BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051E12

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614908.1|  PREDICTED: sugar transporter ERD6-like 7           203   4e-59   Nicotiana tomentosiformis
ref|XP_006358441.1|  PREDICTED: sugar transporter ERD6-like 7-like      202   1e-58   Solanum tuberosum [potatoes]
dbj|BAO96226.1|  sugar-porter family protein 7                          201   1e-58   Solanum lycopersicum
ref|NP_001233882.1|  st3 protein                                        202   2e-58   
ref|XP_009777420.1|  PREDICTED: sugar transporter ERD6-like 7           202   2e-58   Nicotiana sylvestris
ref|XP_004292608.2|  PREDICTED: sugar transporter ERD6-like 7           193   3e-55   Fragaria vesca subsp. vesca
ref|XP_010507819.1|  PREDICTED: sugar transporter ERD6-like 7           184   4e-55   Camelina sativa [gold-of-pleasure]
gb|AFK48468.1|  unknown                                                 184   4e-55   Lotus japonicus
ref|XP_007050715.1|  Major facilitator superfamily protein isoform 1    192   6e-55   
gb|KHG20787.1|  hypothetical protein F383_26710                         190   7e-55   Gossypium arboreum [tree cotton]
gb|EYU43551.1|  hypothetical protein MIMGU_mgv1a005532mg                191   1e-54   Erythranthe guttata [common monkey flower]
ref|XP_008234933.1|  PREDICTED: sugar transporter ERD6-like 7           191   2e-54   
ref|XP_010512799.1|  PREDICTED: sugar transporter ERD6-like 7           186   2e-54   
ref|XP_010112685.1|  Sugar transporter ERD6-like 7                      190   3e-54   
ref|XP_007200994.1|  hypothetical protein PRUPE_ppa005144mg             190   3e-54   Prunus persica
ref|XP_004493632.1|  PREDICTED: sugar transporter ERD6-like 7-like      189   7e-54   Cicer arietinum [garbanzo]
ref|XP_008234934.1|  PREDICTED: sugar transporter ERD6-like 7           189   9e-54   
gb|KEH23690.1|  sugar porter (SP) family MFS transporter                189   1e-53   Medicago truncatula
ref|XP_010512800.1|  PREDICTED: sugar transporter ERD6-like 7           185   1e-53   
gb|KJB23160.1|  hypothetical protein B456_004G084300                    188   2e-53   Gossypium raimondii
gb|KCW58958.1|  hypothetical protein EUGRSUZ_H015842                    178   2e-53   Eucalyptus grandis [rose gum]
gb|KCW58969.1|  hypothetical protein EUGRSUZ_H01597                     182   2e-53   Eucalyptus grandis [rose gum]
ref|XP_010107672.1|  Sugar transporter ERD6-like 7                      187   3e-53   
gb|KHG14417.1|  hypothetical protein F383_03945                         187   3e-53   Gossypium arboreum [tree cotton]
gb|KDO87479.1|  hypothetical protein CISIN_1g033094mg                   177   3e-53   Citrus sinensis [apfelsine]
ref|XP_008386585.1|  PREDICTED: sugar transporter ERD6-like 7           187   4e-53   
emb|CDP03586.1|  unnamed protein product                                186   9e-53   Coffea canephora [robusta coffee]
gb|KHN19852.1|  Sugar transporter ERD6-like 7                           186   1e-52   Glycine soja [wild soybean]
ref|XP_003521224.1|  PREDICTED: sugar transporter ERD6-like 7-like      186   1e-52   Glycine max [soybeans]
ref|XP_011079781.1|  PREDICTED: sugar transporter ERD6-like 7           186   1e-52   Sesamum indicum [beniseed]
ref|XP_010026273.1|  PREDICTED: sugar transporter ERD6-like 7           181   2e-52   Eucalyptus grandis [rose gum]
gb|KFK37554.1|  hypothetical protein AALP_AA4G271800                    185   2e-52   Arabis alpina [alpine rockcress]
ref|XP_003554233.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    185   3e-52   Glycine max [soybeans]
ref|XP_008386586.1|  PREDICTED: sugar transporter ERD6-like 7           185   3e-52   
ref|XP_010507821.1|  PREDICTED: sugar transporter ERD6-like 7           184   4e-52   
ref|XP_010242565.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    184   4e-52   
ref|XP_010242564.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    185   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010242566.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    184   4e-52   
gb|KEH23721.1|  sugar porter (SP) family MFS transporter                184   6e-52   Medicago truncatula
ref|XP_006409064.1|  hypothetical protein EUTSA_v10022677mg             184   6e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010026252.1|  PREDICTED: sugar transporter ERD6-like 7           176   9e-52   
emb|CDY01404.1|  BnaA07g11770D                                          184   9e-52   
ref|XP_004290697.1|  PREDICTED: sugar transporter ERD6-like 7           184   9e-52   Fragaria vesca subsp. vesca
ref|XP_007162379.1|  hypothetical protein PHAVU_001G147100g             183   1e-51   Phaseolus vulgaris [French bean]
gb|KHN45387.1|  Sugar transporter ERD6-like 7                           182   2e-51   Glycine soja [wild soybean]
ref|XP_002524779.1|  sugar transporter, putative                        183   2e-51   Ricinus communis
gb|AAM61246.1|  putative sugar transporter                              183   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103393.1|  PREDICTED: sugar transporter ERD6-like 7           183   2e-51   Brassica rapa
ref|NP_566120.1|  sugar transporter ERD6-like 7                         182   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290698.1|  PREDICTED: sugar transporter ERD6-like 7           182   2e-51   Fragaria vesca subsp. vesca
gb|KJB47011.1|  hypothetical protein B456_008G006300                    183   2e-51   Gossypium raimondii
ref|XP_002880340.1|  hypothetical protein ARALYDRAFT_483991             182   3e-51   
ref|XP_010042802.1|  PREDICTED: sugar transporter ERD6-like 7           172   3e-51   
ref|XP_006444170.1|  hypothetical protein CICLE_v10019923mg             180   3e-51   
gb|KCW58928.1|  hypothetical protein EUGRSUZ_H015512                    174   3e-51   Eucalyptus grandis [rose gum]
ref|XP_010107671.1|  Sugar transporter ERD6-like 7                      179   4e-51   
ref|XP_007162380.1|  hypothetical protein PHAVU_001G147200g             182   5e-51   Phaseolus vulgaris [French bean]
ref|XP_008235073.1|  PREDICTED: sugar transporter ERD6-like 7           182   5e-51   Prunus mume [ume]
ref|XP_007201571.1|  hypothetical protein PRUPE_ppa018319mg             182   5e-51   
ref|XP_010667578.1|  PREDICTED: sugar transporter ERD6-like 7           182   5e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009102177.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    181   6e-51   
emb|CDY39145.1|  BnaA07g01410D                                          181   6e-51   Brassica napus [oilseed rape]
ref|XP_008386584.1|  PREDICTED: sugar transporter ERD6-like 7           181   7e-51   
ref|XP_004140089.1|  PREDICTED: sugar transporter ERD6-like 7-like      181   7e-51   Cucumis sativus [cucumbers]
ref|XP_010545075.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    179   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_004292610.1|  PREDICTED: sugar transporter ERD6-like 7           182   8e-51   Fragaria vesca subsp. vesca
emb|CDX82668.1|  BnaC07g01980D                                          181   8e-51   
emb|CDY12861.1|  BnaC07g15720D                                          181   9e-51   Brassica napus [oilseed rape]
gb|KJB47013.1|  hypothetical protein B456_008G006300                    181   9e-51   Gossypium raimondii
ref|XP_008368891.1|  PREDICTED: sugar transporter ERD6-like 7           181   1e-50   
ref|XP_006444171.1|  hypothetical protein CICLE_v10019923mg             181   1e-50   Citrus clementina [clementine]
gb|KDP21525.1|  hypothetical protein JCGZ_21996                         181   1e-50   Jatropha curcas
ref|XP_006444169.1|  hypothetical protein CICLE_v10019923mg             181   1e-50   
ref|XP_010070279.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    180   2e-50   
ref|XP_010545070.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    180   3e-50   
ref|XP_010070277.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    180   3e-50   Eucalyptus grandis [rose gum]
ref|XP_011009474.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    179   3e-50   Populus euphratica
emb|CBI32306.3|  unnamed protein product                                179   4e-50   Vitis vinifera
ref|XP_011009473.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    179   4e-50   Populus euphratica
ref|XP_002302812.2|  sugar transporter family protein                   179   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010070313.1|  PREDICTED: sugar transporter ERD6-like 7           179   5e-50   Eucalyptus grandis [rose gum]
ref|XP_004158614.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    179   6e-50   
ref|XP_002270927.2|  PREDICTED: sugar transporter ERD6-like 7           179   6e-50   Vitis vinifera
gb|EPS59997.1|  hypothetical protein M569_14807                         179   6e-50   Genlisea aurea
ref|XP_010070291.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    178   9e-50   Eucalyptus grandis [rose gum]
ref|XP_010070290.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    178   1e-49   Eucalyptus grandis [rose gum]
gb|KCW58947.1|  hypothetical protein EUGRSUZ_H01571                     178   2e-49   Eucalyptus grandis [rose gum]
ref|XP_008449464.1|  PREDICTED: sugar transporter ERD6-like 7           177   4e-49   Cucumis melo [Oriental melon]
ref|XP_002320384.1|  sugar transporter family protein                   169   1e-46   
ref|XP_006444168.1|  hypothetical protein CICLE_v10019918mg             169   4e-46   Citrus clementina [clementine]
ref|XP_010242562.1|  PREDICTED: sugar transporter ERD6-like 7           168   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_002512320.1|  sugar transporter, putative                        166   4e-45   
ref|XP_011033659.1|  PREDICTED: sugar transporter ERD6-like 7           166   4e-45   Populus euphratica
ref|XP_010105671.1|  Sugar transporter ERD6-like 16                     164   1e-44   
ref|XP_010242560.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    164   2e-44   Nelumbo nucifera [Indian lotus]
gb|KJB72536.1|  hypothetical protein B456_011G183500                    164   2e-44   Gossypium raimondii
gb|KDO74959.1|  hypothetical protein CISIN_1g018767mg                   161   3e-44   Citrus sinensis [apfelsine]
ref|XP_008809152.1|  PREDICTED: sugar transporter ERD6-like 16          162   4e-44   
ref|XP_010912096.1|  PREDICTED: sugar transporter ERD6-like 16          163   4e-44   Elaeis guineensis
ref|XP_006356995.1|  PREDICTED: sugar transporter ERD6-like 16-like     162   7e-44   Solanum tuberosum [potatoes]
ref|XP_006419726.1|  hypothetical protein CICLE_v10004839mg             161   8e-44   
ref|XP_004229493.1|  PREDICTED: sugar transporter ERD6-like 16          162   1e-43   Solanum lycopersicum
ref|XP_008438776.1|  PREDICTED: sugar transporter ERD6-like 16 is...    161   2e-43   Cucumis melo [Oriental melon]
ref|XP_008223080.1|  PREDICTED: sugar transporter ERD6-like 16          162   2e-43   Prunus mume [ume]
ref|XP_008438774.1|  PREDICTED: sugar transporter ERD6-like 16 is...    162   2e-43   Cucumis melo [Oriental melon]
ref|XP_007222121.1|  hypothetical protein PRUPE_ppa004636mg             162   2e-43   Prunus persica
ref|XP_008438775.1|  PREDICTED: sugar transporter ERD6-like 16 is...    161   2e-43   Cucumis melo [Oriental melon]
ref|XP_011090877.1|  PREDICTED: sugar transporter ERD6-like 16          161   2e-43   Sesamum indicum [beniseed]
ref|XP_010024484.1|  PREDICTED: sugar transporter ERD6-like 16 is...    160   2e-43   Eucalyptus grandis [rose gum]
ref|XP_008795113.1|  PREDICTED: sugar transporter ERD6-like 16 is...    161   3e-43   
ref|XP_008438773.1|  PREDICTED: sugar transporter ERD6-like 16 is...    161   3e-43   Cucumis melo [Oriental melon]
ref|XP_006419729.1|  hypothetical protein CICLE_v10004839mg             161   3e-43   Citrus clementina [clementine]
ref|XP_010024483.1|  PREDICTED: sugar transporter ERD6-like 16 is...    161   3e-43   Eucalyptus grandis [rose gum]
gb|KDP23565.1|  hypothetical protein JCGZ_23398                         159   3e-43   Jatropha curcas
ref|XP_008795112.1|  PREDICTED: sugar transporter ERD6-like 16 is...    161   3e-43   Phoenix dactylifera
emb|CDO98940.1|  unnamed protein product                                160   8e-43   Coffea canephora [robusta coffee]
ref|XP_007207811.1|  hypothetical protein PRUPE_ppa023976mg             150   9e-43   
gb|KJB28573.1|  hypothetical protein B456_005G056400                    160   9e-43   Gossypium raimondii
ref|XP_009603615.1|  PREDICTED: sugar transporter ERD6-like 16 is...    158   9e-43   Nicotiana tomentosiformis
ref|XP_007035424.1|  Major facilitator superfamily protein              160   1e-42   Theobroma cacao [chocolate]
ref|XP_010279404.1|  PREDICTED: sugar transporter ERD6-like 16 is...    159   1e-42   
dbj|BAH01094.1|  unnamed protein product                                159   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|ADP37168.1|  putative ERD6-like transporter                          159   1e-42   Vitis vinifera
ref|XP_004134178.1|  PREDICTED: sugar transporter ERD6-like 16-like     159   1e-42   Cucumis sativus [cucumbers]
ref|XP_010279395.1|  PREDICTED: sugar transporter ERD6-like 16 is...    159   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010660046.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    159   2e-42   
ref|XP_010660047.1|  PREDICTED: sugar transporter ERD6-like 8           159   2e-42   
ref|XP_010660044.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    159   2e-42   
ref|XP_006577261.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    159   2e-42   Glycine max [soybeans]
ref|XP_003521722.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    159   2e-42   Glycine max [soybeans]
ref|XP_003609563.1|  Sugar transporter ERD6-like protein                159   3e-42   Medicago truncatula
gb|KHG12382.1|  hypothetical protein F383_10647                         159   3e-42   Gossypium arboreum [tree cotton]
emb|CBI26138.3|  unnamed protein product                                157   3e-42   Vitis vinifera
emb|CDY13925.1|  BnaC09g39010D                                          149   3e-42   Brassica napus [oilseed rape]
ref|XP_009603614.1|  PREDICTED: sugar transporter ERD6-like 16 is...    158   3e-42   Nicotiana tomentosiformis
ref|XP_009414205.1|  PREDICTED: sugar transporter ERD6-like 16          158   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010660042.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    158   4e-42   
ref|XP_010660043.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    158   4e-42   
ref|XP_002278197.1|  PREDICTED: sugar transporter ERD6-like 16 is...    158   5e-42   Vitis vinifera
emb|CBI34327.3|  unnamed protein product                                159   5e-42   Vitis vinifera
gb|EYU43869.1|  hypothetical protein MIMGU_mgv1a018596mg                157   6e-42   Erythranthe guttata [common monkey flower]
ref|XP_003575758.2|  PREDICTED: sugar transporter ERD6-like 16          157   6e-42   
ref|XP_002882396.1|  sugar transporter family protein                   157   7e-42   
tpg|DAA53930.1|  TPA: hypothetical protein ZEAMMB73_856317              151   8e-42   
ref|XP_002512323.1|  sugar transporter, putative                        157   9e-42   Ricinus communis
gb|AAF27021.1|AC009177_11  putative sugar transporter                   157   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187166.2|  sugar transporter ERD6-like 8                         157   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626331.1|  Sugar transporter ERD6, putative                   157   1e-41   
gb|KHN43250.1|  Sugar transporter ERD6-like 5                           156   1e-41   Glycine soja [wild soybean]
emb|CBI34326.3|  unnamed protein product                                160   1e-41   Vitis vinifera
gb|ABN09011.1|  General substrate transporter; Sugar transporter ...    157   1e-41   Medicago truncatula
ref|XP_009774898.1|  PREDICTED: sugar transporter ERD6-like 16 is...    155   1e-41   Nicotiana sylvestris
gb|KJB45167.1|  hypothetical protein B456_007G293200                    157   1e-41   Gossypium raimondii
