174

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGK  +D+
Sbjct  175  GRQGVGQNFRSIGKNVSPIEVKFTGKNSFDI  205



>emb|CAB52677.1| photosystem I subunit II precursor [Arabidopsis thaliana]
Length=204

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSK+KI YQFYRVFPNGEVQYLHPKDG+YPEK N 
Sbjct  114  AIMREGPNLLKLARKEQCLALGTRLRSKFKITYQFYRVFPNGEVQYLHPKDGIYPEKANP  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GREG G NMRSIGKN+SPI VKF GKQ YDL
Sbjct  174  GREGFGLNMRSIGKNVSPIEVKFPGKQSYDL  204



>gb|EMT14162.1| Photosystem I reaction center subunit II, chloroplastic [Aegilops 
tauschii]
Length=97

 Score =   167 bits (423),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  7    AIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNA  66

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGK  +D+
Sbjct  67   GRQGVGQNFRSIGKNVSPIEVKFTGKNSFDI  97



>emb|CAN61448.1| hypothetical protein VITISV_024141 [Vitis vinifera]
Length=183

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  95   AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  154

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVY  106
            GR+GVGQN RSIGKN+SPI VKFTGKQ Y
Sbjct  155  GRQGVGQNFRSIGKNVSPIEVKFTGKQAY  183



>gb|ACG41754.1| photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLAR EQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  110  AIMREGPNLLKLARNEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNP  169

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GREGVGQN RSIGKN++PI VKFTGK  +D
Sbjct  170  GREGVGQNFRSIGKNVNPIDVKFTGKATFD  199



>gb|EMS56878.1| Photosystem I reaction center subunit II, chloroplastic [Triticum 
urartu]
Length=156

 Score =   168 bits (426),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  66   AIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNA  125

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGK  +D+
Sbjct  126  GRQGVGQNFRSIGKNVSPIEVKFTGKNSFDI  156



>ref|XP_003564108.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Brachypodium distachyon]
Length=204

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVNA
Sbjct  114  AIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPSGEVQYLHPKDGVYPEKVNA  173

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVGQN RSIGKN+SPI VKFTGK  +D+
Sbjct  174  GRQGVGQNFRSIGKNVSPIEVKFTGKNTFDV  204



>ref|XP_010456951.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGK  115
            GREGVGQNMRSIGKN+SPI VKFTGK
Sbjct  180  GREGVGQNMRSIGKNVSPIEVKFTGK  205



>ref|XP_010424650.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGK  115
            GREGVGQNMRSIGKN+SPI VKFTGK
Sbjct  180  GREGVGQNMRSIGKNVSPIEVKFTGK  205



>gb|ACN40159.1| unknown [Picea sitchensis]
Length=161

 Score =   167 bits (422),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  71   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  130

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN++P  VKFTGKQ YD+
Sbjct  131  GRKGVGVNFRSIGKNVNPSQVKFTGKQTYDV  161



>ref|XP_010497891.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic, 
partial [Camelina sativa]
Length=85

 Score =   164 bits (414),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -1

Query  369  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  190
            IMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N G
Sbjct  1    IMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPG  60

Query  189  REGVGQNMRSIGKNISPIGVKFTGK  115
            REGVGQNMRSIGKN+SPI VKFTGK
Sbjct  61   REGVGQNMRSIGKNVSPIEVKFTGK  85



>gb|ABK21314.1| unknown [Picea sitchensis]
 gb|ABK24570.1| unknown [Picea sitchensis]
 gb|ABK26950.1| unknown [Picea sitchensis]
 gb|ABR17153.1| unknown [Picea sitchensis]
Length=234

 Score =   167 bits (423),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  144  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  203

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN++P  VKFTGKQ YD+
Sbjct  204  GRKGVGVNFRSIGKNVNPSQVKFTGKQTYDV  234



>ref|XP_010424649.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=230

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  120  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTG  118
            GREGVGQNMRSIGKN+SPI VKFT 
Sbjct  180  GREGVGQNMRSIGKNVSPIEVKFTA  204



>pdb|4RKU|D Chain D, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=137

 Score =   162 bits (410),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  51   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNP  110

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQ  112
            GR+GVG N RSIGKN+SPI VKFTGKQ
Sbjct  111  GRQGVGVNFRSIGKNVSPIEVKFTGKQ  137



>ref|XP_002991814.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
 gb|EFJ07076.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
Length=147

 Score =   161 bits (407),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLLKLARKEQCLALGT+LRSK+KINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  57   AIMRSGPNLLKLARKEQCLALGTQLRSKFKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  116

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N+RSIGKN +P+ +KFTGK  YD+
Sbjct  117  GRKGVGVNLRSIGKNCNPVDLKFTGKAAYDV  147



>gb|ABK21867.1| unknown [Picea sitchensis]
Length=234

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVY EKVN 
Sbjct  144  AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYQEKVNP  203

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N RSIGKN++P  VKFTGKQ YD+
Sbjct  204  GRKGVGVNFRSIGKNVNPSQVKFTGKQTYDV  234



>gb|AAB51150.1| subunit II of photosystem I [Picea abies]
Length=102

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  1    AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  60

Query  192  GREGVGQNMRSIGKNISPIGVKF  124
            GR+GVG N+RSIGKN+ PI VKF
Sbjct  61   GRKGVGVNLRSIGKNVDPIQVKF  83



>ref|XP_002992973.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
 gb|EFJ05919.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
Length=976

 Score =   167 bits (424),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLLKLARKEQCLALGT+LRSK+KINYQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  886  AIMRSGPNLLKLARKEQCLALGTQLRSKFKINYQFYRVFPNGEVQYLHPKDGVYPEKVNP  945

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+GVG N+RSIGKN +P+ +KFTGK  YD+
Sbjct  946  GRKGVGVNLRSIGKNCNPVDLKFTGKAAYDV  976



>ref|XP_010474917.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=241

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMRE  NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N 
Sbjct  157  AIMRERPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANP  216

Query  192  GREGVGQNMRSIGKNISPIGV  130
            GREGVGQNMRSIGKN+SPI V
Sbjct  217  GREGVGQNMRSIGKNVSPIEV  237



>gb|KJB28316.1| hypothetical protein B456_005G042000 [Gossypium raimondii]
Length=228

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  124  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  183

Query  192  GREGVGQNMRSIGKNISPI  136
            GR+GVGQN RSIGKN+SPI
Sbjct  184  GRQGVGQNFRSIGKNVSPI  202



>gb|ACF05876.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05886.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   153 bits (386),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  90   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  149

Query  192  GREGVGQNMRSIGKNISP  139
            GR+GVGQN RSIGKN SP
Sbjct  150  GRQGVGQNFRSIGKNASP  167



>gb|ACF05868.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05879.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05880.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   153 bits (386),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  90   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  149

Query  192  GREGVGQNMRSIGKNISP  139
            GR+GVGQN RSIGKN SP
Sbjct  150  GRQGVGQNFRSIGKNASP  167



>ref|XP_001751403.1| predicted protein [Physcomitrella patens]
 gb|EDQ83720.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  76   AIMRSGPNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNA  135

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR  VG N RSIGKN +P  +KF  KQ YDL
Sbjct  136  GRSPVGVNNRSIGKNANPAELKFAQKQAYDL  166



>gb|ACF05859.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05860.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05869.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05870.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05873.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05875.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05877.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05885.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  90   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  149

Query  192  GREGVGQNMRSIGKNISP  139
            GR+GVGQN RSIGKN SP
Sbjct  150  GRQGVGQNFRSIGKNASP  167



>gb|ACF05855.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05856.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05857.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05858.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05861.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05862.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05863.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05864.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05865.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05866.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05867.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05872.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05874.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05878.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05881.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05882.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05883.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05887.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05888.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05889.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05890.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05891.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05892.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  90   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  149

Query  192  GREGVGQNMRSIGKNISP  139
            GR+GVGQN RSIGKN SP
Sbjct  150  GRQGVGQNFRSIGKNASP  167



>gb|ACF05871.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  90   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  149

Query  192  GREGVGQNMRSIGKNISP  139
            GR+GVGQN RSIGKN SP
Sbjct  150  GRQGVGQNFRSIGKNASP  167



>gb|ACF05884.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  90   AIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  149

Query  192  GREGVGQNMRSIGKNISP  139
            GR+GVGQN RSIGKN SP
Sbjct  150  GRQGVGQNFRSIGKNASP  167



>ref|XP_001768962.1| predicted protein [Physcomitrella patens]
 gb|EDQ66316.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   152 bits (385),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  76   AIMRSGPNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNA  135

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR  VG N RSIGKN +P  +KF  KQ YDL
Sbjct  136  GRSPVGVNNRSIGKNANPAELKFAHKQAYDL  166



>ref|XP_001765579.1| predicted protein [Physcomitrella patens]
 gb|EDQ69629.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score =   152 bits (383),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  66   AIMRSGPNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNA  125

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR  VG N RSIGKN +P  +KF  KQ YDL
Sbjct  126  GRSPVGVNNRSIGKNANPAELKFAQKQAYDL  156



>ref|XP_001752431.1| predicted protein [Physcomitrella patens]
 gb|EDQ82670.1| predicted protein [Physcomitrella patens]
Length=210

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  120  AIMRSGPNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNA  179

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR  VG N RSIG+N +P  +KF  KQ YDL
Sbjct  180  GRTAVGVNNRSIGQNANPAELKFAHKQAYDL  210



>gb|KDO68707.1| hypothetical protein CISIN_1g047658mg [Citrus sinensis]
Length=229

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  119  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  178

Query  192  GREGVGQNMRSIGKNISPI  136
            GR+GVG N RSIGKN+SPI
Sbjct  179  GRQGVGVNYRSIGKNVSPI  197



>ref|XP_005647040.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE22496.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
Length=192

 Score =   141 bits (355),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLLKLARKEQCLAL T+LR+K+K + Q YRVFP+GEVQYLHPKDGVYPEKVNA
Sbjct  101  AIMRSGPNLLKLARKEQCLALLTQLRNKFKTDGQIYRVFPDGEVQYLHPKDGVYPEKVNA  160

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQ-VYDL  100
            GR  VG   RSIGKN +P+ VKFTGK   YD+
Sbjct  161  GRTAVGAKDRSIGKNTNPVAVKFTGKLGTYDV  192



>ref|YP_005088653.1| photosystem I subunit II [Phaeocystis antarctica]
 gb|AEK26757.1| photosystem I subunit II [Phaeocystis antarctica]
Length=141

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIM++G NLL LA+KEQCLALGT+LR+ +KIN Y+ YR+FPN EVQYLHPKDGV+PEK+N
Sbjct  51   AIMQKGENLLYLAKKEQCLALGTQLRTSFKINDYKIYRIFPNSEVQYLHPKDGVFPEKLN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR GVG  M SIGKN  P+ VKFTGK  +D
Sbjct  111  AGRLGVGNVMHSIGKNAQPVNVKFTGKNTFD  141



>ref|YP_008145427.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
 gb|AGO44889.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
Length=141

 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIM++G NLL LA+KEQCLALGT+LR+ +K+N Y+ YR+FPN EVQYLHPKDGV+PEK+N
Sbjct  51   AIMQKGENLLYLAKKEQCLALGTQLRTSFKVNDYKIYRIFPNSEVQYLHPKDGVFPEKLN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR GVG  M SIGKN  P+ VKFTGK  +D
Sbjct  111  AGRLGVGNVMHSIGKNAQPVNVKFTGKNTFD  141



>ref|XP_007511428.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17549.1| predicted protein [Bathycoccus prasinos]
Length=199

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQC+AL T  R+K   N   YRVFP+GEVQYLHPKDGVYPEKVNA
Sbjct  109  AIMRKGPNLLKLARKEQCMALVTTFRAKKIANGCIYRVFPSGEVQYLHPKDGVYPEKVNA  168

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR G  QNMRSIGKN +P+ VKF GK  +D+
Sbjct  169  GRVGANQNMRSIGKNTNPVNVKFQGKGTFDV  199



>ref|XP_002953316.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
 gb|EFJ45626.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
Length=179

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLK A+KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVNA
Sbjct  87   AIMRQGPNLLKFAKKEQCLALTTQLRTKFKLTPAFYRVFPDGKVQYLHPADGVYPEKVNA  146

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQV  109
            GR GV QN R IG+N++PI VKF+G+ +
Sbjct  147  GRVGVNQNFRRIGQNVNPIKVKFSGRMM  174



>gb|KIZ01091.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=187

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKE CLAL T+LR+K+KI   FYRV+P GEV+YLHPKDGVYPEKVNA
Sbjct  97   AIMRKGPNLLKLARKEHCLALTTQLRNKFKIQPAFYRVYPTGEVEYLHPKDGVYPEKVNA  156

Query  192  GREGVGQNMRSIGKNISPIGVKFTGK  115
            GR G  QN R IG+N++PI VKFTGK
Sbjct  157  GRIGENQNFRRIGENVNPIKVKFTGK  182



>gb|AFC39948.1| photosystem I subunit II [Porphyra umbilicalis]
Length=141

 Score =   134 bits (336),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR+G NLL LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRDGENLLYLAKKEQCLALGTQLKGKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR+ +     SIGKN++P+ VKFT K  YD
Sbjct  111  AGRDSINSVDHSIGKNVNPVNVKFTNKATYD  141



>ref|XP_005847397.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
 gb|EFN55295.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
Length=186

 Score =   135 bits (339),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLAL T+LR+K+K +   YRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  96   AIMRQGPNLLKLARKEQCLALLTQLRTKFKTDGFIYRVFPNGEVQYLHPKDGVYPEKVNA  155

Query  192  GREGVGQNMRSIGKNISPIGVKFTGK  115
            GR G   NMR IG+N +P  +KFTGK
Sbjct  156  GRSGDNTNMRRIGQNTNPSQIKFTGK  181



>ref|YP_007947808.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
 gb|AGG37057.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
Length=141

 Score =   133 bits (335),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR G NLL LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRNGENLLYLAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR  V     SIG+N++P+ VKFT K  YD
Sbjct  111  AGRASVNSVDHSIGRNVNPVDVKFTNKATYD  141



>gb|AIA20054.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   133 bits (335),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR G NLL LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRNGENLLYLAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR  V     SIGKNI+PI VKFT K  YD
Sbjct  111  AGRASVNSVNHSIGKNINPIDVKFTNKTTYD  141



>gb|KIZ02718.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=169

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKE CLAL T+LR+K+KI   FYRV+P GEV+YLHPKDGVYPEKVNA
Sbjct  79   AIMRKGPNLLKLARKEHCLALTTQLRNKFKIQPAFYRVYPTGEVEYLHPKDGVYPEKVNA  138

Query  192  GREGVGQNMRSIGKNISPIGVKFTGK  115
            GR G  QN R IG+N++PI VKFTGK
Sbjct  139  GRIGENQNFRRIGENVNPIKVKFTGK  164



>ref|NP_053889.1| photosystem I subunit II [Porphyra purpurea]
 sp|P51279.1|PSAD_PORPU RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Porphyra purpurea]
 gb|AAC08165.1| Photosystem I reaction centre subunit II (chloroplast) [Porphyra 
purpurea]
Length=141

 Score =   133 bits (335),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR+G NLL LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRDGENLLYLAKKEQCLALGTQLKGKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR  +     SIGKN++PI VKFT K  YD
Sbjct  111  AGRASINSVDHSIGKNVNPINVKFTNKATYD  141



>ref|YP_009027562.1| photosystem I subunit II [Pyropia perforata]
 gb|AGQ17098.1| photosystem I subunit II [Pyropia perforata]
 gb|AHB35056.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AHB35265.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AIA19427.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19636.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19845.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20263.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20472.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20681.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20890.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA21099.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR G NLL LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRNGENLLYLAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR  V     SIGKNI+PI VKFT K  YD
Sbjct  111  AGRASVNSVNHSIGKNINPIDVKFTNKATYD  141



>ref|YP_008965721.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
 dbj|BAO23697.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
Length=142

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMREG NLL LARKEQCLALGT+LR+ +KI +Y+ YR+FP GEVQYLHPKDGV+PEKVN
Sbjct  51   AIMREGDNLLYLARKEQCLALGTQLRNSFKISDYKIYRIFPTGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
             GR G+    R+IGKN +PI VKFTGK  +++
Sbjct  111  EGRVGINNVSRNIGKNPNPISVKFTGKSTFEV  142



>gb|AIA21307.1| photosystem I subunit II [Pyropia kanakaensis]
Length=141

 Score =   132 bits (331),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR G NLL LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRNGENLLYLAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR  V     SIGKN++P+ VKFT K  YD
Sbjct  111  AGRASVNSVDHSIGKNVNPVDVKFTNKATYD  141