ref|XP_006663074.1|  PREDICTED: sugar transporter ERD6-like 16-like     156   2e-41   Oryza brachyantha
ref|XP_007205125.1|  hypothetical protein PRUPE_ppa004943mg             156   2e-41   
ref|XP_003553740.2|  PREDICTED: sugar transporter ERD6-like 5-like      156   3e-41   
ref|XP_009774897.1|  PREDICTED: sugar transporter ERD6-like 16 is...    155   3e-41   Nicotiana sylvestris
ref|XP_008458507.1|  PREDICTED: sugar transporter ERD6-like 16          155   3e-41   Cucumis melo [Oriental melon]
ref|XP_006299027.1|  hypothetical protein CARUB_v10015164mg             155   4e-41   Capsella rubella
ref|XP_008246533.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    155   4e-41   Prunus mume [ume]
gb|AES77878.2|  sugar transporter                                       147   4e-41   Medicago truncatula
ref|XP_004494647.1|  PREDICTED: sugar transporter ERD6-like 5-like      155   4e-41   Cicer arietinum [garbanzo]
ref|XP_008388978.1|  PREDICTED: sugar transporter ERD6-like 5           152   5e-41   
ref|XP_010941736.1|  PREDICTED: sugar transporter ERD6-like 16          155   5e-41   Elaeis guineensis
ref|XP_008246532.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    155   6e-41   Prunus mume [ume]
ref|XP_010485917.1|  PREDICTED: sugar transporter ERD6-like 8           154   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011090878.1|  PREDICTED: sugar transporter ERD6-like 16 is...    154   9e-41   Sesamum indicum [beniseed]
ref|XP_009419855.1|  PREDICTED: sugar transporter ERD6-like 16 is...    154   1e-40   
ref|XP_010423926.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    152   1e-40   
ref|XP_007226898.1|  hypothetical protein PRUPE_ppa016361mg             154   1e-40   
ref|XP_009419854.1|  PREDICTED: sugar transporter ERD6-like 16 is...    154   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002319570.2|  sugar transporter family protein                   154   1e-40   
ref|XP_004508324.1|  PREDICTED: sugar transporter ERD6-like 16-like     154   1e-40   Cicer arietinum [garbanzo]
ref|XP_002263418.1|  PREDICTED: sugar transporter ERD6-like 5           154   1e-40   
ref|XP_010912097.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    154   1e-40   Elaeis guineensis
ref|XP_003621660.1|  Sugar transporter ERD6-like protein                145   1e-40   
ref|XP_006400440.1|  hypothetical protein EUTSA_v10013389mg             154   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_011462680.1|  PREDICTED: sugar transporter ERD6-like 16 is...    152   2e-40   Fragaria vesca subsp. vesca
ref|XP_009620983.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    152   2e-40   Nicotiana tomentosiformis
emb|CBI34338.3|  unnamed protein product                                154   2e-40   Vitis vinifera
ref|XP_007030780.1|  Major facilitator superfamily protein              154   2e-40   
ref|XP_002315546.2|  hypothetical protein POPTR_0010s02740g             154   2e-40   
ref|XP_010464026.1|  PREDICTED: sugar transporter ERD6-like 8           153   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007147846.1|  hypothetical protein PHAVU_006G159600g             154   2e-40   Phaseolus vulgaris [French bean]
ref|XP_010043109.1|  PREDICTED: sugar transporter ERD6-like 5           153   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010666329.1|  PREDICTED: sugar transporter ERD6-like 16          153   3e-40   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX92578.1|  BnaA10g16170D                                          153   3e-40   
ref|XP_010492922.1|  PREDICTED: sugar transporter ERD6-like 16          153   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004296777.1|  PREDICTED: sugar transporter ERD6-like 16 is...    153   3e-40   Fragaria vesca subsp. vesca
ref|XP_011023522.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    153   3e-40   Populus euphratica
ref|XP_009120937.1|  PREDICTED: sugar transporter ERD6-like 16          153   3e-40   Brassica rapa
ref|XP_011466327.1|  PREDICTED: sugar transporter ERD6-like 5           153   4e-40   Fragaria vesca subsp. vesca
ref|XP_009782756.1|  PREDICTED: sugar transporter ERD6-like 5           152   4e-40   Nicotiana sylvestris
ref|XP_007050737.1|  Major facilitator superfamily protein              152   4e-40   
ref|XP_008223079.1|  PREDICTED: sugar transporter ERD6-like 16          152   4e-40   
ref|XP_010454136.1|  PREDICTED: sugar transporter ERD6-like 16 is...    152   5e-40   
ref|NP_568367.1|  sugar transporter ERD6-like 16                        152   5e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64736.1|  sugar transporter-like protein                          152   5e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KDP40049.1|  hypothetical protein JCGZ_02047                         152   6e-40   Jatropha curcas
ref|XP_009620982.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    152   6e-40   Nicotiana tomentosiformis
ref|XP_008340870.1|  PREDICTED: sugar transporter ERD6-like 16          152   6e-40   
ref|XP_011011018.1|  PREDICTED: sugar transporter ERD6-like 16          152   7e-40   Populus euphratica
ref|XP_008359875.1|  PREDICTED: sugar transporter ERD6-like 5           152   7e-40   
ref|XP_009417911.1|  PREDICTED: sugar transporter ERD6-like 5           152   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010546662.1|  PREDICTED: sugar transporter ERD6-like 8           152   8e-40   Tarenaya hassleriana [spider flower]
ref|XP_010420663.1|  PREDICTED: sugar transporter ERD6-like 16 is...    152   8e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008672347.1|  PREDICTED: hypothetical protein isoform X2         151   8e-40   
ref|XP_010420662.1|  PREDICTED: sugar transporter ERD6-like 16 is...    152   8e-40   Camelina sativa [gold-of-pleasure]
gb|KDO44993.1|  hypothetical protein CISIN_1g011956mg                   150   8e-40   Citrus sinensis [apfelsine]
ref|XP_003520821.1|  PREDICTED: sugar transporter ERD6-like 5-like      152   8e-40   Glycine max [soybeans]
ref|XP_009352178.1|  PREDICTED: sugar transporter ERD6-like 16          152   8e-40   Pyrus x bretschneideri [bai li]
gb|KDO44992.1|  hypothetical protein CISIN_1g011956mg                   152   9e-40   Citrus sinensis [apfelsine]
ref|XP_009591842.1|  PREDICTED: sugar transporter ERD6-like 8           147   9e-40   Nicotiana tomentosiformis
ref|XP_006433198.1|  hypothetical protein CICLE_v10001032mg             152   9e-40   Citrus clementina [clementine]
ref|XP_011087867.1|  PREDICTED: sugar transporter ERD6-like 5           151   1e-39   Sesamum indicum [beniseed]
gb|ACN26851.1|  unknown                                                 151   1e-39   Zea mays [maize]
ref|XP_008672346.1|  PREDICTED: hypothetical protein isoform X1         151   1e-39   Zea mays [maize]
ref|XP_009758159.1|  PREDICTED: sugar transporter ERD6-like 8           147   1e-39   Nicotiana sylvestris
ref|XP_002871845.1|  hypothetical protein ARALYDRAFT_488771             151   1e-39   
ref|XP_003626332.1|  Sugar transporter ERD6-like protein                151   1e-39   Medicago truncatula
gb|KDP23561.1|  hypothetical protein JCGZ_23394                         151   2e-39   Jatropha curcas
ref|XP_004164629.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    150   2e-39   
ref|XP_004157263.1|  PREDICTED: sugar transporter ERD6-like 5-like      150   2e-39   
ref|XP_007147091.1|  hypothetical protein PHAVU_006G095600g             151   2e-39   Phaseolus vulgaris [French bean]
gb|KEH36721.1|  sugar porter (SP) family MFS transporter                149   2e-39   Medicago truncatula
ref|XP_004135636.1|  PREDICTED: sugar transporter ERD6-like 5-like      150   2e-39   
ref|XP_010546910.1|  PREDICTED: sugar transporter ERD6-like 16          151   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_004153836.1|  PREDICTED: sugar transporter ERD6-like 16-like     150   2e-39   Cucumis sativus [cucumbers]
gb|KGN66112.1|  hypothetical protein Csa_1G571840                       151   2e-39   Cucumis sativus [cucumbers]
ref|XP_004967879.1|  PREDICTED: sugar transporter ERD6-like 5-like      150   2e-39   Setaria italica
ref|XP_002457558.1|  hypothetical protein SORBIDRAFT_03g009310          149   2e-39   
ref|XP_010242561.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    150   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_003547222.2|  PREDICTED: sugar transporter ERD6-like 16-like     150   2e-39   Glycine max [soybeans]
ref|XP_008366851.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    150   2e-39   
emb|CDY30026.1|  BnaC01g39820D                                          150   3e-39   Brassica napus [oilseed rape]
ref|XP_009124970.1|  PREDICTED: sugar transporter ERD6-like 8           150   3e-39   Brassica rapa
ref|XP_006287631.1|  hypothetical protein CARUB_v10000842mg             150   3e-39   Capsella rubella
ref|XP_006845811.1|  hypothetical protein AMTR_s00019p00256520          148   3e-39   
ref|XP_008795118.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    148   3e-39   
ref|XP_003594043.1|  Sugar transporter ERD6-like protein                150   4e-39   Medicago truncatula
ref|XP_009373955.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    150   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_008795117.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    148   5e-39   
gb|KHN33102.1|  Sugar transporter ERD6-like 16                          149   6e-39   Glycine soja [wild soybean]
ref|XP_003580968.1|  PREDICTED: sugar transporter ERD6-like 5           149   6e-39   Brachypodium distachyon [annual false brome]
ref|NP_001146190.1|  uncharacterized protein LOC100279760               149   6e-39   Zea mays [maize]
gb|KHN37528.1|  Sugar transporter ERD6-like 16                          149   7e-39   Glycine soja [wild soybean]
gb|EEC80176.1|  hypothetical protein OsI_22030                          148   7e-39   Oryza sativa Indica Group [Indian rice]
gb|EYU27040.1|  hypothetical protein MIMGU_mgv1a022081mg                146   7e-39   Erythranthe guttata [common monkey flower]
ref|XP_010070278.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    149   8e-39   
ref|XP_003541649.1|  PREDICTED: sugar transporter ERD6-like 16-like     149   8e-39   Glycine max [soybeans]
ref|XP_008795116.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    147   8e-39   
ref|XP_008450692.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    147   9e-39   Cucumis melo [Oriental melon]
ref|XP_004230159.2|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    149   1e-38   
ref|XP_007030775.1|  Major facilitator superfamily protein, putative    147   1e-38   
gb|ABA95042.1|  Sugar transporter family protein, expressed             147   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008795114.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    147   1e-38   
ref|XP_008795119.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    147   1e-38   
ref|XP_007147087.1|  hypothetical protein PHAVU_006G095200g             148   1e-38   Phaseolus vulgaris [French bean]
dbj|BAJ93725.1|  predicted protein                                      148   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006361887.1|  PREDICTED: sugar transporter ERD6-like 5-like      148   2e-38   Solanum tuberosum [potatoes]
ref|XP_006594464.1|  PREDICTED: sugar transporter ERD6-like 16-li...    148   2e-38   
ref|XP_008450691.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    148   2e-38   
emb|CDP17983.1|  unnamed protein product                                148   2e-38   Coffea canephora [robusta coffee]
ref|XP_004248997.1|  PREDICTED: sugar transporter ERD6-like 8           148   2e-38   
ref|XP_003541648.2|  PREDICTED: sugar transporter ERD6-like 16-li...    148   2e-38   Glycine max [soybeans]
ref|XP_006594463.1|  PREDICTED: sugar transporter ERD6-like 16-li...    149   2e-38   Glycine max [soybeans]
ref|XP_006594462.1|  PREDICTED: sugar transporter ERD6-like 16-li...    149   2e-38   
gb|KGN66110.1|  hypothetical protein Csa_1G571820                       147   2e-38   Cucumis sativus [cucumbers]
ref|XP_008450689.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    148   2e-38   
ref|XP_008450688.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    148   2e-38   
gb|EMT03312.1|  Sugar transporter ERD6-like protein 5                   148   3e-38   
gb|KFK26120.1|  hypothetical protein AALP_AA8G206400                    147   3e-38   Arabis alpina [alpine rockcress]
ref|XP_010649814.1|  PREDICTED: sugar transporter ERD6-like 16 is...    147   5e-38   
ref|XP_007030767.1|  Sugar transporter, putative                        147   5e-38   
ref|XP_010674993.1|  PREDICTED: sugar transporter ERD6-like 5           146   7e-38   
ref|XP_010528859.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    146   9e-38   Tarenaya hassleriana [spider flower]
ref|XP_004145042.1|  PREDICTED: sugar transporter ERD6-like 16-like     146   9e-38   
ref|XP_010912098.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    145   1e-37   
gb|KFK35614.1|  hypothetical protein AALP_AA4G014000                    145   2e-37   Arabis alpina [alpine rockcress]
gb|KHN03404.1|  Sugar transporter ERD6-like 16                          142   2e-37   
ref|XP_003557831.1|  PREDICTED: sugar transporter ERD6-like 16          144   5e-37   
gb|KCW85184.1|  hypothetical protein EUGRSUZ_B02014                     144   6e-37   
emb|CDP17979.1|  unnamed protein product                                143   7e-37   
ref|NP_850964.1|  sugar transporter ERD6-like 5                         143   9e-37   
ref|XP_010242567.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    142   1e-36   
ref|XP_004486078.1|  PREDICTED: sugar transporter ERD6-like 16-like     143   1e-36   
ref|XP_004171627.1|  PREDICTED: sugar transporter ERD6-like 16-like     143   2e-36   
ref|XP_006845806.1|  hypothetical protein AMTR_s00019p00256160          142   2e-36   
ref|XP_010674987.1|  PREDICTED: sugar transporter ERD6-like 5           142   2e-36   
emb|CDY43482.1|  BnaA01g21370D                                          142   3e-36   
ref|XP_008350755.1|  PREDICTED: sugar transporter ERD6-like 5           141   4e-36   
gb|KDO44991.1|  hypothetical protein CISIN_1g011956mg                   140   7e-36   
ref|XP_006471873.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    140   7e-36   
emb|CDP17977.1|  unnamed protein product                                141   7e-36   
ref|XP_009119507.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    140   7e-36   
ref|XP_008674200.1|  PREDICTED: LOC100281158 isoform X1                 140   9e-36   
tpg|DAA45486.1|  TPA: solute carrier family 2, facilitated glucos...    140   1e-35   
gb|ADW40547.1|  vacuolar monosaccharide symporter 1                     140   1e-35   
ref|XP_010511207.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   1e-35   
ref|NP_001147549.1|  LOC100281158                                       140   1e-35   
ref|XP_010660066.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   1e-35   
ref|XP_010511205.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    140   2e-35   
gb|EAZ27016.1|  hypothetical protein OsJ_10945                          139   2e-35   
ref|NP_001050166.1|  Os03g0363600                                       140   2e-35   
ref|XP_009119503.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   2e-35   
ref|XP_002512321.1|  sugar transporter, putative                        139   2e-35   
gb|KEH23691.1|  sugar porter (SP) family MFS transporter                139   2e-35   
ref|XP_004984296.1|  PREDICTED: sugar transporter ERD6-like 16-like     139   2e-35   
ref|XP_009119491.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   3e-35   
ref|XP_010660065.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   4e-35   
ref|XP_010660064.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   4e-35   
ref|XP_010470371.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   4e-35   
ref|XP_010660063.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   4e-35   
ref|XP_010470369.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   5e-35   