>ref|WP_008312724.1| PsaD [Leptolyngbya sp. PCC 6406]
Length=142

 Score =   132 bits (331),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K   ++Y+ YR++PNGE QYLHP DGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGTQLRTKFKPKIVDYKIYRIYPNGETQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE VG   RSIGKN  P  VKF+GK+ Y++
Sbjct  109  VNEGREAVGSVSRSIGKNPDPSTVKFSGKEPYEV  142



>ref|XP_011400522.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27539.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
Length=199

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMREG NLLKL+RKEQCLAL T+LR+K+KI+   YRVFPNGE QYLHPKDGVYPEKVN 
Sbjct  107  AIMREGPNLLKLSRKEQCLALLTQLRTKFKIDGAIYRVFPNGETQYLHPKDGVYPEKVNP  166

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GR+ V    R IG N +P  VKFTGK  Y++
Sbjct  167  GRKEVNAVFRRIGSNTNPAKVKFTGKPTYEV  197



>ref|XP_001697722.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
 sp|Q39615.1|PSAD_CHLRE RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAL73208.1|AF335592_1 photosystem I subunit [Chlamydomonas reinhardtii]
 emb|CAA56122.1| psaD [Chlamydomonas reinhardtii]
 emb|CAA52440.1| PSI reaction center, subunit II [Chlamydomonas reinhardtii]
 gb|EDO99874.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
Length=196

 Score =   132 bits (333),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLK  +KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVNA
Sbjct  104  AIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNA  163

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQV  109
            GR G  QNMR IG+N++PI VKF+G+ +
Sbjct  164  GRVGANQNMRRIGQNVNPIKVKFSGRMM  191



>gb|AIA21513.1| photosystem I subunit II [Pyropia fucicola]
Length=141

 Score =   131 bits (329),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR G NLL LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRNGENLLYLAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR  V     SIG+N++P+ VKF  K  YD
Sbjct  111  AGRASVNSVDHSIGQNVNPVDVKFMNKATYD  141



>gb|AHY04349.1| photosystem I reaction center subunit II (chloroplast) [Chrysochromulina 
sp. CCMP291]
Length=141

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIM+ G NLL LA+KEQCLALGT+LR+ +KI +Y+ YR+FPN EVQYLHPKDG++PEK+N
Sbjct  51   AIMKSGENLLYLAKKEQCLALGTQLRTLFKISDYKIYRIFPNSEVQYLHPKDGIFPEKLN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR GVG    SIGKN  P+ VKFTGK  YD
Sbjct  111  QGRVGVGNVGHSIGKNPQPVSVKFTGKSTYD  141



>ref|YP_536961.1| photosystem I subunit II [Pyropia yezoensis]
 sp|Q1XDK7.1|PSAD_PYRYE RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92404.1| Photosystem I reaction centre subunit II [Pyropia yezoensis]
 gb|AGH27605.1| photosystem I subunit II (chloroplast) [Pyropia yezoensis]
Length=141

 Score =   130 bits (326),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR G NLL LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN
Sbjct  51   ATMRNGENLLYLAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIG+NI+P+ VKF  K  YD
Sbjct  111  TGRASVNSVDHSIGQNINPVDVKFMNKATYD  141



>ref|YP_008144865.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
 gb|AGO19836.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
Length=133

 Score =   130 bits (326),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMREG NLL LA+KEQCLAL T+LR+K+KI +++ YR+FP+GEVQYLHPKDGV+PEK N
Sbjct  43   AIMREGNNLLYLAKKEQCLALSTQLRAKFKITDFKIYRIFPDGEVQYLHPKDGVFPEKAN  102

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GRE VG    SIGKN +P+  KFTGK  Y+
Sbjct  103  PGRESVGNIQHSIGKNDNPVNKKFTGKATYE  133



>gb|AJO68451.1| photosystem I subunit II (chloroplast) [Gracilariopsis lemaneiformis]
Length=141

 Score =   130 bits (326),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMREG NLL LA+KEQCLAL ++L +K+KI +++ YR+FPNGEVQYLHPKDGV+PEKVN
Sbjct  51   AIMREGNNLLYLAKKEQCLALSSQLNTKFKITDFKIYRIFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR  VG    SIGKN +P+  KFTGK  Y+
Sbjct  111  AGRSSVGNISHSIGKNKNPVNEKFTGKATYE  141



>ref|YP_007627400.1| photosystem I subunit II [Chondrus crispus]
 emb|CCP38147.1| photosystem I subunit II [Chondrus crispus]
Length=141

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMREG NLL LA+KEQCLAL  +LR  +KI +++ YR+FPNGEVQYLHPKDGV+PEKVN
Sbjct  51   AIMREGDNLLYLAKKEQCLALSAQLRKSFKIRDFKIYRIFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GREGVG    SIGKN +P+  KFTG+  Y+
Sbjct  111  PGREGVGNISHSIGKNENPVNTKFTGRGTYE  141



>emb|CEG01861.1| Photosystem I PsaD [Ostreococcus tauri]
Length=188

 Score =   130 bits (328),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLAL    RSK K++   YRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  97   AIMRKGPNLLKLARKEQCLALLNTFRSKMKLDGCIYRVFPSGEVQYLHPKDGVYPEKVNK  156

Query  192  GREGVGQNMRSIGKNISPIGVKFTGK  115
            GR G  QNMRSIGKN +P  +KF GK
Sbjct  157  GRVGANQNMRSIGKNTNPAKIKFQGK  182



>ref|XP_002504652.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
 gb|ACO65910.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
Length=216

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLAL   +R+K KIN   YRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  112  AIMRKGPNLLKLARKEQCLALLNSMRAKNKINGCVYRVFPSGEVQYLHPKDGVYPEKVNK  171

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR G   NMRSIGKN +P  +KF GK   D
Sbjct  172  GRVGANNNMRSIGKNANPASIKFGGKMYKD  201



>gb|KEI67811.1| PsaD [Planktothrix agardhii NIVA-CYA 126/8]
Length=100

 Score =   126 bits (317),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NL+ LARKEQCLALGT+LRSK+K    NY+ YRVFPNGE +YLHPKDGV+PEK
Sbjct  7    AIMNEGDNLMYLARKEQCLALGTQLRSKFKPKIDNYKIYRVFPNGETEYLHPKDGVFPEK  66

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR+ V     +IG N+ P+ VKFT K   D+
Sbjct  67   VNEGRQSVNSVAHNIGSNVDPVKVKFTTKTTSDV  100



>ref|YP_009051089.1| photosystem I subunit II [Galdieria sulphuraria]
 ref|XP_005705023.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|ADO32968.1| photosystem I 20kDa subunit [Galdieria sulphuraria]
 gb|EME28503.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|AIG92532.1| photosystem I subunit II [Galdieria sulphuraria]
Length=141

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A+MR G NLL  ARKEQCL+LGT+L++++KI NY+ YRVFPNGE+QYLHPKDGV+PEKVN
Sbjct  51   ALMRSGENLLYFARKEQCLSLGTQLKTQFKIDNYKIYRVFPNGEIQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR+ +    RSIGKN  P+ VKF  KQ ++
Sbjct  111  EGRKAINTLTRSIGKNPDPVVVKFINKQTFE  141



>ref|XP_001421350.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99643.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
Length=192

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLAL    R+K K++   YRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  101  AIMRKGPNLLKLARKEQCLALLNNFRAKMKLDGCIYRVFPSGEVQYLHPKDGVYPEKVNK  160

Query  192  GREGVGQNMRSIGKNISPIGVKFTGK  115
            GR G  QNMRSIGKN +P  +KF GK
Sbjct  161  GRVGANQNMRSIGKNTNPASIKFQGK  186



>ref|XP_003063552.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
 gb|EEH51925.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
Length=225

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR+G NLLKLARKEQCLAL   +R+K KIN   YRVFP+GEVQYLHPKDGVYPEKVN 
Sbjct  121  AIMRKGPNLLKLARKEQCLALLNSMRAKNKINGCVYRVFPSGEVQYLHPKDGVYPEKVNK  180

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR G   NMRSIGKN +P  +KF GK   D
Sbjct  181  GRVGANNNMRSIGKNANPASIKFGGKLGSD  210



>ref|WP_015145740.1| PsaD [Pleurocapsa minor]
 gb|AFY79442.1| PsaD [Pleurocapsa sp. PCC 7327]
Length=142

 Score =   127 bits (319),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALG +LR+K+K    NY+ YR++PNGE+QYLHP DGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGAQLRTKFKPKIENYKIYRIYPNGEIQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR  VG+  RSIGKN  P  +KF+GK  YD+
Sbjct  109  VNEGRVAVGKKDRSIGKNPEPATLKFSGKMPYDV  142



>ref|NP_050759.1| photosystem I subunit II (chloroplast) [Guillardia theta]
 sp|O78502.1|PSAD_GUITH RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Guillardia theta]
 gb|AAC35693.1| PSI ferredoxin-binding protein II (chloroplast) [Guillardia theta]
Length=141

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR+G NLL LARKEQCLALGT++++ +KI +Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  51   AIMRKGENLLYLARKEQCLALGTQVKTSFKITDYKIYRIFPSGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR GVG    SIGKN++P  +KFT K   D
Sbjct  111  PGRIGVGNVSHSIGKNLNPAQIKFTNKSFCD  141



>ref|WP_026795097.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   127 bits (318),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NL+ LARKEQCLALGT+LRSK+K    NY+ YRVFPNGE +YLHPKDGV+PEK
Sbjct  49   AIMNEGDNLMYLARKEQCLALGTQLRSKFKPKIDNYKIYRVFPNGETEYLHPKDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR+ V     +IG N+ P+ VKFT K   D+
Sbjct  109  VNEGRQSVNSVAHNIGSNVDPVKVKFTTKTTSDV  142



>ref|WP_009769007.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ66743.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
Length=139

 Score =   127 bits (318),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            A+MR+G NLL LARKEQCLALGT+L++K+KI+Y+ YRVFPNG++QYLHP DGVYPEKVN 
Sbjct  49   AVMRQGDNLLYLARKEQCLALGTQLKTKFKIDYKIYRVFPNGDIQYLHPADGVYPEKVNP  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR  V    R+IGKN  P  +KF+G   Y+
Sbjct  109  GRVAVNSVPRNIGKNPDPAKLKFSGVAPYN  138



>ref|YP_001936347.1| photosystem I subunit II [Heterosigma akashiwo]
 gb|ABV65953.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
 gb|ABV70094.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
Length=139

 Score =   127 bits (318),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIM +G NLL LARKEQCLALGT+LRS +KIN Y+ YR+FPNGE+QYLHPKDGV+PEKVN
Sbjct  49   AIMLQGENLLYLARKEQCLALGTQLRS-FKINDYKIYRLFPNGEIQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  VG    SIGKN +P+ VKF+GK  +D
Sbjct  108  PGRLAVGSRNFSIGKNPNPVSVKFSGKGTFD  138



>ref|WP_039725494.1| MULTISPECIES: Photosystem I reaction center subunit II [Oscillatoriophycideae]
 gb|KIF13826.1| Photosystem I reaction center subunit II [Aphanocapsa montana 
BDHKU210001]
 gb|KIF38764.1| Photosystem I reaction center subunit II [Lyngbya confervoides 
BDU141951]
Length=142

 Score =   126 bits (316),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALG +LR+K+K    +Y+ YR++P+GE QYLHP DGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGAQLRTKFKPRIQDYKIYRIYPSGETQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE V +N RSIGKN  P  +KF+GK+ Y++
Sbjct  109  VNEGRESVNRNDRSIGKNPDPATIKFSGKEPYEV  142



>ref|YP_277398.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAU81920.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAX13897.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AEI29557.1| photosystem I subunit II [Emiliania huxleyi]
Length=142

 Score =   126 bits (316),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIM++G NLL LA+KEQCLAL T+LR+ +KI +Y+ YR+FPN EVQYLHPKDGV+PEK+N
Sbjct  52   AIMQKGENLLYLAKKEQCLALSTQLRTLFKISDYKIYRIFPNSEVQYLHPKDGVFPEKLN  111

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR GVG    SIGKN +P+ VKFTGK  +D
Sbjct  112  EGRIGVGNVGYSIGKNPNPVNVKFTGKNTFD  142



>ref|YP_001293570.1| photosystem I subunit II [Rhodomonas salina]
 gb|ABO70759.1| photosystem I subunit II [Rhodomonas salina]
Length=141

 Score =   125 bits (315),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR+G NLL LARKEQCLAL T++++ +KI +Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  51   AIMRQGENLLYLARKEQCLALATQVKNSFKITDYKVYRIFPSGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGK  115
            AGR GVG    SIGKN++P  +KFT K
Sbjct  111  AGRVGVGNVSHSIGKNLNPAQIKFTSK  137



>ref|YP_063618.1| photosystem I subunit II [Gracilaria tenuistipitata var. liui]
 gb|AAT79693.1| photosystem I reaction center subunit II [Gracilaria tenuistipitata 
var. liui]
Length=141

 Score =   125 bits (315),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMREG NLL LARKEQCLAL T+L+ ++KI +++ YR+FPN EVQYLHPKDGV+PEKVN
Sbjct  51   AIMREGNNLLYLARKEQCLALSTQLKMQFKIKDFKIYRIFPNSEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR G+G    SIGKN  P+  KFTGK  Y+
Sbjct  111  PGRVGIGNIDHSIGKNEDPVNKKFTGKATYE  141



>ref|YP_009019626.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
 gb|AHH24594.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
Length=141

 Score =   125 bits (315),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIM+EG NLL LARKEQCLALGT+L++++KI +++ YR+FPN EVQYLHPKDGV+PEKVN
Sbjct  51   AIMQEGNNLLYLARKEQCLALGTQLKTQFKITDFKIYRIFPNSEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGR G+G    SIG+N +P+  KFT K  Y+
Sbjct  111  AGRVGIGNIDHSIGENDNPVNKKFTVKATYE  141



>ref|WP_035996822.1| Photosystem I reaction center subunit II [Leptolyngbya sp. JSC-1]
Length=142

 Score =   125 bits (315),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A+MR+G NLL LARKEQC+ALG +LRSK+K    +Y+ YRVFP+GE+QYLHP DGV+PEK
Sbjct  49   AVMRQGENLLYLARKEQCIALGAQLRSKFKPKIEDYKIYRVFPSGEIQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  V    RSIG+N  P  VKFTGK  YD
Sbjct  109  VNEGRAAVNSVPRSIGQNPQPATVKFTGKNTYD  141



>ref|WP_018400163.1| Photosystem I reaction center subunit II [filamentous cyanobacterium 
ESFC-1]
Length=142

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG N+L+LARKEQCLALGT+LR+K+K    +Y+ YR++PNGE+QYLHP DGV+PEK
Sbjct  49   AIMNEGENMLELARKEQCLALGTQLRTKFKPKMEDYKIYRIYPNGEIQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR  VG+  R IG N  P  VKF+GK  YD+
Sbjct  109  VNEGRPYVGKKDRKIGDNPEPATVKFSGKAPYDV  142



>ref|WP_010871317.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 ref|NP_440008.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 sp|P19569.2|PSAD_SYNY3 RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 pdb|4KT0|D Chain D, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|D Chain D, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|DD Chain d, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|4 Chain 4, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 gb|AAA88625.1| photosystem I subunit II [Synechocystis sp.]
 dbj|BAA16688.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 dbj|BAK48859.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 dbj|BAL27858.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31028.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34197.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50390.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 gb|AGF50377.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
Length=141

 Score =   124 bits (312),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K    +Y+ YRV+P+GEVQYLHP DGV+PEK
Sbjct  48   AIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEK  107

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G   R IG+N  P+ +KF+GK  Y++
Sbjct  108  VNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV  141



>sp|Q9T4W8.1|PSAD_CYAPA RecName: Full=Photosystem I reaction center subunit II, cyanelle; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Cyanophora paradoxa]
 emb|CAB64901.1| photosystem I reaction centre subunit II precursor [Cyanophora 
paradoxa]
Length=220

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL+LARKEQC+ALG +L+ K+KI +Y+ YRV+P+GEVQ+LHPKDGV+PEKVN
Sbjct  125  AIMRAGENLLRLARKEQCIALGAQLKDKFKITDYKIYRVYPSGEVQFLHPKDGVFPEKVN  184

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  VG N R IG+N  P  +KF G++ +D
Sbjct  185  PGRVAVGSNKRRIGQNPDPAKLKFKGQETFD  215



>ref|WP_026788324.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   124 bits (311),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NL+ LA KEQCLALGT+LRSK+K    NY+ YRVFPNGE +YLHPKDGV+PEK
Sbjct  49   AIMNEGDNLMYLALKEQCLALGTQLRSKFKPKIDNYKIYRVFPNGETEYLHPKDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR+ V     +IG N+ P+ VKFT K   D+
Sbjct  109  VNEGRQSVNSVAHNIGSNVDPVKVKFTTKTTSDV  142



>gb|AJH65942.1| photosystem I reaction center subunit II [Vertebrata lanosa]
Length=143