ref|XP_010660062.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   5e-35   
emb|CBI34328.3|  unnamed protein product                                139   5e-35   
ref|XP_002465229.1|  hypothetical protein SORBIDRAFT_01g034610          139   5e-35   
ref|XP_010660061.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    139   5e-35   
ref|XP_011048905.1|  PREDICTED: sugar transporter ERD6-like 5           138   6e-35   
gb|ADM76943.1|  ERD sugar transporter-like protein                      132   1e-34   
ref|XP_009119495.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    137   2e-34   
ref|XP_002465230.1|  hypothetical protein SORBIDRAFT_01g034620          134   2e-34   
gb|ADM76938.1|  ERD sugar transporter-like protein                      131   2e-34   
ref|XP_009119487.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    137   2e-34   
gb|ADM76964.1|  ERD sugar transporter-like protein                      131   2e-34   
ref|XP_009119480.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    137   2e-34   
ref|XP_010674995.1|  PREDICTED: sugar transporter ERD6-like 5           137   2e-34   
ref|XP_010545516.1|  PREDICTED: putative sugar transporter ERD6-l...    136   3e-34   
ref|XP_006845808.1|  hypothetical protein AMTR_s00019p00256320          136   3e-34   
ref|XP_002894602.1|  hypothetical protein ARALYDRAFT_474748             136   3e-34   
ref|XP_010111875.1|  Sugar transporter ERD6-like 5                      135   4e-34   
gb|ADE77226.1|  unknown                                                 130   4e-34   
ref|XP_006651406.1|  PREDICTED: sugar transporter ERD6-like 16-like     135   5e-34   
ref|XP_010684722.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    135   5e-34   
ref|XP_010660048.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    135   6e-34   
ref|XP_010660049.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    135   6e-34   
ref|XP_010684721.1|  PREDICTED: sugar transporter ERD6-like 16 is...    135   6e-34   
gb|EMS53450.1|  Sugar transporter ERD6-like 16                          135   8e-34   
gb|EMT05561.1|  Sugar transporter ERD6-like 16                          135   8e-34   
gb|KDP26380.1|  hypothetical protein JCGZ_17538                         135   8e-34   
gb|AAC64898.1|  Similar to Beta integral membrane protein homolog...    135   1e-33   
ref|XP_006301882.1|  hypothetical protein CARUB_v10022354mg             135   1e-33   
emb|CBI34332.3|  unnamed protein product                                127   1e-33   
gb|ADP37159.1|  putative ERD6-like transporter                          134   1e-33   
ref|XP_008681387.1|  PREDICTED: hypothetical protein isoform X1         134   2e-33   
ref|XP_006651405.1|  PREDICTED: sugar transporter ERD6-like 16-like     133   2e-33   
gb|KCW85182.1|  hypothetical protein EUGRSUZ_B02013                     132   3e-33   
ref|XP_004984297.1|  PREDICTED: sugar transporter ERD6-like 16-like     133   4e-33   
ref|XP_010043108.1|  PREDICTED: sugar transporter ERD6-like 5           133   5e-33   
ref|XP_011466344.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    132   6e-33   
ref|XP_007030778.1|  Major facilitator superfamily protein, putative    132   7e-33   
ref|XP_010660054.1|  PREDICTED: sugar transporter ERD6-like 5           132   7e-33   
gb|ADP37161.1|  putative ERD6-like transporter                          132   8e-33   
gb|KEH23719.1|  sugar transporter                                       125   8e-33   
ref|XP_008366941.1|  PREDICTED: sugar transporter ERD6-like 5           131   9e-33   
ref|XP_011466343.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    132   9e-33   
ref|XP_010649828.1|  PREDICTED: sugar transporter ERD6-like 16 is...    131   1e-32   
ref|XP_011466341.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    132   1e-32   
ref|XP_011466342.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    132   1e-32   
emb|CBI26146.3|  unnamed protein product                                132   1e-32   
ref|XP_002278654.3|  PREDICTED: sugar transporter ERD6-like 7 iso...    132   1e-32   
gb|ADE75821.1|  unknown                                                 132   2e-32   
ref|XP_010660072.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    130   2e-32   
ref|XP_010660071.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    131   2e-32   
ref|XP_010649826.1|  PREDICTED: sugar transporter ERD6-like 16 is...    130   2e-32   
ref|XP_010649823.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    131   2e-32   
ref|XP_007147088.1|  hypothetical protein PHAVU_006G095300g             131   2e-32   
gb|EPS63288.1|  hypothetical protein M569_11497                         128   2e-32   
ref|XP_010649825.1|  PREDICTED: sugar transporter ERD6-like 16 is...    130   3e-32   
gb|AHG94614.1|  sugar transporter ERD6-like protein                     130   3e-32   
gb|KHG12383.1|  hypothetical protein F383_10647                         130   3e-32   
ref|XP_011466331.1|  PREDICTED: sugar transporter ERD6-like 3           130   3e-32   
ref|XP_010660060.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    130   4e-32   
ref|XP_009373999.1|  PREDICTED: sugar transporter ERD6-like 5           130   4e-32   
ref|XP_006838267.1|  hypothetical protein AMTR_s00103p00071860          130   5e-32   
gb|KDP23563.1|  hypothetical protein JCGZ_23396                         130   5e-32   
gb|EEE59094.1|  hypothetical protein OsJ_10944                          129   6e-32   
ref|XP_008388982.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    130   6e-32   
ref|XP_011466345.1|  PREDICTED: sugar transporter ERD6-like 3           129   7e-32   
ref|XP_011466340.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    129   7e-32   
ref|NP_001050165.1|  Os03g0363500                                       130   8e-32   
ref|XP_011466338.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    129   9e-32   
ref|XP_011466336.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    129   9e-32   
gb|EEC75308.1|  hypothetical protein OsI_11676                          129   1e-31   
ref|XP_011466333.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    130   1e-31   
ref|XP_006382655.1|  sugar transporter family protein                   129   1e-31   
emb|CDP17980.1|  unnamed protein product                                129   1e-31   
ref|XP_006345308.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    129   1e-31   
ref|XP_002311812.1|  sugar transporter family protein                   122   1e-31   
ref|XP_010674988.1|  PREDICTED: sugar transporter ERD6-like 5           129   2e-31   
gb|KCW85189.1|  hypothetical protein EUGRSUZ_B020192                    127   2e-31   
ref|XP_011048904.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    128   2e-31   
ref|XP_010043114.1|  PREDICTED: sugar transporter ERD6-like 5           123   2e-31   
gb|KDP23562.1|  hypothetical protein JCGZ_23395                         129   2e-31   
ref|XP_004231463.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    128   2e-31   
ref|XP_011048900.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    128   2e-31   
ref|XP_011048902.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    128   2e-31   
ref|XP_011048903.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    128   2e-31   
ref|XP_011048901.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    128   2e-31   
ref|XP_011468422.1|  PREDICTED: sugar transporter ERD6-like 3           128   2e-31   
ref|XP_010025134.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    128   2e-31   
ref|XP_011466332.1|  PREDICTED: sugar transporter ERD6-like 17 is...    130   3e-31   
gb|KHN03017.1|  Sugar transporter ERD6-like 16                          126   3e-31   
ref|XP_010025135.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    127   3e-31   
ref|XP_010046270.1|  PREDICTED: sugar transporter ERD6-like 5           127   4e-31   
ref|XP_010432317.1|  PREDICTED: sugar transporter ERD6-like 14          127   5e-31   
ref|XP_011466330.1|  PREDICTED: sugar transporter ERD6-like 3           127   5e-31   
gb|KDO87480.1|  hypothetical protein CISIN_1g033094mg                   119   5e-31   
ref|XP_002512324.1|  sugar transporter, putative                        127   6e-31   
ref|XP_006382631.1|  hypothetical protein POPTR_0005s03960g             120   6e-31   
ref|XP_010315529.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    127   6e-31   
gb|ABK24356.1|  unknown                                                 127   7e-31   
ref|XP_006382654.1|  hypothetical protein POPTR_0005s04170g             125   9e-31   
gb|KCW61732.1|  hypothetical protein EUGRSUZ_H044401                    125   1e-30   
ref|XP_006287657.1|  hypothetical protein CARUB_v10000868mg             126   1e-30   
gb|KJB45165.1|  hypothetical protein B456_007G293100                    126   1e-30   
gb|KCW85187.1|  hypothetical protein EUGRSUZ_B02017                     125   1e-30   
ref|XP_010674990.1|  PREDICTED: sugar transporter ERD6-like 5           126   1e-30   
ref|XP_010422298.1|  PREDICTED: sugar transporter ERD6-like 14          126   1e-30   
ref|XP_010660059.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    126   1e-30   
ref|XP_010043118.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    125   2e-30   
ref|XP_010027219.1|  PREDICTED: sugar transporter ERD6-like 5           125   2e-30   
ref|XP_010228593.1|  PREDICTED: sugar transporter ERD6-like 16 is...    126   2e-30   
emb|CBI34330.3|  unnamed protein product                                125   2e-30   
ref|XP_010660058.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    125   2e-30   
gb|KJB45159.1|  hypothetical protein B456_007G293000                    125   2e-30   
gb|KCW85191.1|  hypothetical protein EUGRSUZ_B02020                     125   2e-30   
gb|KCW85193.1|  hypothetical protein EUGRSUZ_B02020                     125   2e-30   
gb|KCW61729.1|  hypothetical protein EUGRSUZ_H04439                     125   2e-30   
ref|XP_010043119.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    125   2e-30   
gb|KCW76707.1|  hypothetical protein EUGRSUZ_D01065                     125   2e-30   
emb|CAN71288.1|  hypothetical protein VITISV_004400                     124   3e-30   
ref|XP_010027218.1|  PREDICTED: sugar transporter ERD6-like 5           125   3e-30   
ref|XP_010043116.1|  PREDICTED: sugar transporter ERD6-like 10          125   3e-30   
gb|EMT10929.1|  Sugar transporter ERD6-like protein 16                  125   3e-30   
ref|XP_010043117.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    125   3e-30   
ref|XP_002975748.1|  hypothetical protein SELMODRAFT_103433             125   3e-30   
ref|XP_002973697.1|  hypothetical protein SELMODRAFT_99846              125   3e-30   
gb|ADM77800.1|  major facilitator superfamily sugar transporter-l...    121   3e-30   
gb|ADM77802.1|  major facilitator superfamily sugar transporter-l...    120   3e-30   
ref|XP_010052627.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   3e-30   
gb|ADP37162.1|  putative ERD6-like transporter                          125   4e-30   
gb|KHG13159.1|  hypothetical protein F383_17202                         124   4e-30   
ref|NP_192385.2|  sugar transporter ERD6-like 15                        125   4e-30   
ref|XP_010660057.1|  PREDICTED: sugar transporter ERD6-like 10 is...    125   4e-30   
ref|XP_010042349.1|  PREDICTED: sugar transporter ERD6-like 10          119   4e-30   
ref|XP_010312436.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   4e-30   
ref|XP_010025137.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   5e-30   
ref|XP_010660055.1|  PREDICTED: sugar transporter ERD6-like 10 is...    124   5e-30   
ref|XP_010312440.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   5e-30   
ref|XP_010052626.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   5e-30   
ref|XP_010043135.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   5e-30   
ref|XP_002872708.1|  sugar transporter family protein                   124   5e-30   
ref|XP_010455776.1|  PREDICTED: sugar transporter ERD6-like 14          124   5e-30   
ref|XP_010550028.1|  PREDICTED: sugar transporter ERD6                  124   6e-30   
ref|XP_010025138.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   6e-30   
ref|XP_006289469.1|  hypothetical protein CARUB_v10002998mg             124   7e-30   
ref|XP_011013521.1|  PREDICTED: sugar transporter ERD6-like 18          124   7e-30   
ref|XP_010551192.1|  PREDICTED: sugar transporter ERD6-like 3           124   7e-30   
ref|NP_001159247.1|  hypothetical protein                               124   7e-30   
ref|XP_010043132.1|  PREDICTED: sugar transporter ERD6-like 5           124   8e-30   
ref|XP_010043133.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    124   8e-30   
ref|XP_010553745.1|  PREDICTED: sugar transporter ERD6-like 3           123   8e-30   
ref|XP_011023517.1|  PREDICTED: sugar transporter ERD6-like 18          124   9e-30   
ref|XP_010052628.1|  PREDICTED: sugar transporter ERD6-like 5           124   9e-30   
ref|XP_010043129.1|  PREDICTED: sugar transporter ERD6-like 5           124   9e-30   
gb|KDP23564.1|  hypothetical protein JCGZ_23397                         124   1e-29   
ref|XP_010511206.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    123   1e-29   
ref|XP_011036750.1|  PREDICTED: sugar transporter ERD6-like 3           124   1e-29   
ref|XP_010422296.1|  PREDICTED: sugar transporter ERD6-like 14          123   1e-29   
ref|NP_192384.2|  sugar transporter ERD6-like 14                        123   1e-29   
ref|XP_010052632.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    123   1e-29   
ref|XP_010052633.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    123   1e-29   
emb|CAB80840.1|  putative sugar transporter                             123   1e-29   
sp|Q9M0Z9.2|EDL15_ARATH  RecName: Full=Sugar transporter ERD6-lik...    123   2e-29   
ref|XP_002319571.2|  hypothetical protein POPTR_0013s02870g             123   2e-29   
emb|CBI34335.3|  unnamed protein product                                123   2e-29   
ref|XP_011023519.1|  PREDICTED: sugar transporter ERD6-like 3           123   2e-29   
ref|XP_010660053.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    123   2e-29   
emb|CAB80841.1|  putative sugar transporter                             122   2e-29   
ref|XP_006878598.1|  hypothetical protein AMTR_s00011p00254360          122   2e-29   
gb|ABK25410.1|  unknown                                                 122   2e-29   
ref|XP_002872707.1|  predicted protein                                  122   2e-29   
ref|XP_006392490.1|  hypothetical protein EUTSA_v10023420mg             122   3e-29   
gb|ABR16538.1|  unknown                                                 122   3e-29   
gb|KCW76703.1|  hypothetical protein EUGRSUZ_D01063                     122   3e-29   
ref|XP_010674986.1|  PREDICTED: sugar transporter ERD6-like 5           122   3e-29   
ref|XP_006297579.1|  hypothetical protein CARUB_v10013612mg             122   3e-29   
ref|XP_010924278.1|  PREDICTED: sugar transporter ERD6-like 6 iso...    122   3e-29   
ref|XP_008388057.1|  PREDICTED: sugar transporter ERD6-like 6           122   3e-29   
gb|KJB29571.1|  hypothetical protein B456_005G108100                    122   3e-29   
ref|XP_002319572.1|  sugar transporter family protein                   122   4e-29   
ref|XP_010052629.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    122   4e-29   
ref|XP_006417634.1|  hypothetical protein EUTSA_v10007580mg             122   4e-29   
ref|XP_006361907.1|  PREDICTED: uncharacterized protein LOC102601222    124   5e-29   
gb|AAB70420.1|  Similar to Beta integral membrane protein (gb|U43...    122   5e-29   
gb|ADP37160.1|  putative ERD6-like transporter                          122   5e-29   
emb|CDY54651.1|  BnaA05g36160D                                          121   5e-29   
ref|XP_009145626.1|  PREDICTED: putative sugar transporter ERD6-l...    121   5e-29   
ref|XP_010111874.1|  Sugar transporter ERD6-like 5                      121   5e-29   