 Score =   124 bits (311),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIM EG NLL LA+KEQCLAL  +L+SK+KIN ++ YR+FPNGEVQYLHPKDGV+PEKVN
Sbjct  51   AIMAEGDNLLYLAKKEQCLALSNQLKSKFKINDFKIYRIFPNGEVQYLHPKDGVFPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR G+G    +IG+N +P+  KFTG+  Y+
Sbjct  111  EGRVGIGYIEHNIGQNTNPVNKKFTGQATYE  141



>ref|YP_003734986.1| photosystem I protein subunit II [Durinskia baltica]
 gb|ADI40201.1| photosystem I protein subunit II [Durinskia baltica]
Length=139

 Score =   124 bits (310),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINNYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  +     SIGKN  P  +KF+GK  YD
Sbjct  108  PGRVAMNSRDFSIGKNPDPASIKFSGKTTYD  138



>ref|WP_017304392.1| Photosystem I reaction center subunit II [Spirulina subsalsa]
Length=142

 Score =   124 bits (310),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K    +Y+ YR++PNGE QYLHP DGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGTQLRTKFKPKIEDYKIYRIYPNGETQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR   G+  R+IG N  P+ +KF+GK  YD+
Sbjct  109  VNEGRPFAGKKDRNIGSNPEPVTIKFSGKAPYDV  142



>ref|WP_015173693.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
 gb|AFY68129.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
Length=142

 Score =   124 bits (310),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A+M EG NLL LARKEQCLALG +LR+K+K    +Y+ YRVFPNGE+QYLHPKDGV+PEK
Sbjct  49   AVMNEGENLLYLARKEQCLALGAQLRTKFKPKMEDYKIYRVFPNGEIQYLHPKDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  V  N R IG N  P  VKF+G   Y+
Sbjct  109  VNEGRTSVNHNPRKIGDNPQPAKVKFSGTPTYE  141



>ref|WP_017292752.1| Photosystem I reaction center subunit II [Geminocystis herdmanii]
Length=144

 Score =   124 bits (310),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NL   ARKEQCLALGT+LR+K+K    +Y+ YRV+P GE+QYLHP DGV+PEK
Sbjct  51   AIMNEGENLFYFARKEQCLALGTQLRTKFKPKIEDYKVYRVYPTGEIQYLHPADGVFPEK  110

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G+  RSIGKN  P+ +KF+GK  YD+
Sbjct  111  VNEGREFHGKKDRSIGKNPEPVTLKFSGKAPYDV  144



>ref|YP_003734548.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
 gb|ADI40333.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
Length=139

 Score =   123 bits (309),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLL LARKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN 
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNP  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR        SIGKN +P  +KF+GK  YD
Sbjct  109  GRVAANSRDFSIGKNPNPASIKFSGKTTYD  138



>ref|WP_028947468.1| Photosystem I reaction center subunit II [Synechocystis sp. PCC 
6714]
 gb|AIE75111.1| photosystem I subunit II (PsaD) [Synechocystis sp. PCC 6714]
Length=141

 Score =   123 bits (308),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM +G NLL LARKEQCLALGT+LR+K+K    +Y+ YRV+P+GEVQYLHP DGV+PEK
Sbjct  48   AIMNQGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEK  107

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G   R IG+N  P+ +KF+GK  Y++
Sbjct  108  VNEGREAQGTKSRRIGQNPEPVTIKFSGKAPYEV  141



>ref|WP_016924991.1| Photosystem I reaction center subunit II [Prochlorothrix hollandica]
Length=142

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A M  G NLL LARKEQCLALG +LR+K+K    +Y+ YRVFP G+V+YLHPKDGV+PEK
Sbjct  49   ATMNAGENLLYLARKEQCLALGRQLRTKFKPKMADYKIYRVFPTGDVEYLHPKDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  V     SIG N+ P  VKFTGK+ +D
Sbjct  109  VNEGRSAVNSVAHSIGHNVEPAAVKFTGKETFD  141



>ref|WP_015222401.1| photosystem I protein PsaD [Cyanobacterium stanieri]
 gb|AFZ47083.1| photosystem I protein PsaD [Cyanobacterium stanieri PCC 7202]
Length=144

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NL   ARKEQCLALGT+LR+K+K    +Y+ YRV+PNGEVQYLHP DGV+PEK
Sbjct  51   AIMNEGENLYYFARKEQCLALGTQLRTKFKPKMEDYKIYRVYPNGEVQYLHPADGVFPEK  110

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G+  R+IG+N  P+ +KF+GK  YD+
Sbjct  111  VNEGREFHGKKDRNIGRNPEPVTLKFSGKNPYDV  144



>ref|WP_015221061.1| photosystem I protein PsaD [Cyanobacterium aponinum]
 gb|AFZ55343.1| photosystem I protein PsaD [Cyanobacterium aponinum PCC 10605]
Length=144

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL  ARKEQCLALGT+LR+K+K    +Y+ YR++P GE QYLHP DGV+PEK
Sbjct  51   AIMNEGENLLYFARKEQCLALGTQLRTKFKPKIEDYKIYRIYPTGETQYLHPADGVFPEK  110

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G+  R+IGKN  P+ +KF+GK  YD+
Sbjct  111  VNEGREFHGKKDRNIGKNPEPVTLKFSGKTPYDV  144



>ref|YP_003002181.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
 gb|ACS36893.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
Length=139

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLL LARKEQCLALGT+LR+    +Y+ YR+FP+GEVQYLHPKDGV+PEK N 
Sbjct  49   AIMRTGQNLLYLARKEQCLALGTQLRTFKITDYKIYRIFPSGEVQYLHPKDGVFPEKSNE  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR  VG+   SIGKN +P+ VKF+GK+ ++
Sbjct  109  GRIQVGKRDFSIGKNPNPVTVKFSGKESFE  138



>ref|WP_006616635.1| MULTISPECIES: photosystem I protein PsaD [Arthrospira]
 gb|EDZ95101.1| photosystem I protein PsaD [Arthrospira maxima CS-328]
 dbj|BAI90809.1| photosystem I reaction center subunit II [Arthrospira platensis 
NIES-39]
 emb|CCE16228.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|EKD05964.1| photosystem I protein PsaD [Arthrospira platensis C1]
 emb|CDM94815.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|KDR56251.1| Photosystem I reaction center subunit II [Arthrospira platensis 
str. Paraca]
Length=142

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K    +++ YR+FPNGE++YLHPKDGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGTQLRTKFKPKIEDFKIYRIFPNGEMEYLHPKDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GRE  G+  R IG N +P  VKF+GK  Y+
Sbjct  109  VNEGREFNGKIDRKIGDNPNPASVKFSGKATYE  141



>ref|YP_009029026.1| photosystem I reaction center subunit II (chloroplast) [Cylindrotheca 
closterium]
 gb|AGH28565.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Cylindrotheca closterium]
Length=139

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLL LARKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN 
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNP  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR  VG    SIGKN +P  +KF+G   YD
Sbjct  109  GRISVGSRDFSIGKNPNPALIKFSGIATYD  138



>ref|YP_004376584.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
 dbj|BAK18950.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
Length=139

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVY  106
             GR  V     SIGKN +P  +KF+G   Y
Sbjct  108  PGRSAVNSRQFSIGKNPNPASIKFSGTTTY  137



>ref|YP_009092872.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
 gb|AIR75263.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
Length=139

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRTSVNSRDFSIGKNPNPASIKFSGTTTYE  138



>ref|YP_009093339.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
 gb|AIR76012.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
Length=139

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRTSVNSRDFSIGKNPNPASIKFSGTTTYE  138



>ref|YP_009028878.1| photosystem I reaction center subunit II (chloroplast) [Coscinodiscus 
radiatus]
 gb|AGH28422.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Coscinodiscus radiatus]
Length=139

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR+ +     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRKAINSRNFSIGKNPNPASIKFSGNTTYE  138



>ref|YP_005089671.1| psaD gene product (chloroplast) [Ulnaria acus]
 gb|AEX37796.1| photosystem I subunit II (chloroplast) [Ulnaria acus]
Length=139

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLL LARKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN 
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNP  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR  V     SIGKN  P  VKF+G   Y+
Sbjct  109  GRSAVNSREFSIGKNPEPASVKFSGIATYE  138



>gb|KCW60797.1| hypothetical protein EUGRSUZ_H03534 [Eucalyptus grandis]
Length=186

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 70/91 (77%), Gaps = 13/91 (14%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AI+R+G N LKLARKEQCLALGTRLRSKYKI YQFYRV PNG             +KVN 
Sbjct  109  AIVRQGPNPLKLARKEQCLALGTRLRSKYKIKYQFYRVLPNG-------------KKVNL  155

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            GRE +GQN+RSIGKN+SPI VKFTGKQV DL
Sbjct  156  GREVMGQNLRSIGKNVSPIEVKFTGKQVDDL  186



>ref|WP_013323038.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
 gb|ADN14945.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
Length=141

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQC+ALG + RSK+K    NY+ YR+FPNGE++YLHP DGV+PEK
Sbjct  48   AIMNEGDNLLYLARKEQCIALGGQFRSKFKPKIDNYKIYRIFPNGEIEYLHPADGVFPEK  107

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR   G+  RSIGKN  P  +KF+GK+ YD+
Sbjct  108  VNEGRAYNGKKDRSIGKNPEPATLKFSGKKPYDV  141



>ref|WP_019505782.1| Photosystem I reaction center subunit II [Pleurocapsa sp. PCC 
7319]
Length=142

 Score =   121 bits (304),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALG +LR+K+K    +Y+ YRVFP+GE QYLHP DGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGAQLRTKFKPRIQDYKIYRVFPSGETQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G+  RSIG+N  P  +KF+GK  Y++
Sbjct  109  VNEGREFNGKKDRSIGQNPEPATIKFSGKAPYEV  142



>ref|YP_009059209.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
 gb|AHI51156.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
Length=139

 Score =   121 bits (303),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLL LARKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN 
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNP  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR  V     SIGKN +P  VKF+G   Y+
Sbjct  109  GRTSVNSRGFSIGKNPNPASVKFSGINTYE  138



>ref|WP_006910658.1| photosystem I reaction center subunit II [Cyanobium sp. PCC 7001]
 gb|EDY38753.1| photosystem I reaction center subunit II [Cyanobium sp. PCC 7001]
Length=143

 Score =   121 bits (303),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A M EG NL+  ARKEQCLALGT+LR+K+K    +Y+ YR+FP G+ +YLHPKDGV+PEK
Sbjct  50   AEMNEGENLMYFARKEQCLALGTQLRTKFKPRIEDYKIYRIFPGGDTEYLHPKDGVFPEK  109

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  VG N R+IG N +P  +KFTGK  +D
Sbjct  110  VNEGRPIVGHNPRTIGANTNPANLKFTGKNTFD  142



>ref|WP_006530712.1| PsaD [Gloeocapsa sp. PCC 73106]
 gb|ELR96477.1| PsaD [Gloeocapsa sp. PCC 73106]
Length=142

 Score =   121 bits (303),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 3/92 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG N+L LARKEQCLALG +LR+K+K    N++ YRVFPNGEVQYLHP DGV+PEK
Sbjct  49   AIMNEGDNILYLARKEQCLALGGQLRTKFKPKIENFKIYRVFPNGEVQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVY  106
            VN GRE  G+  RSIGKN  P  +KF+GK  Y
Sbjct  109  VNPGREYNGKIDRSIGKNPEPATLKFSGKTPY  140



>ref|YP_002327575.1| PSI reaction center subunit II [Vaucheria litorea]
 gb|ACF70992.1| PSI reaction center subunit II [Vaucheria litorea]
Length=139

 Score =   121 bits (303),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A+M    NLL LARKEQCLALGT+L+ K+KIN Y+ YR+FPNGEVQ+LHPKDGV+PEKVN
Sbjct  49   AVMLNDQNLLYLARKEQCLALGTQLK-KFKINDYKIYRIFPNGEVQFLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVY  106
             GR  VG    SIGKN +PI VKF+G++ Y
Sbjct  108  VGRLAVGSRNFSIGKNPNPISVKFSGQETY  137



>ref|YP_874394.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
 gb|ABK20617.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
Length=139

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRSGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRTAVNNRDFSIGKNPNPASIKFSGINTYE  138



>ref|WP_026032399.1| Photosystem I reaction center subunit II [Prochlorococcus sp. 
W7]
Length=140

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR  K +I NY+ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMNEGDNLMYFARKEQCLALGTQLRGFKPRIENYKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N+SP   KFT K+ YD
Sbjct  109  NEGREQVGHNPRRIGENLSPAKFKFTTKKTYD  140



>ref|YP_009093018.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
 gb|AIR75691.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
Length=139

 Score =   120 bits (302),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLL LARKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN 
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRTFKLNNYKIYRIFPSGEVQYLHPKDGVFPEKVNP  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR  V     SIGKN +P+ +KF+G   Y+
Sbjct  109  GRIPVNSRPFSIGKNPNPVSIKFSGINTYE  138



>ref|WP_036530202.1| Photosystem I reaction center subunit II [Neosynechococcus sphagnicola]
 gb|KGF74025.1| Photosystem I reaction center subunit II [Neosynechococcus sphagnicola 
sy1]
Length=139

 Score =   120 bits (302),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A M+EG NLL LARKEQCLALGT+LR K+KI +Y+ YR+FP G+V+YLHPKDGV+PEKVN
Sbjct  49   ATMQEGENLLPLARKEQCLALGTQLR-KFKITDYKIYRIFPGGDVEYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVY  106
            AGRE  G+  R+IG+N  P+ +KF+G   Y
Sbjct  108  AGREFAGKKDRNIGRNPEPVTLKFSGNTPY  137



>ref|NP_043647.1| photosystem I subunit II [Odontella sinensis]
 sp|P49481.1|PSAD_ODOSI RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Odontella sinensis]
 emb|CAA91679.1| PSI, ferredoxin-binding protein II [Odontella sinensis]
Length=139

 Score =   120 bits (302),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRTSVNSRGFSIGKNPNPASIKFSGITTYE  138



>ref|YP_007878240.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
 gb|AGA63851.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
Length=141

 Score =   120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMRE  NLL L+RKEQCLAL ++L SK+KI + + YR+FP+GEVQYLHPKDGV PEKVN
Sbjct  51   AIMREDDNLLYLSRKEQCLALSSQLLSKFKIRDCKIYRIFPSGEVQYLHPKDGVVPEKVN  110

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            +GR GVG    SIGKN  P+  KFTG+  Y+
Sbjct  111  SGRIGVGNIDHSIGKNTEPVNKKFTGQNTYE  141



>ref|WP_038547798.1| Photosystem I reaction center subunit II [Synechococcus sp. KORDI-100]
Length=143

 Score =   120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A+M EG N++  ARKEQCLALGT+LR+K+K    NY+ YR+FP G+ ++LHP DGV+PEK
Sbjct  50   AMMNEGDNIMYFARKEQCLALGTQLRTKFKPRIENYKIYRIFPGGDTEFLHPADGVFPEK  109

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  VG N R IG+N++P  +KF+G+  YD
Sbjct  110  VNEGRAMVGHNPRRIGQNVNPANIKFSGRNTYD  142



>ref|WP_028953660.1| Photosystem I reaction center subunit II [Synechococcus sp. CC9616]
Length=143

 Score =   120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A+M EG NL+  ARKEQCLALGT+LR+K+K    NY+ YR+FP G+ ++LHP DGV+PEK
Sbjct  50   AMMNEGDNLMYFARKEQCLALGTQLRTKFKPRIENYKIYRIFPGGDTEFLHPADGVFPEK  109

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  VG N R IG+N++P  +KF+G+  YD
Sbjct  110  VNEGRPIVGHNPRRIGQNVNPANIKFSGRNTYD  142



>ref|WP_023068767.1| photosystem I reaction center subunit II [Lyngbya aestuarii]
 gb|ERT04980.1| photosystem I reaction center subunit II [Lyngbya aestuarii BL 
J]
Length=142

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGTQLRTKFKPKMEDFKIYRIYPNGEMEYLHPKDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR+  G+  R+IG N  P  VKF+GK  Y++
Sbjct  109  VNEGRDFYGKIERNIGSNPDPAKVKFSGKATYEV  142



>ref|WP_032521962.1| Photosystem I reaction center subunit II [Prochlorococcus marinus]
 gb|KGF96016.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9201]
Length=140

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LRS K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRSFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_011377212.1| photosystem I protein PsaD [Prochlorococcus marinus]
 gb|ABB50731.1| photosystem I protein PsaD [Prochlorococcus marinus str. MIT 
9312]
 gb|KGG02282.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9311]
Length=140

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LRS K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRSFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|YP_009029191.1| photosystem I reaction center subunit II (chloroplast) [Didymosphenia 
geminata]
 gb|AGH28722.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Didymosphenia geminata]
Length=139

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+    Y+
Sbjct  108  PGRTAVNSRQFSIGKNPNPASIKFSSFTTYE  138