>ref|XP_009614908.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana tomentosiformis]
Length=483

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  IA   AP+LAVTGI+VYIGSFS+GMGAVPWV+MSEI+PIN+KG AGS ATLVNWF
Sbjct  367  LKGHEIAVKEAPILAVTGILVYIGSFSIGMGAVPWVVMSEIYPINIKGAAGSLATLVNWF  426

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW CSYTFNFLM WNSFGTFILYA +N L+ILFVIK+VPETKGRTLEQIQA+INA
Sbjct  427  GAWACSYTFNFLMTWNSFGTFILYAAVNALSILFVIKIVPETKGRTLEQIQASINA  482



>ref|XP_006358441.1| PREDICTED: sugar transporter ERD6-like 7-like [Solanum tuberosum]
Length=480

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  IA   AP+LAVTGI+VYIGSFSVGMGAVPWV+MSEI+PIN+KG AGS ATLVNWF
Sbjct  364  LKGHEIAIKVAPILAVTGILVYIGSFSVGMGAVPWVVMSEIYPINIKGAAGSLATLVNWF  423

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW CSYTFNFLM WNSFGTFILYA +N L+ILFVIK+VPETKGRTLEQIQA INA
Sbjct  424  GAWACSYTFNFLMTWNSFGTFILYAAVNALSILFVIKIVPETKGRTLEQIQAAINA  479



>dbj|BAO96226.1| sugar-porter family protein 7, partial [Solanum lycopersicum]
Length=468

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            +KG  +A  AAP+LAVTGI+VYIGSFSVGMGAVPWV+MSEI+PIN+KG AGS ATLVNWF
Sbjct  352  MKGHEMAIKAAPILAVTGILVYIGSFSVGMGAVPWVVMSEIYPINIKGAAGSLATLVNWF  411

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW CSYTFNFLM WNSFGTF+LYA +N L+ILFVIK+VPETKGRTLEQIQA INA
Sbjct  412  GAWACSYTFNFLMTWNSFGTFVLYAAVNALSILFVIKIVPETKGRTLEQIQAAINA  467



>ref|NP_001233882.1| st3 protein [Solanum lycopersicum]
 emb|CAC00697.2| putative sugar transporter [Solanum lycopersicum]
Length=480

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            +KG  +A  AAP+LAVTGI+VYIGSFSVGMGAVPWV+MSEI+PIN+KG AGS ATLVNWF
Sbjct  364  MKGHEMAIKAAPILAVTGILVYIGSFSVGMGAVPWVVMSEIYPINIKGAAGSLATLVNWF  423

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW CSYTFNFLM WNSFGTF+LYA +N L+ILFVIK+VPETKGRTLEQIQA INA
Sbjct  424  GAWACSYTFNFLMTWNSFGTFVLYAAVNALSILFVIKIVPETKGRTLEQIQAAINA  479



>ref|XP_009777420.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana sylvestris]
Length=483

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  IA    P+LAVTGI+VYIGSFS+GMGAVPWV+MSEI+PIN+KG AGS ATLVNWF
Sbjct  367  LKGHEIAVKGGPILAVTGILVYIGSFSIGMGAVPWVVMSEIYPINIKGAAGSLATLVNWF  426

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW CSYTFNFLM WNSFGTFILYA +N L+ILFVIK+VPETKGRTLEQIQA+INA
Sbjct  427  GAWACSYTFNFLMTWNSFGTFILYAAVNALSILFVIKIVPETKGRTLEQIQASINA  482



>ref|XP_004292608.2| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            +K   ++  A P+LAVTGI+V+IGSFS+GMGAVPWVIMSEIFPIN+KG AGSFATLVNWF
Sbjct  361  IKVHQLSPKAVPILAVTGILVFIGSFSIGMGAVPWVIMSEIFPINIKGQAGSFATLVNWF  420

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAWLCSYTFNFLM W+S+GTFILYA INVLAI+F++ +VPETKGRTLEQIQA+IN
Sbjct  421  GAWLCSYTFNFLMTWSSYGTFILYAVINVLAIIFIVVMVPETKGRTLEQIQASIN  475



>ref|XP_010507819.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=163

 Score =   184 bits (466),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  48   LKVHNLAQEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  107

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  108  GAWAVSYTFNFLMSWSSYGTFIIYAAINALAIVFVIVIVPETKGKTLEQIQAVVN  162



>gb|AFK48468.1| unknown [Lotus japonicus]
Length=193

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   I+  A P LAVTGI+VY+GSF++GMGAVPWV+MSEIFP+N+KG AGS ATLVNWF
Sbjct  78   LKAQEISVGAVPGLAVTGILVYVGSFAIGMGAVPWVVMSEIFPVNIKGQAGSLATLVNWF  137

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFLM+W+++GTFILYA IN L ILF++ VVPETKG++LEQ+QA INA
Sbjct  138  GAWLCSYTFNFLMSWSTYGTFILYAAINALGILFIVVVVPETKGKSLEQLQAAINA  193



>ref|XP_007050715.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007050716.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94872.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94873.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=484