>ref|WP_009787700.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
 gb|EAW33738.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
Length=142

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGTQLRTKFKPKIEDFKIYRIYPNGEMEYLHPKDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR+  G+  R+IG N  P  VKF+GK  Y++
Sbjct  109  VNEGRDFYGKIERNIGANPDPAKVKFSGKATYEV  142



>ref|WP_019477882.1| MULTISPECIES: Photosystem I reaction center subunit II [Prochlorococcus]
Length=140

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR  K +I N++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMNEGDNLMYFARKEQCLALGTQLRGFKPRIENFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N+SP   KFT K+ YD
Sbjct  109  NEGREQVGHNPRRIGENLSPAKFKFTTKKTYD  140



>gb|AII42441.1| Photosystem I reaction center subunit II [Synechococcus sp. KORDI-100]
Length=165

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A+M EG N++  ARKEQCLALGT+LR+K+K    NY+ YR+FP G+ ++LHP DGV+PEK
Sbjct  72   AMMNEGDNIMYFARKEQCLALGTQLRTKFKPRIENYKIYRIFPGGDTEFLHPADGVFPEK  131

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  VG N R IG+N++P  +KF+G+  YD
Sbjct  132  VNEGRAMVGHNPRRIGQNVNPANIKFSGRNTYD  164



>ref|WP_008189408.1| PsaD [Moorea producens]
 gb|EGJ29445.1| PsaD [Moorea producens 3L]
Length=142

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K    +Y+ YRV+PNGE+Q+LHP DGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGTQLRTKFKPKIEDYKIYRVYPNGEIQFLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR   G+  R+IG N  P  +KF+GK  Y++
Sbjct  109  VNEGRPYAGKIDRNIGSNPEPATIKFSGKAAYEV  142



>ref|YP_009029445.1| photosystem I reaction center subunit II (chloroplast) [Lithodesmium 
undulatum]
 gb|AGH28976.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Lithodesmium undulatum]
Length=139

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVSPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  VKF+G   Y+
Sbjct  108  PGRTAVNSRGFSIGKNPNPASVKFSGISTYE  138



>ref|YP_009028619.1| photosystem I reaction center subunit II (chloroplast) [Asterionella 
formosa]
 gb|AGH28170.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Asterionella formosa]
Length=139

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL L+RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLSRKEQCLALGTQLRT-FKINNYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRTPVNTRDFSIGKNPNPASIKFSGVSTYE  138



>ref|WP_028824843.1| Photosystem I reaction center subunit II [Proteobacteria bacterium 
JGI 0000113-P07]
Length=139

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N
Sbjct  49   AIMRTGQNLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKSN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR        SIGKN +PI VKF+GK  ++
Sbjct  108  EGRVQANNRQFSIGKNPNPIAVKFSGKGTFE  138



>ref|WP_019474331.1| MULTISPECIES: Photosystem I reaction center subunit II [Prochlorococcus]
Length=140

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 74/92 (80%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG N++  ARKEQCLALGT+LR+ K +I N++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNMMYFARKEQCLALGTQLRAFKPRIENFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K+ +D
Sbjct  109  NEGREQVGHNPRRIGENPNPAGLKFTTKKTFD  140



>ref|WP_025900916.1| Photosystem I reaction center subunit II, partial [Prochlorococcus 
sp. scB243_498N8]
Length=93

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  2    AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  61

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  62   NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  93



>ref|WP_025954911.1| Photosystem I reaction center subunit II [Prochlorococcus sp. 
scB243_498C16]
Length=140

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNSRRIGENPNPAGLKFTTKNTFD  140



>gb|EDX77926.1| photosystem I reaction center subunit II [Coleofasciculus chthonoplastes 
PCC 7420]
Length=156

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+++K    +Y+ YR++P+GE+QYLHP DGV+PEK
Sbjct  63   AIMNEGENLLYLARKEQCLALGTQLRTQFKPKMEDYKIYRIYPSGEIQYLHPADGVFPEK  122

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR  VG+  R IG N  P+ +KF+GK  Y++
Sbjct  123  VNEGRPFVGKIDRKIGNNPEPVTLKFSGKATYEV  156



>ref|WP_041622790.1| Photosystem I reaction center subunit II [Oscillatoria nigro-viridis]
Length=141

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALG-TRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIMR+G NLL L RKEQC+ALG  +LR+K+KI NY+ YRVFP+G  +YLHPKDGV+PEKV
Sbjct  49   AIMRQGDNLLHLPRKEQCIALGGQQLRAKFKITNYKIYRVFPDGSTEYLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GR   G+  R+IG N +PI VKFTGK+ YD
Sbjct  109  NEGRPYNGKIDRNIGSNPNPIKVKFTGKKTYD  140



>ref|WP_044204978.1| Photosystem I reaction center subunit II [Coleofasciculus chthonoplastes]
Length=150

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+++K    +Y+ YR++P+GE+QYLHP DGV+PEK
Sbjct  57   AIMNEGENLLYLARKEQCLALGTQLRTQFKPKMEDYKIYRIYPSGEIQYLHPADGVFPEK  116

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR  VG+  R IG N  P+ +KF+GK  Y++
Sbjct  117  VNEGRPFVGKIDRKIGNNPEPVTLKFSGKATYEV  150



>ref|WP_015124443.1| PsaD [Synechococcus sp. PCC 6312]
 gb|AFY60899.1| PsaD [Synechococcus sp. PCC 6312]
Length=140

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTR-LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A+MREG NL+ LARKEQCLAL  + LR +   NYQ YR+FP+GE   LHPKDGV+PEKVN
Sbjct  49   AVMREGENLVYLARKEQCLALAAQQLRPRKINNYQIYRIFPDGESVLLHPKDGVFPEKVN  108

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            AGRE V    RSIG+N SP  +KF+GKQ YD
Sbjct  109  AGREAVNSVPRSIGENPSPGQIKFSGKQPYD  139



>sp|O96800.1|PSAD_SKECO RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Skeletonema costatum]
 emb|CAA10621.1| PSI ferredoxin-binding protein II [Skeletonema costatum]
Length=139

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRTSVNSRGFSIGKNPNPASIKFSGITTYE  138



>ref|WP_007305646.1| Photosystem I protein PsaD [Crocosphaera watsonii]
 gb|EAM50690.1| Photosystem I protein PsaD [Crocosphaera watsonii WH 8501]
 emb|CCQ60541.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0401]
 emb|CCQ48941.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 8502]
 emb|CCQ56533.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0005]
 emb|CCQ65642.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0402]
Length=142

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM EG NLL LARKEQCLALGT+LR+K+K    +Y+ YRV+P+GE+QYLHP DGV+PEK
Sbjct  49   AIMNEGENLLYLARKEQCLALGTQLRTKFKPRIQDYKIYRVYPSGEIQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G+  R IG N  P+ +KF+G   YD+
Sbjct  109  VNEGREYNGKIDRKIGDNPEPVTLKFSGNAPYDV  142



>gb|AFR24825.1| photosystem I reaction center subunit II [uncultured Pelagomonas]
Length=139

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N
Sbjct  49   AIMRTGQNLLYLARKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKSN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR        SIGKN +P+ VKF+GK  ++
Sbjct  108  EGRVQANNRQFSIGKNPNPVAVKFSGKGTFE  138



>ref|WP_025927078.1| Photosystem I reaction center subunit II [Prochlorococcus sp. 
scB241_528J8]
Length=140

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_011863680.1| MULTISPECIES: photosystem I protein PsaD [Prochlorococcus]
 gb|ABO18392.1| Photosystem I protein PsaD [Prochlorococcus marinus str. MIT 
9301]
Length=140

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|NP_849051.1| photosystem I subunit II [Cyanidioschyzon merolae strain 10D]
 dbj|BAC76213.1| photosystem I p700 chlorophyll A apoprotein A2 (chloroplast) 
[Cyanidioschyzon merolae strain 10D]
Length=139

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A+M  G NLL LARKEQ LAL T+LR+++KI +Y+ YR+FP+GEVQYLHPKDGV P +VN
Sbjct  48   AVMNSGDNLLYLARKEQALALATQLRTQFKIQDYKIYRIFPSGEVQYLHPKDGVLPYQVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GRE VG+   +IGKN++P  VKFT K  YD
Sbjct  108  KGREQVGRVKSTIGKNVNPAQVKFTSKATYD  138



>gb|ABE11137.1| photosystem I protein PsaD [uncultured Prochlorococcus marinus 
clone HF10-11H11]
Length=140

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|YP_874547.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 ref|XP_002297531.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|ABK20770.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 gb|EED86171.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=139