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG N+A N+ P+LAV GI++YIGSFS GMGAVPWV+MSEIFPIN+KGVAGS ATLVNWF
Sbjct  369  LKGHNLALNSVPILAVAGILIYIGSFSAGMGAVPWVVMSEIFPINIKGVAGSLATLVNWF  428

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAILFV+ VVPETKG+TLEQIQA INA
Sbjct  429  GAWAVSYTFNFLMSWSSYGTFIIYAVINALAILFVVIVVPETKGKTLEQIQAAINA  484



>gb|KHG20787.1| hypothetical protein F383_26710 [Gossypium arboreum]
Length=384

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A ++ P+LAVTGI++YIGSFS GMGAVPWV+MSEIFPIN+KG+AGS ATLVNWF
Sbjct  269  LKDHNLAPSSVPILAVTGILMYIGSFSAGMGAVPWVVMSEIFPINIKGIAGSLATLVNWF  328

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+S+GTFI+YA IN +AI+FVI VVPETKGRTLEQIQA INA
Sbjct  329  GAWAVSYTFNFLMSWSSYGTFIIYAAINAVAIVFVITVVPETKGRTLEQIQAAINA  384



>gb|EYU43551.1| hypothetical protein MIMGU_mgv1a005532mg [Erythranthe guttata]
Length=480

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A    P LAVTGI+VYIG+FSVGMGAVPWV+MSEIFPIN+KGVAGS ATLVNWF
Sbjct  364  LKDQGLASEVTPALAVTGILVYIGAFSVGMGAVPWVVMSEIFPINIKGVAGSLATLVNWF  423

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+S+GTF+LYA +N LAI+FVIKVVPETKGRTLEQIQ  INA
Sbjct  424  GAWAVSYTFNFLMSWSSYGTFVLYAAVNALAIVFVIKVVPETKGRTLEQIQTAINA  479



>ref|XP_008234933.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  A P+LAVTGI+VYIGSFS+GMGAVPWV+MSEIFPIN+KG AGS ATLVNWF
Sbjct  360  LKVHELALTATPILAVTGILVYIGSFSIGMGAVPWVVMSEIFPINIKGQAGSLATLVNWF  419

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAWLCSYTFN+LM+W+S+GTFILYA IN LAILFVI +VPETKGRTLEQIQ  IN
Sbjct  420  GAWLCSYTFNYLMSWSSYGTFILYAAINALAILFVILMVPETKGRTLEQIQGAIN  474



>ref|XP_010512799.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=278

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  163  LKVHNLAQEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  222

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  223  GAWAVSYTFNFLMSWSSYGTFIIYAAINALAIVFVIVIVPETKGKTLEQIQAVVN  277



>ref|XP_010112685.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC34643.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=450

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  543  RLVLLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATL  364
            R  LL    +A  A+P+LAVTGIM+YIGSFS GMGAVPW++MSEIFPIN+KG AGS ATL
Sbjct  331  RKPLLLAHELALQASPILAVTGIMLYIGSFSAGMGAVPWIVMSEIFPINIKGQAGSLATL  390

Query  363  VNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            +NWFGAWLCSY+FNFLMAW+S+GTFI+YA + VLAILF+I VVPETKG+TLEQIQA IN
Sbjct  391  MNWFGAWLCSYSFNFLMAWSSYGTFIIYAAVYVLAILFIITVVPETKGKTLEQIQAAIN  449



>ref|XP_007200994.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
 gb|EMJ02193.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
Length=475

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  A P+LAVTGI++YIGSFS+GMGAVPW++MSEIFPIN+KG AGSFATLVNW 
Sbjct  360  LKVHELALTATPILAVTGILIYIGSFSIGMGAVPWIVMSEIFPINIKGQAGSFATLVNWL  419

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAWLCSYTFNFLM+W+S+GTFILYA IN LAILFVI +VPETKG+TLEQIQ  IN
Sbjct  420  GAWLCSYTFNFLMSWSSYGTFILYAAINALAILFVILMVPETKGKTLEQIQGDIN  474



>ref|XP_004493632.1| PREDICTED: sugar transporter ERD6-like 7-like [Cicer arietinum]
Length=473

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++   A PVLAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+N+KG AGS ATLVNWF
Sbjct  358  LKVHDVGAGAVPVLAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNIKGQAGSIATLVNWF  417

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFLM+W+S+GTF+LYA IN LAILF+  VVPETKG++LEQ+QA INA
Sbjct  418  GAWLCSYTFNFLMSWSSYGTFVLYAAINSLAILFIAIVVPETKGKSLEQLQAAINA  473



>ref|XP_008234934.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234935.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234936.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234938.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234939.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234940.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  A P+LAVTGI++YIGSFS+GMGAVPW++MSEIFPIN+KG AGSF+TLVNW 
Sbjct  360  LKVHELALTATPILAVTGILIYIGSFSIGMGAVPWIVMSEIFPINIKGQAGSFSTLVNWL  419

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAWLCSYTFNFLM+W+S+GTFILYA IN LAILFVI +VPETKG+TLEQIQ  IN
Sbjct  420  GAWLCSYTFNFLMSWSSYGTFILYAAINALAILFVILMVPETKGKTLEQIQGDIN  474



>gb|KEH23690.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=477

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A P LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+N+KG AGS ATLVNWF
Sbjct  362  LKVHDVAVGAVPALAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNIKGQAGSIATLVNWF  421

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFLM+W+S+GTF+LYA IN LAILF+  VVPETKG++LEQ+QA INA
Sbjct  422  GAWLCSYTFNFLMSWSSYGTFVLYAAINALAILFIAVVVPETKGKSLEQLQAAINA  477



>ref|XP_010512800.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=336

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  221  LKVHNLAQEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  280

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  281  GAWAVSYTFNFLMSWSSYGTFIIYAAINALAIVFVIVIVPETKGKTLEQIQAVVN  335



>gb|KJB23160.1| hypothetical protein B456_004G084300 [Gossypium raimondii]
Length=480

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A ++ P+LAVTGI++YIGSFS GMGAVPWV+MSEIFPIN+KG+AGS ATLVNWF
Sbjct  365  LKDHNLAPSSVPILAVTGILMYIGSFSAGMGAVPWVVMSEIFPINIKGIAGSLATLVNWF  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+S+GTFI+YA IN +AI+FVI VVPETKG+TLEQIQA INA
Sbjct  425  GAWAVSYTFNFLMSWSSYGTFIIYAAINAVAIVFVITVVPETKGKTLEQIQAAINA  480



>gb|KCW58958.1| hypothetical protein EUGRSUZ_H015842, partial [Eucalyptus grandis]
Length=115

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  519  NIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWL  340
            ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWFGAW 
Sbjct  3    DLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWFGAWA  62

Query  339  CSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             SYTFN+LM+W+SFGTF+LYA IN   ++FVI VVPETKGR+LEQIQA IN
Sbjct  63   VSYTFNYLMSWSSFGTFLLYAVINAAGMVFVITVVPETKGRSLEQIQAAIN  113



>gb|KCW58969.1| hypothetical protein EUGRSUZ_H01597 [Eucalyptus grandis]
Length=259

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPINVKGVAG FATLVNWF
Sbjct  143  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINVKGVAGGFATLVNWF  202

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   I+FVI VVPETKGR+LEQIQA IN
Sbjct  203  GAWAVSYTFNYLMSWSSYGTFLLYAGINAAGIVFVITVVPETKGRSLEQIQAAIN  257



>ref|XP_010107672.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC16583.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=448

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  543  RLVLLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATL  364
            R  LL    +A  A+P+LAVTGIM+YIGSFS GMGAVPW++MSEIFPIN+KG AGS ATL
Sbjct  329  RKPLLLAHELALQASPILAVTGIMLYIGSFSAGMGAVPWIVMSEIFPINIKGQAGSLATL  388

Query  363  VNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            +NWFGAWLCSY+FNFLMAW+S+GTFI YA + V+AILF+I VVPETKG+TLE+IQA IN
Sbjct  389  MNWFGAWLCSYSFNFLMAWSSYGTFIFYAAVYVMAILFIITVVPETKGKTLEEIQAAIN  447



>gb|KHG14417.1| hypothetical protein F383_03945 [Gossypium arboreum]
Length=432

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A +A P+LAVTGI++YI +FS GMGAVPWVIMSEIFPIN+KGVAGS ATLVNWF
Sbjct  317  LKDHNLALDAVPILAVTGILIYISAFSAGMGAVPWVIMSEIFPINIKGVAGSLATLVNWF  376

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+S+GTFILYA IN  AILFV+ +VPETKG+TLEQIQA INA
Sbjct  377  GAWAVSYTFNFLMSWSSYGTFILYAAINAGAILFVVTLVPETKGKTLEQIQAAINA  432



>gb|KDO87479.1| hypothetical protein CISIN_1g033094mg [Citrus sinensis]
Length=127

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             + P LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGV GS ATLVNWFGAWL SYT
Sbjct  20   ESVPALAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVGGSLATLVNWFGAWLVSYT  79

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            FNFLM W+S+GTFILYA IN L ILF+I VVPETKGRTLEQIQA INA
Sbjct  80   FNFLMTWSSYGTFILYAAINALGILFMIIVVPETKGRTLEQIQAAINA  127



>ref|XP_008386585.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=476

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A+P+LAVTGI+VYIGSF++GMGAVPWVIMSEIFPIN+KG AGS ATLVNWF
Sbjct  362  LKVHDLAHKASPILAVTGILVYIGSFAIGMGAVPWVIMSEIFPINIKGQAGSLATLVNWF  421

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             AWLCSYTFN+LM+W+S+GTFILYA IN LAI+FV+ +VPETKG+TLEQIQ  IN
Sbjct  422  VAWLCSYTFNYLMSWSSYGTFILYAAINALAIVFVVSMVPETKGKTLEQIQGAIN  476



>emb|CDP03586.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A    PVLAVTG++VYIGSFS GMGAVPWV+MSEIFPIN+KGVAGS ATLVNWF
Sbjct  322  LKVHELALKTVPVLAVTGVLVYIGSFSAGMGAVPWVVMSEIFPINIKGVAGSLATLVNWF  381

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFN+LM W+S GTFILYA IN L ILFV  VVPETKGR+LEQIQ+ INA
Sbjct  382  GAWLCSYTFNYLMTWSSPGTFILYAAINALGILFVTIVVPETKGRSLEQIQSAINA  437



>gb|KHN19852.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=478

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   A P LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+NVKG+AGS ATL NWF
Sbjct  363  LKVHEVGVEAVPALAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNVKGLAGSVATLTNWF  422

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFLM+W+S+GTFILYA IN LAILF+I  VPETKG++LEQ+QA IN+
Sbjct  423  GAWLCSYTFNFLMSWSSYGTFILYAAINALAILFIIVAVPETKGKSLEQLQADINS  478



>ref|XP_003521224.1| PREDICTED: sugar transporter ERD6-like 7-like [Glycine max]
Length=471

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   A P LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+NVKG+AGS ATL NWF
Sbjct  356  LKVHEVGVEAVPALAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNVKGLAGSVATLTNWF  415

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFLM+W+S+GTFILYA IN LAILF+I  VPETKG++LEQ+QA IN+
Sbjct  416  GAWLCSYTFNFLMSWSSYGTFILYAAINALAILFIIVAVPETKGKSLEQLQADINS  471



>ref|XP_011079781.1| PREDICTED: sugar transporter ERD6-like 7 [Sesamum indicum]
Length=485

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = -3

Query  483  TGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWN  304
            TGI+VYIG+FS GMGAVPWV+MSEIFPIN+KGVAGSFATLVNWFGAW CSYTFNFLM+W+
Sbjct  385  TGILVYIGAFSAGMGAVPWVVMSEIFPINIKGVAGSFATLVNWFGAWACSYTFNFLMSWS  444

Query  303  SFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            S+GTFILYA +N LAILFVIKVVPETKGRTLEQIQA IN
Sbjct  445  SYGTFILYAAVNALAILFVIKVVPETKGRTLEQIQAAIN  483



>ref|XP_010026273.1| PREDICTED: sugar transporter ERD6-like 7, partial [Eucalyptus 
grandis]
Length=281

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPINVKGVAG FATLVNWF
Sbjct  165  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINVKGVAGGFATLVNWF  224

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   I+FVI VVPETKGR+LEQIQA IN
Sbjct  225  GAWAVSYTFNYLMSWSSYGTFLLYAGINAAGIVFVITVVPETKGRSLEQIQAAIN  279



>gb|KFK37554.1| hypothetical protein AALP_AA4G271800 [Arabis alpina]
Length=468

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  353  LKAHDMAHDAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  412

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA +N LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  413  GAWAVSYTFNFLMSWSSYGTFIIYAVVNALAIVFVIAIVPETKGKTLEQIQALVN  467



>ref|XP_003554233.1| PREDICTED: sugar transporter ERD6-like 7-like isoform 1 [Glycine 
max]
Length=466

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   A P LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+N+KG+AGS ATLVNWF
Sbjct  351  LKVHEVGVEAVPALAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNIKGLAGSVATLVNWF  410

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNF M+W+S+GTFILYA IN LAILF+I  VPETKG++LEQ+QA IN+
Sbjct  411  GAWLCSYTFNFFMSWSSYGTFILYAAINALAILFIIVAVPETKGKSLEQLQADINS  466



>ref|XP_008386586.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=478

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
            +AAP+ AV GI+++IGSFS+GMGAVPWVIMSEIFPIN+KG AGS  TLVNW GAWLCSYT
Sbjct  371  DAAPIFAVAGILIFIGSFSIGMGAVPWVIMSEIFPINIKGQAGSLTTLVNWVGAWLCSYT  430

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FNFLM+WNS+GTFILYA +NVLA+LFVI +VPETKG+TLEQIQ  IN
Sbjct  431  FNFLMSWNSYGTFILYAVVNVLAVLFVIALVPETKGKTLEQIQGEIN  477



>ref|XP_010507821.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=437

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  322  LKVHNLAQEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  381

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  382  GAWAVSYTFNFLMSWSSYGTFIIYAAINALAIVFVIVIVPETKGKTLEQIQAVVN  436



>ref|XP_010242565.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Nelumbo 
nucifera]
Length=458

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   ++  + P LAVTGI+VYIGSFS GMGA PWVIMSEIFPINVKG+AGS ATLVNWF
Sbjct  342  LKVHELSIKSVPALAVTGILVYIGSFSAGMGATPWVIMSEIFPINVKGIAGSLATLVNWF  401

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFILYA IN LAILFV KVVPETKGRTLEQIQA IN
Sbjct  402  GAWAISYTFNFLMSWSSYGTFILYAAINGLAILFVAKVVPETKGRTLEQIQAAIN  456



>ref|XP_010242564.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Nelumbo 
nucifera]
Length=479

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   ++  + P LAVTGI+VYIGSFS GMGA PWVIMSEIFPINVKG+AGS ATLVNWF
Sbjct  363  LKVHELSIKSVPALAVTGILVYIGSFSAGMGATPWVIMSEIFPINVKGIAGSLATLVNWF  422

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFILYA IN LAILFV KVVPETKGRTLEQIQA IN
Sbjct  423  GAWAISYTFNFLMSWSSYGTFILYAAINGLAILFVAKVVPETKGRTLEQIQAAIN  477



>ref|XP_010242566.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Nelumbo 
nucifera]
Length=452

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   ++  + P LAVTGI+VYIGSFS GMGA PWVIMSEIFPINVKG+AGS ATLVNWF
Sbjct  336  LKVHELSIKSVPALAVTGILVYIGSFSAGMGATPWVIMSEIFPINVKGIAGSLATLVNWF  395

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFILYA IN LAILFV KVVPETKGRTLEQIQA IN
Sbjct  396  GAWAISYTFNFLMSWSSYGTFILYAAINGLAILFVAKVVPETKGRTLEQIQAAIN  450



>gb|KEH23721.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=475

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A P LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP N+KG AGS ATLVNWF
Sbjct  360  LKVHDVAVGAVPALAVTGILVYIGSFSIGMGAIPWVVMSEIFPANIKGQAGSIATLVNWF  419

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFLM W+ +GTFILYA IN LAILF++ VVPETKG++LEQ+Q+ INA
Sbjct  420  GAWLCSYTFNFLMGWSFYGTFILYAAINALAILFIVLVVPETKGKSLEQLQSAINA  475



>ref|XP_006409064.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
 gb|ESQ50517.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
Length=468

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  353  LKVHDMAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  412

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPETKG+TLEQIQA +N
Sbjct  413  GAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPETKGKTLEQIQALVN  467



>ref|XP_010026252.1| PREDICTED: sugar transporter ERD6-like 7 [Eucalyptus grandis]
Length=172

 Score =   176 bits (445),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNW 
Sbjct  56   LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWC  115

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++F+I VVPETKGR+LEQIQA IN
Sbjct  116  GAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFMITVVPETKGRSLEQIQAAIN  170



>emb|CDY01404.1| BnaA07g11770D [Brassica napus]
Length=468

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIMVYI SFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  353  LKAHDMAHKAVPVLAVVGIMVYIASFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  412

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPETKG+TLEQIQA +N
Sbjct  413  GAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPETKGKTLEQIQAVVN  467



>ref|XP_004290697.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458634.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458635.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 3/125 (2%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L    +A   APVLAVTGI+++IG+FS+GMGAVPW+IMSEIFPIN+KG AGS ATLVNWF
Sbjct  359  LTAQELALTVAPVLAVTGILIFIGAFSIGMGAVPWIIMSEIFPINIKGQAGSLATLVNWF  418

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAWLCSYTFNFLM+W+++GTFILYA IN LAI FVI  VPETKG+TLEQIQA I   S+ 
Sbjct  419  GAWLCSYTFNFLMSWSTYGTFILYAAINALAIFFVIFFVPETKGKTLEQIQAAI---SKE  475

Query  171  RRHKN  157
            R  + 
Sbjct  476  RSEET  480



>ref|XP_007162379.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
 gb|ESW34373.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
Length=473

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   A P LAVTG++VYIGSFS+GMGA+PWV+MSEIFP+N+KG+AGS ATL NWF
Sbjct  358  LKVHEVGVAAVPALAVTGVLVYIGSFSIGMGAIPWVVMSEIFPVNIKGMAGSVATLTNWF  417

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFL++W+S+GTFILYA IN LAILF+I VVPETKG++LEQ+QA IN+
Sbjct  418  GAWLCSYTFNFLISWSSYGTFILYAAINALAILFIIVVVPETKGKSLEQLQAAINS  473



>gb|KHN45387.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=437

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+N+KG+AGS ATLVNWFGAWLCSYTFNF
Sbjct  333  PALAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNIKGLAGSVATLVNWFGAWLCSYTFNF  392

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
             M+W+S+GTFILYA IN LAILF+I  VPETKG++LEQ+QA IN+
Sbjct  393  FMSWSSYGTFILYAAINALAILFIIVAVPETKGKSLEQLQADINS  437



>ref|XP_002524779.1| sugar transporter, putative [Ricinus communis]
 gb|EEF37622.1| sugar transporter, putative [Ricinus communis]
Length=481

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A P LAVTGI++YIGSFS GMGAVPWV+MSEIFPIN+KGVAGS ATL+NWF
Sbjct  366  LKTNDLALKAVPALAVTGILLYIGSFSAGMGAVPWVVMSEIFPINIKGVAGSLATLMNWF  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYT+NFLM+W+S+GTFI+YA IN L I+FV KVVPETKGRTLEQIQA IN+
Sbjct  426  GAWTISYTYNFLMSWSSYGTFIIYAAINALGIVFVAKVVPETKGRTLEQIQAAINS  481



>gb|AAM61246.1| putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  348  LKVHDMAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  407

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  408  GAWAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVIAIVPETKGKTLEQIQAVVN  462



>ref|XP_009103393.1| PREDICTED: sugar transporter ERD6-like 7 [Brassica rapa]
Length=468

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIMVYI SFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  353  LKAHDMAHKAVPVLAVVGIMVYIASFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  412

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI FVI VVPETKG+TLEQIQA +N
Sbjct  413  GAWAVSYTFNFLMSWSSYGTFIIYAVINALAIFFVIAVVPETKGKTLEQIQAVVN  467



>ref|NP_566120.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 ref|NP_850483.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 sp|P93051.2|ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AAD13706.2| putative sugar transporter [Arabidopsis thaliana]
 gb|AAM53273.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AAN15372.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AEC10924.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AEC10925.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
Length=463

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  348  LKVHDMAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  407

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  408  GAWAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVIAIVPETKGKTLEQIQAIVN  462



>ref|XP_004290698.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=464

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             A   LAVTGI+VYIGSFS+GMGAVPWV+MSEIFPIN+KG AGS ATLVNWFGAWLCSYT
Sbjct  357  GAVGALAVTGILVYIGSFSIGMGAVPWVVMSEIFPINIKGQAGSLATLVNWFGAWLCSYT  416

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FNFLM+W+S+GTFILYA IN LAI+FV+ VVPETKG+TLEQIQA IN
Sbjct  417  FNFLMSWSSYGTFILYAAINGLAIVFVVFVVPETKGKTLEQIQAAIN  463



>gb|KJB47011.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47012.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47014.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=484

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+  N+A +A P+LAVTGI++YI +FS GMGAVPWVIMSEIFPIN+KG AGS ATLVNWF
Sbjct  369  LRDHNLALDAVPILAVTGILIYISAFSAGMGAVPWVIMSEIFPINIKGAAGSLATLVNWF  428

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+++GTFILYA IN  AILFV+ +VPETKG+TLEQIQA INA
Sbjct  429  GAWAVSYTFNFLMSWSAYGTFILYAAINAGAILFVVTLVPETKGKTLEQIQAAINA  484



>ref|XP_002880340.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56599.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
Length=464

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  349  LKVHDMAPEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  408

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI +VPETKG+TLEQIQA +N
Sbjct  409  GAWAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVIAIVPETKGKTLEQIQAVVN  463



>ref|XP_010042802.1| PREDICTED: sugar transporter ERD6-like 7 [Eucalyptus grandis]
Length=121

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
            +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWFGAW  SYT
Sbjct  13   DAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWFGAWAVSYT  72

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FN+LM+W+S+GTF+LYA IN   ++FVI VVPETKGR+LEQIQA IN
Sbjct  73   FNYLMSWSSYGTFLLYAGINAAGMVFVITVVPETKGRSLEQIQAAIN  119



>ref|XP_006444170.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 gb|ESR57410.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=385

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   + P LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGV GS ATLVNWF
Sbjct  270  LKDHELGLESVPALAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVGGSLATLVNWF  329

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWL SYTFNFLM W+S+GTFILYA IN L ILF+I VVPETKGRTLEQIQA INA
Sbjct  330  GAWLVSYTFNFLMTWSSYGTFILYAAINALGILFMIIVVPETKGRTLEQIQAAINA  385



>gb|KCW58928.1| hypothetical protein EUGRSUZ_H015512, partial [Eucalyptus grandis]
Length=168

 Score =   174 bits (440),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  52   LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  111

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VV ETKGR+LEQIQ  IN
Sbjct  112  GAWAVSYTFNYLMSWSSYGTFLLYAVINATGMVFVITVVLETKGRSLEQIQVAIN  166



>ref|XP_010107671.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC16582.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=362

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  543  RLVLLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATL  364
            R  LL    +A  A+P+LAV GI++YIGS+SVGMGAVPWV+MSEIF IN+KG AGS ATL
Sbjct  243  RKPLLLVHELALQASPILAVIGILLYIGSYSVGMGAVPWVMMSEIFSINIKGQAGSLATL  302

Query  363  VNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            +NWFGAW  SY+FNFLMAW+S+GTFILYA IN LAILF+I VVPETKG+TLEQIQA IN
Sbjct  303  MNWFGAWFYSYSFNFLMAWSSYGTFILYAAINALAILFIITVVPETKGKTLEQIQAAIN  361



>ref|XP_007162380.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
 gb|ESW34374.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
Length=472

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   A P LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+N+KG AGS ATL NWF
Sbjct  357  LKVYEVGAAAVPALAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNIKGQAGSLATLTNWF  416

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWLCSYTFNFLM+ +S+GTFILYA IN LAILF+I  VPETKG++LEQ+QA IN+
Sbjct  417  GAWLCSYTFNFLMSCSSYGTFILYAAINALAILFIIVAVPETKGKSLEQLQAAINS  472



>ref|XP_008235073.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=480

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  A+P+ AV GI+++IGSFSVGMGAVPWV+MSEIFPIN+KG AGS  TLVNW 
Sbjct  365  LKVHGLALKASPIFAVAGILIFIGSFSVGMGAVPWVLMSEIFPINIKGQAGSLTTLVNWL  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAWLCSYTFNFLM+W+S+GTFILYA +NVL++LFVI +VPETKG+TLEQIQ  IN
Sbjct  425  GAWLCSYTFNFLMSWSSYGTFILYAVVNVLSVLFVIVIVPETKGKTLEQIQGAIN  479



>ref|XP_007201571.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
 gb|EMJ02770.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
Length=494

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  549  NRRLVLLKGLN-IAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSF  373
            +++  L+K ++ +A  A+P+ AV GI+++IGSFS+GMGAVPWV+MSEIFPIN+KG AGS 
Sbjct  372  DKKRALVKQVHGLALKASPIFAVAGILIFIGSFSIGMGAVPWVLMSEIFPINIKGQAGSL  431

Query  372  ATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQAT  193
             TLVNW GAWLCSYTFNFLM+W+S+GTFILYA +NVL++LFVI +VPETKG+TLEQIQ  
Sbjct  432  TTLVNWLGAWLCSYTFNFLMSWSSYGTFILYAVVNVLSVLFVIVIVPETKGKTLEQIQGA  491

Query  192  IN  187
            IN
Sbjct  492  IN  493



>ref|XP_010667578.1| PREDICTED: sugar transporter ERD6-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  528  KGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFG  349
            K   ++  AAP+LA+TGI+VYI +FSVGMGAVPWV+MSEIFPINVKGVAGS ATLVNWFG
Sbjct  372  KAHELSEKAAPILAITGILVYISAFSVGMGAVPWVVMSEIFPINVKGVAGSLATLVNWFG  431