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRTSVNSRGFSIGKNPNPASIKFSGITTYE  138



>ref|WP_025915179.1| Photosystem I reaction center subunit II [Prochlorococcus sp. 
scB245a_520K10]
Length=140

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|YP_003002042.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
 gb|ACS36806.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
Length=139

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  193
            AIMR G NLL LARKEQCLALGT+LR+    +Y+ YR+FP+GEVQYLHPKDGV+PEK N 
Sbjct  49   AIMRTGQNLLYLARKEQCLALGTQLRTFKITDYKIYRIFPSGEVQYLHPKDGVFPEKSNE  108

Query  192  GREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            GR        SIGKN +P+ VKF+GK  ++
Sbjct  109  GRVQANNRQFSIGKNPNPVAVKFSGKGTFE  138



>ref|WP_025956224.1| Photosystem I reaction center subunit II [Prochlorococcus sp. 
scB243_498I20]
Length=140

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_025889562.1| MULTISPECIES: Photosystem I reaction center subunit II [Prochlorococcus]
Length=140

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>gb|AFZ10051.1| photosystem I protein PsaD [Oscillatoria nigro-viridis PCC 7112]
Length=154

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALG-TRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIMR+G NLL L RKEQC+ALG  +LR+K+KI NY+ YRVFP+G  +YLHPKDGV+PEKV
Sbjct  62   AIMRQGDNLLHLPRKEQCIALGGQQLRAKFKITNYKIYRVFPDGSTEYLHPKDGVFPEKV  121

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GR   G+  R+IG N +PI VKFTGK+ YD
Sbjct  122  NEGRPYNGKIDRNIGSNPNPIKVKFTGKKTYD  153



>ref|WP_032513725.1| Photosystem I reaction center subunit II [Prochlorococcus marinus]
 gb|KGF91386.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9107]
 gb|KGF91752.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9116]
 gb|KGF93858.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9123]
Length=140

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            A+M EG NL+  ARKEQCLALGT+LR+ K +I +++ YRVFP G++++LHPKDGV+PEKV
Sbjct  49   AVMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRVFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_025937671.1| MULTISPECIES: Photosystem I reaction center subunit II [Prochlorococcus]
Length=140

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMNEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_017288063.1| Photosystem I reaction center subunit II [Leptolyngbya boryana]
Length=140

 Score =   118 bits (296),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            A MR+G NLL LARKE CLALG +LR+K+KI NY+ YRVFPNGE+QYLHP DGV+PEKVN
Sbjct  49   AKMRQGDNLLYLARKEHCLALGGQLRTKFKITNYKIYRVFPNGEIQYLHPADGVFPEKVN  108

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V    R+IG N  P  +KF+G+  YD
Sbjct  109  EGRVAVNSVPRNIGSNPEPAKLKFSGRLPYD  139



>ref|YP_009093464.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
 gb|AIR76137.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
Length=139

 Score =   118 bits (296),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  +     SIGKN  P  +KF+G   Y+
Sbjct  108  PGRTSINSRGFSIGKNPEPASIKFSGITTYE  138



>ref|WP_012593753.1| MULTISPECIES: photosystem I protein PsaD [Cyanothece]
 gb|ACK64476.1| photosystem I protein PsaD [Cyanothece sp. PCC 8801]
 gb|ACU99346.1| photosystem I protein PsaD [Cyanothece sp. PCC 8802]
Length=142

 Score =   118 bits (296),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM +G NLL LARKEQCLALGT+LR+K+K    +Y+ YR++P+GE QYLHP DGV+PEK
Sbjct  49   AIMNKGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRIYPSGETQYLHPADGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GRE  G+  R IG N  P  +KF+GK  YD+
Sbjct  109  VNEGREFNGKKDRKIGDNPEPATLKFSGKAPYDV  142



>ref|WP_032526300.1| Photosystem I reaction center subunit II [Prochlorococcus marinus]
 gb|KGF98188.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9302]
Length=140

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDMEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_032517906.1| Photosystem I reaction center subunit II [Prochlorococcus marinus]
 gb|KGG03151.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9321]
 gb|KGG06543.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9322]
 gb|KGG07640.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9401]
Length=140

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I  ++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEEFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_010314860.1| photosystem I protein PsaD [Synechococcus sp. CB0205]
Length=140

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A M EG NL+  ARKEQCLALGT+LR+K+K    +Y+ YR+FP G+ ++LHPKDGV+PEK
Sbjct  47   AHMNEGENLMYFARKEQCLALGTQLRTKFKPRIEDYKIYRIFPGGDTEFLHPKDGVFPEK  106

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR+ VG N R IG+N +P  +KF GK  +D
Sbjct  107  VNEGRQMVGHNARRIGQNGNPASIKFIGKNTFD  139



>ref|WP_042851104.1| Photosystem I reaction center subunit II [Prochlorococcus sp. 
MIT 0604]
 gb|AIQ95943.1| photosystem I subunit II (PsaD) [Prochlorococcus sp. MIT 0604]
Length=140

 Score =   118 bits (295),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            AIM EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G+ ++LHPKDGV+PEKV
Sbjct  49   AIMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDTEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_006042180.1| photosystem I reaction center subunit II (PsaD) [Synechococcus 
sp. WH 7805]
 gb|EAR19055.1| photosystem I reaction center subunit II (PsaD) [Synechococcus 
sp. WH 7805]
Length=143

 Score =   118 bits (296),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A+M  G N++  ARKEQCLALGT+LR+K+K    +Y+ YR+FP G+ +YLHP DGV+PEK
Sbjct  50   AMMNAGENIMYFARKEQCLALGTQLRTKFKPRIEDYKIYRIFPGGDTEYLHPSDGVFPEK  109

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  VG N R IG+NI+P  +KF+G+  +D
Sbjct  110  VNEGRAMVGHNPRRIGQNINPANIKFSGRNTFD  142



>ref|YP_009093191.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
 gb|AIR75864.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
Length=139

 Score =   118 bits (295),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVN  196
            AIMR G NLL LARKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN
Sbjct  49   AIMRNGENLLYLARKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVN  107

Query  195  AGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
             GR  V     SIGKN +P  +KF+G   Y+
Sbjct  108  PGRVSVNSRGFSIGKNPNPASIKFSGITTYE  138



>ref|WP_011819190.1| photosystem I protein PsaD [Prochlorococcus marinus]
 gb|ABM71068.1| Photosystem I protein PsaD [Prochlorococcus marinus str. AS9601]
 gb|KGG00573.1| photosystem I subunit II (PsaD) [Prochlorococcus marinus str. 
MIT 9314]
Length=140

 Score =   118 bits (295),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRS-KYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKV  199
            A+M EG NL+  ARKEQCLALGT+LR+ K +I +++ YR+FP G++++LHPKDGV+PEKV
Sbjct  49   ALMHEGDNLMYFARKEQCLALGTQLRAFKPRIEDFKIYRIFPGGDIEFLHPKDGVFPEKV  108

Query  198  NAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            N GRE VG N R IG+N +P G+KFT K  +D
Sbjct  109  NEGREKVGHNPRRIGENPNPAGLKFTTKNTFD  140



>ref|WP_017715328.1| Photosystem I reaction center subunit II [Oscillatoria sp. PCC 
10802]
Length=142

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            AIM +G NLL LARKEQCLALG +LR+K+K    +Y+ YR++ NGE+QYLHP DGV+PEK
Sbjct  49   AIMHQGQNLLYLARKEQCLALGAQLRTKFKPKIEDYKIYRIYANGEIQYLHPNDGVFPEK  108

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYDL  100
            VN GR  VG+  R+IG N  P  VKF+G++ Y++
Sbjct  109  VNEGRASVGKKDRNIGSNPQPATVKFSGQRTYEV  142



>ref|WP_010311728.1| photosystem I protein PsaD [Synechococcus sp. CB0101]
Length=140

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -1

Query  372  AIMREGANLLKLARKEQCLALGTRLRSKYKI---NYQFYRVFPNGEVQYLHPKDGVYPEK  202
            A M EG N++  ARKEQCLALGT+LR+K+K    +Y+ YR+FP G+ ++LHPKDGV+PEK
Sbjct  47   AHMNEGENIMYFARKEQCLALGTQLRTKFKPRIEDYKIYRIFPGGDTEFLHPKDGVFPEK  106

Query  201  VNAGREGVGQNMRSIGKNISPIGVKFTGKQVYD  103
            VN GR  VG N R IG+N +P  +KFTGK  +D
Sbjct  107  VNEGRLMVGHNARRIGQNGNPASIKFTGKNTFD  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005