Query  348  AWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            AW  SYTFNFLM W+S GTFI+YA IN  AI+FV+ VVPETKGR+LEQIQA INA
Sbjct  432  AWAISYTFNFLMEWSSSGTFIIYAVINAAAIIFVVMVVPETKGRSLEQIQADINA  486



>ref|XP_009102177.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 7 
[Brassica rapa]
Length=463

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIM+YI SFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  348  LKAHDMAHEAVPVLAVVGIMMYIASFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  407

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPETKG+TLE+IQA +N
Sbjct  408  GAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPETKGKTLEEIQAVVN  462



>emb|CDY39145.1| BnaA07g01410D [Brassica napus]
Length=463

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIM+YI SFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  348  LKAHDMAHEAVPVLAVVGIMMYIASFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  407

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPETKG+TLE+IQA +N
Sbjct  408  GAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPETKGKTLEEIQAVVN  462



>ref|XP_008386584.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
            NA P+LAVTGI+VYIG+FS+GMGAVPWV+MSEIFPIN+KG AGS ATLVNW  AWLCSYT
Sbjct  366  NAVPILAVTGILVYIGAFSIGMGAVPWVVMSEIFPINIKGQAGSLATLVNWLCAWLCSYT  425

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FN+LM W+S+GTFILYA IN LAILFV+ +VPETKG+TLE IQA IN
Sbjct  426  FNYLMIWSSYGTFILYAGINALAILFVVALVPETKGKTLEHIQAAIN  472



>ref|XP_004140089.1| PREDICTED: sugar transporter ERD6-like 7-like [Cucumis sativus]
 gb|KGN47881.1| hypothetical protein Csa_6G409380 [Cucumis sativus]
Length=473

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A  A P+L V G++VYIGSFS+GMGAVPWV+MSEIFPIN+KG+AGS ATL NWF
Sbjct  358  LKENNLAIQAVPLLTVAGVLVYIGSFSIGMGAVPWVVMSEIFPINIKGLAGSMATLTNWF  417

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW CSYTFNFLMAW+S+GTF++YA IN +AI FV+ +VPETKGR+LEQIQA IN
Sbjct  418  GAWACSYTFNFLMAWSSYGTFLIYAVINAMAIGFVVLIVPETKGRSLEQIQAAIN  472



>ref|XP_010545075.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Tarenaya 
hassleriana]
Length=385

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A +A P+LAV GI+ YIGSFS G+GA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  270  LKVHGMAPDAVPILAVVGILGYIGSFSAGLGAMPWVVMSEIFPINIKGVAGGMATLVNWF  329

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+WNSFGTFI+YA INVL I+FVI +VPETKG+TLEQIQA +N
Sbjct  330  GAWAVSYTFNFLMSWNSFGTFIIYAAINVLGIVFVITIVPETKGKTLEQIQAAVN  384



>ref|XP_004292610.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L    +A   APVLAVTGI+++IG+FS+GMGAVPW IMSEIFPIN+KG AGS ATLVNWF
Sbjct  359  LTAQELALTVAPVLAVTGILIFIGAFSIGMGAVPWTIMSEIFPINIKGQAGSLATLVNWF  418

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAWLCSYTFNFLM+W+++GTFILYA IN LAI+FVI  VPETKG+TLE+IQA I   S+ 
Sbjct  419  GAWLCSYTFNFLMSWSTYGTFILYAAINALAIVFVIFFVPETKGKTLEEIQAAI---SKE  475

Query  171  RRHKN-SRQDG  142
               +N  R++G
Sbjct  476  GSEENIKRRNG  486



>emb|CDX82668.1| BnaC07g01980D [Brassica napus]
Length=463

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A PVLAV GIM+YI SFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  348  LKAHDLAHEAVPVLAVVGIMMYIASFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  407

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPETKG+TLE+IQA +N
Sbjct  408  GAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPETKGKTLEEIQAIVN  462



>emb|CDY12861.1| BnaC07g15720D [Brassica napus]
Length=466

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A  A P+LAV GIMVYI SFS GMGA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  351  LKVHDMAHKAVPILAVVGIMVYIASFSAGMGAMPWVVMSEIFPINIKGVAGGMATLVNWF  410

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI VVPETKG+TLEQIQA +N
Sbjct  411  GAWAVSYTFNFLMSWSSYGTFVIYAVINALAIVFVIAVVPETKGKTLEQIQAVVN  465



>gb|KJB47013.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=478

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  519  NIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWL  340
            N+A +A P+LAVTGI++YI +FS GMGAVPWVIMSEIFPIN+KG AGS ATLVNWFGAW 
Sbjct  367  NLALDAVPILAVTGILIYISAFSAGMGAVPWVIMSEIFPINIKGAAGSLATLVNWFGAWA  426

Query  339  CSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
             SYTFNFLM+W+++GTFILYA IN  AILFV+ +VPETKG+TLEQIQA INA
Sbjct  427  VSYTFNFLMSWSAYGTFILYAAINAGAILFVVTLVPETKGKTLEQIQAAINA  478



>ref|XP_008368891.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A +A P+LAV GI+VYI +FS+GMGAVPWV+MSEIFPIN+KG AGS ATLVNWF
Sbjct  358  LKVHELALDAVPILAVAGILVYIXAFSIGMGAVPWVVMSEIFPINIKGQAGSLATLVNWF  417

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAWLCSYTFN+L +W+S+GTFILYA IN LAILFV+ +VPETKG+TLEQIQ  +N
Sbjct  418  GAWLCSYTFNYLXSWSSYGTFILYAGINTLAILFVVSLVPETKGKTLEQIQGAMN  472



>ref|XP_006444171.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 ref|XP_006479808.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57411.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=478

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   + P LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGV GS ATLVNWF
Sbjct  363  LKDHELGLESVPALAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVGGSLATLVNWF  422

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWL SYTFNFLM W+S+GTFILYA IN L ILF+I VVPETKGRTLEQIQA INA
Sbjct  423  GAWLVSYTFNFLMTWSSYGTFILYAAINALGILFMIIVVPETKGRTLEQIQAAINA  478



>gb|KDP21525.1| hypothetical protein JCGZ_21996 [Jatropha curcas]
Length=484

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  + P LAVTGI++YIGSFS GMGAVPWV+MSEIFPIN+KGVAGS ATL NWF
Sbjct  369  LKDHEMALTSVPTLAVTGILLYIGSFSAGMGAVPWVVMSEIFPINIKGVAGSLATLTNWF  428

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYT+NFL +W+S+GTF+LYA IN L I+F+ KVVPETKGRTLEQIQA INA
Sbjct  429  GAWAISYTYNFLTSWSSYGTFVLYAAINALGIVFIAKVVPETKGRTLEQIQAAINA  484



>ref|XP_006444169.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 gb|ESR57409.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=483

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +   + P LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGV GS ATLVNWF
Sbjct  368  LKDHELGLESVPALAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVGGSLATLVNWF  427

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAWL SYTFNFLM W+S+GTFILYA IN L ILF+I VVPETKGRTLEQIQA INA
Sbjct  428  GAWLVSYTFNFLMTWSSYGTFILYAAINALGILFMIIVVPETKGRTLEQIQAAINA  483



>ref|XP_010070279.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Eucalyptus 
grandis]
Length=459

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  343  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  402

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPETKGR+LEQIQA IN
Sbjct  403  GAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPETKGRSLEQIQAAIN  457



>ref|XP_010545070.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545071.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545072.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545074.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
Length=464

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A +A P+LAV GI+ YIGSFS G+GA+PWV+MSEIFPIN+KGVAG  ATLVNWF
Sbjct  349  LKVHGMAPDAVPILAVVGILGYIGSFSAGLGAMPWVVMSEIFPINIKGVAGGMATLVNWF  408

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+WNSFGTFI+YA INVL I+FVI +VPETKG+TLEQIQA +N
Sbjct  409  GAWAVSYTFNFLMSWNSFGTFIIYAAINVLGIVFVITIVPETKGKTLEQIQAAVN  463



>ref|XP_010070277.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58937.1| hypothetical protein EUGRSUZ_H01560 [Eucalyptus grandis]
Length=481

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  365  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPETKGR+LEQIQA IN
Sbjct  425  GAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPETKGRSLEQIQAAIN  479



>ref|XP_011009474.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Populus 
euphratica]
Length=437

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  + P L + GI++YIGSFS GMGAVPWVIMSEIFPIN+KGVAGS ATLVNWF
Sbjct  322  LKVNELAIKSVPALTLIGILLYIGSFSAGMGAVPWVIMSEIFPINIKGVAGSLATLVNWF  381

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYT+N+LM+W+S+GTFILYA IN LAI+FV+ VVPETKGRTLEQIQA INA
Sbjct  382  GAWAVSYTYNYLMSWSSYGTFILYAAINALAIVFVVTVVPETKGRTLEQIQAAINA  437



>emb|CBI32306.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  486  VTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAW  307
            VTGI++YIGSFSVGMGAVPWV+MSEIFPIN+KGVAGS ATL+NWFGAW  SYTFN+LM+W
Sbjct  337  VTGILLYIGSFSVGMGAVPWVVMSEIFPINIKGVAGSLATLMNWFGAWAISYTFNYLMSW  396

Query  306  NSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            +S+GTFI+Y  IN LAI+FV+KVVPETKGRTLEQIQATINA
Sbjct  397  SSYGTFIIYGVINALAIVFVVKVVPETKGRTLEQIQATINA  437



>ref|XP_011009473.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Populus 
euphratica]
Length=478

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  + P L + GI++YIGSFS GMGAVPWVIMSEIFPIN+KGVAGS ATLVNWF
Sbjct  363  LKVNELAIKSVPALTLIGILLYIGSFSAGMGAVPWVIMSEIFPINIKGVAGSLATLVNWF  422

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYT+N+LM+W+S+GTFILYA IN LAI+FV+ VVPETKGRTLEQIQA INA
Sbjct  423  GAWAVSYTYNYLMSWSSYGTFILYAAINALAIVFVVTVVPETKGRTLEQIQAAINA  478



>ref|XP_002302812.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE82085.2| sugar transporter family protein [Populus trichocarpa]
Length=484

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  + P L +TGI++YIGSFS GMGAVPWVIMSEIFPIN+KGVAGS ATLVNWF
Sbjct  369  LKVNELAVKSVPALTLTGILLYIGSFSAGMGAVPWVIMSEIFPINIKGVAGSLATLVNWF  428

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYT+N+LM+W+S+GTFILYA IN LAI+FV+ VVPETKGRTLEQIQA IN
Sbjct  429  GAWAISYTYNYLMSWSSYGTFILYAAINALAIVFVVMVVPETKGRTLEQIQAAIN  483



>ref|XP_010070313.1| PREDICTED: sugar transporter ERD6-like 7 [Eucalyptus grandis]
 gb|KCW58972.1| hypothetical protein EUGRSUZ_H01602 [Eucalyptus grandis]
Length=479

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  363  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  422

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPETKGR+LEQIQA IN
Sbjct  423  GAWAVSYTFNYLMSWSSYGTFLLYAGINAAGMVFVITVVPETKGRSLEQIQAAIN  477



>ref|XP_004158614.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 7-like 
[Cucumis sativus]
Length=473

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+A  A P+L V G++VYIGSF  GMGAVPWV+MSEIFPIN+KG+AGS ATL NWF
Sbjct  358  LKENNLAIQAVPLLTVAGVLVYIGSFQXGMGAVPWVVMSEIFPINIKGLAGSMATLTNWF  417

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW CSYTFNFLMAW+S+GTF++YA IN +AI FV+ +VPETKGR+LEQIQA IN
Sbjct  418  GAWACSYTFNFLMAWSSYGTFLIYAVINAMAIGFVVLIVPETKGRSLEQIQAAIN  472



>ref|XP_002270927.2| PREDICTED: sugar transporter ERD6-like 7 [Vitis vinifera]
 gb|ADP37173.1| putative ERD6-like transporter [Vitis vinifera]
Length=490

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  486  VTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAW  307
            VTGI++YIGSFSVGMGAVPWV+MSEIFPIN+KGVAGS ATL+NWFGAW  SYTFN+LM+W
Sbjct  390  VTGILLYIGSFSVGMGAVPWVVMSEIFPINIKGVAGSLATLMNWFGAWAISYTFNYLMSW  449

Query  306  NSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            +S+GTFI+Y  IN LAI+FV+KVVPETKGRTLEQIQATINA
Sbjct  450  SSYGTFIIYGVINALAIVFVVKVVPETKGRTLEQIQATINA  490



>gb|EPS59997.1| hypothetical protein M569_14807, partial [Genlisea aurea]
Length=454

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK    A  AAP LAV GI+VYIG+FSVGMGAVPWVIMSEIFPIN+KGVAGS ATLVNWF
Sbjct  343  LKEHGEAIGAAPTLAVAGILVYIGAFSVGMGAVPWVIMSEIFPINIKGVAGSTATLVNWF  402

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
            GAW  S+TFNFLM+W+S+GTFILYA +N LAI+FVI++VPETKG+TLEQIQA
Sbjct  403  GAWAVSFTFNFLMSWSSYGTFILYAAVNALAIVFVIQLVPETKGKTLEQIQA  454



>ref|XP_010070291.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=459

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  343  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  402

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPETKGR+LEQIQ  IN
Sbjct  403  GAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPETKGRSLEQIQTAIN  457



>ref|XP_010070290.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
Length=481

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  365  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPETKGR+LEQIQ  IN
Sbjct  425  GAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPETKGRSLEQIQTAIN  479



>gb|KCW58947.1| hypothetical protein EUGRSUZ_H01571 [Eucalyptus grandis]
Length=484

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  368  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  427

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPETKGR+LEQIQ  IN
Sbjct  428  GAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPETKGRSLEQIQTAIN  482



>ref|XP_008449464.1| PREDICTED: sugar transporter ERD6-like 7 [Cucumis melo]
Length=473

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+   +A  AAP+L V G++VYIGSFS+GMG VPWV+MSEIFPIN+KG+AGS ATL NWF
Sbjct  358  LRENKLAIQAAPLLTVAGVLVYIGSFSIGMGPVPWVVMSEIFPINIKGLAGSMATLTNWF  417

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW CSYTFNFLMAW+S+GTF++YA +N +AI FV+ +VPETKG++LEQIQA IN
Sbjct  418  GAWACSYTFNFLMAWSSYGTFLIYAVVNAMAIGFVVLIVPETKGKSLEQIQAAIN  472



>ref|XP_002320384.1| sugar transporter family protein [Populus trichocarpa]
 gb|EEE98699.1| sugar transporter family protein [Populus trichocarpa]
Length=436

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  +AP+LAVTGI++YIG+FS GMG +PWVIMSEIFP+N+KGV+GS ATLVNWF
Sbjct  322  LKVHELALKSAPMLAVTGILLYIGTFSAGMGPIPWVIMSEIFPLNIKGVSGSLATLVNWF  381

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             AW  S+TFNFLM+W+S+GTFILYA IN + I FV  +VPETKGRTLEQIQA I 
Sbjct  382  CAWAVSFTFNFLMSWSSYGTFILYAAINAMTIAFVALLVPETKGRTLEQIQAAIR  436



>ref|XP_006444168.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 ref|XP_006479807.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57408.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 gb|KDO87481.1| hypothetical protein CISIN_1g011565mg [Citrus sinensis]
Length=483

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  + P L + G++VYIGSFS GMGA PWV+MSEIFPIN+KGV GS  TLVNWF
Sbjct  368  LKTYGLALESVPALTLAGVLVYIGSFSSGMGATPWVLMSEIFPINIKGVGGSLTTLVNWF  427

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFL  W+S+GTF+LYA +N+L I+F+  VVPETKGRTLE+IQAT+N
Sbjct  428  GAWAISYTFNFLETWSSYGTFLLYAAVNILGIVFITTVVPETKGRTLEEIQATMN  482



>ref|XP_010242562.1| PREDICTED: sugar transporter ERD6-like 7 [Nelumbo nucifera]
Length=497

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            +K   I+  + P+LA+ GIMVYI SFS+GMGAVPWVIMSE+FPIN+KG+ GS  TLVNW 
Sbjct  381  MKVHEISLGSVPILALIGIMVYIASFSMGMGAVPWVIMSEVFPINIKGIGGSLVTLVNWS  440

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            G+W+ S+TFNFLM+W+S+GTF LYA +N+LAILFV K+VPETKGRTLE+IQA++N
Sbjct  441  GSWVVSFTFNFLMSWSSYGTFGLYALVNLLAILFVSKLVPETKGRTLEEIQASMN  495



>ref|XP_002512320.1| sugar transporter, putative [Ricinus communis]
 gb|EEF49772.1| sugar transporter, putative [Ricinus communis]
Length=455

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG ++A    P+LA+TG+M YI  FS+GMGA+PWV+MSE+FP+++KG+AGS  TLVNWF
Sbjct  341  LKGNHLALELVPILAITGVMFYIAFFSLGMGAIPWVLMSELFPLHLKGIAGSLVTLVNWF  400

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  S+TFNFLM W+SFGTF LYA I +  I F++K+VPETKGRTLE+IQA++N
Sbjct  401  GAWFISFTFNFLMGWSSFGTFFLYACICLCNIFFIVKMVPETKGRTLEEIQASVN  455



>ref|XP_011033659.1| PREDICTED: sugar transporter ERD6-like 7 [Populus euphratica]
Length=482

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A  +AP+LAV GI+++IG+FS GMG +PWVIMSEIFP+N+KGVAGS ATLVNWF
Sbjct  368  LKVHELALKSAPMLAVIGILLFIGTFSAGMGPIPWVIMSEIFPLNIKGVAGSLATLVNWF  427

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             AW  S+TFNFLM+W+S+GTFILYA IN + I FV  +VPETKGRTLEQIQA I 
Sbjct  428  CAWAVSFTFNFLMSWSSYGTFILYAAINAMTIAFVALLVPETKGRTLEQIQAAIR  482



>ref|XP_010105671.1| Sugar transporter ERD6-like 16 [Morus notabilis]
 gb|EXC05702.1| Sugar transporter ERD6-like 16 [Morus notabilis]
Length=439

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 101/126 (80%), Gaps = 2/126 (2%)
 Frame = -3

Query  546  RRLVLLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFAT  367
            R L++  GL +    AP++AV G+++YI SFS+GMGAVPWVIMSEIFPI++KGVAGS   
Sbjct  313  RPLIMAHGLLL--ELAPIIAVAGVLIYISSFSIGMGAVPWVIMSEIFPIHMKGVAGSLVV  370

Query  366  LVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            LVNW GAW  SYT+NFLM+W+S+GT+++Y+  +++A+LFV  +VPETKG+TLE+IQA IN
Sbjct  371  LVNWLGAWAVSYTYNFLMSWSSYGTYLIYSGFSIMAVLFVAVLVPETKGKTLEEIQACIN  430

Query  186  A*SRTR  169
            A  R  
Sbjct  431  ADKRVE  436



>ref|XP_010242560.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Nelumbo 
nucifera]
Length=447

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   ++ N  PVLA++G++VYIGSFSVGMGAVPWVIMSEIFPIN+KG+AGS  TLVNW 
Sbjct  332  LKASQLSLNWVPVLALSGVLVYIGSFSVGMGAVPWVIMSEIFPINLKGIAGSLVTLVNWL  391

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            G+WL SYTFNFL  W+++G F +Y+ I  + I F+ KVVPETKGRTLE+IQA++N+
Sbjct  392  GSWLVSYTFNFLSVWSTYGAFFVYSAICAIGIGFIFKVVPETKGRTLEEIQASMNS  447



>gb|KJB72536.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=482

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LAV G+++Y+GSFS+G+GA PWVIMSEIFPINVKGVAGS   LVNW GAW  SYTFNF
Sbjct  376  PILAVAGVLIYVGSFSIGLGAAPWVIMSEIFPINVKGVAGSLVVLVNWLGAWAVSYTFNF  435

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            +M W+S+GTF +Y+ +++L ILFV+K VPETKG+TLE+IQA IN+
Sbjct  436  MMTWSSYGTFYIYSGVSILTILFVVKFVPETKGKTLEEIQACINS  480



>gb|KDO74959.1| hypothetical protein CISIN_1g018767mg [Citrus sinensis]
Length=350

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG N+  +  PVLAV GI++YI  FS+G GAVPWVIMSEIFPIN+KGVAGS   LVNW 
Sbjct  234  LKGQNMFLDWVPVLAVGGILIYIAFFSIGFGAVPWVIMSEIFPINIKGVAGSLVVLVNWS  293

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+  +V+ +LFV K VPETKG+TLEQIQA+IN
Sbjct  294  GAWAVSYTFNFLMSWSSSGTFFIYSAFSVITVLFVAKFVPETKGKTLEQIQASIN  348



>ref|XP_008809152.1| PREDICTED: sugar transporter ERD6-like 16 [Phoenix dactylifera]
Length=414

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   I  +  P+LA+ GI+ ++GSFS+GMGA+PW+IMSEIFPIN+KGVAGS  TLVNWF
Sbjct  297  LKDRGICMDWVPLLALAGILGFLGSFSIGMGAIPWIIMSEIFPINIKGVAGSLVTLVNWF  356

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            G+W+ SY FNFLM+W+S GTF++++ I   ++LFV K+VPETKGRTLE+IQA++N+
Sbjct  357  GSWVVSYAFNFLMSWSSSGTFLIFSAICATSVLFVAKLVPETKGRTLEEIQASMNS  412



>ref|XP_010912096.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=483

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     P+LA+ GI+VYIGSFS+GMGAVPWVIMSEIFPIN+KG+AG   TLVNWF
Sbjct  366  LKGQGMHAEWVPILALAGIIVYIGSFSIGMGAVPWVIMSEIFPINIKGIAGGLVTLVNWF  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            G+W  SYTFNFLM+W+S GTF +++  +   ILFV +VVPETKGRTLE+IQ+++N
Sbjct  426  GSWAVSYTFNFLMSWSSAGTFFIFSAASAATILFVARVVPETKGRTLEEIQSSLN  480



>ref|XP_006356995.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
 ref|XP_006358532.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
Length=472

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG +I     P+LAV+G++VYI +FS+GMGAVPWVIMSEIFPI+VK  AGS   LVNW 
Sbjct  357  LKGNDILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSEIFPIHVKSAAGSLVVLVNWL  416

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTF FLMAW S GTF+LYA  +VL ILFV KVVPETKG+TLE+IQA IN+
Sbjct  417  GAWAVSYTFGFLMAWTSTGTFMLYAGFSVLTILFVAKVVPETKGKTLEEIQAIINS  472



>ref|XP_006419726.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 gb|ESR32966.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=387

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG N+  +  PVLAV GI++YI  FS+G GAVPWVIMSEIFPIN+KGVAGS   LVNW 
Sbjct  271  LKGQNMFLDWVPVLAVGGILIYIAFFSIGFGAVPWVIMSEIFPINIKGVAGSLVVLVNWS  330

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+  +V+ +LFV K VPETKG+TLEQIQA+IN
Sbjct  331  GAWAVSYTFNFLMSWSSSGTFFIYSAFSVITVLFVAKFVPETKGKTLEQIQASIN  385



>ref|XP_004229493.1| PREDICTED: sugar transporter ERD6-like 16 [Solanum lycopersicum]
Length=468

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG +I     P+LAV+G++VYI +FS+GMGAVPWVIMSEIFPI VK  AGS   LVNW 
Sbjct  353  LKGNDILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSEIFPIQVKSAAGSLVVLVNWL  412

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTF FLMAW S GTF+LYA  +VL ILFV KVVPETKG+TLE+IQA IN+
Sbjct  413  GAWAVSYTFGFLMAWTSTGTFMLYAGFSVLTILFVAKVVPETKGKTLEEIQAIINS  468



>ref|XP_008438776.1| PREDICTED: sugar transporter ERD6-like 16 isoform X4 [Cucumis 
melo]
Length=452

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  PVL V G+++YI  FS+GMGAVPWVIMSEIFPINVKGV GS   LVNW 
Sbjct  327  LKGRGLLLDFVPVLVVAGVLIYIAFFSIGMGAVPWVIMSEIFPINVKGVGGSIVVLVNWL  386

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFV+K+VPETKGRTLE+IQA+IN+
Sbjct  387  GAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVMKLVPETKGRTLEEIQASINS  442



>ref|XP_008223080.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=499

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
             LKG  +  +  P++AV+G++ YI SFS+GMGAVPWVIMSEIFPI+VKG AGS   LVNW
Sbjct  373  FLKGYGLLLDWVPIIAVSGVLTYIASFSIGMGAVPWVIMSEIFPIHVKGAAGSLVVLVNW  432

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             GAW  SYT+NFLM+W+S GT+ +Y   ++L ILFV K+VPETKG+TLE+IQ+ IN+  R
Sbjct  433  LGAWAISYTYNFLMSWSSSGTYYIYTGFSLLTILFVAKLVPETKGKTLEEIQSCINS-DR  491

Query  174  TRRHK  160
            +RR  
Sbjct  492  SRRQD  496



>ref|XP_008438774.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Cucumis 
melo]
Length=474

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  PVL V G+++YI  FS+GMGAVPWVIMSEIFPINVKGV GS   LVNW 
Sbjct  349  LKGRGLLLDFVPVLVVAGVLIYIAFFSIGMGAVPWVIMSEIFPINVKGVGGSIVVLVNWL  408

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFV+K+VPETKGRTLE+IQA+IN+
Sbjct  409  GAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVMKLVPETKGRTLEEIQASINS  464



>ref|XP_007222121.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
 gb|EMJ23320.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
Length=499

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
             LKG  +  +  P++AV+G++ YI SFS+GMGAVPWVIMSEIFPI+VKG AGS   LVNW
Sbjct  373  FLKGYGLLLDWVPIIAVSGVLTYIASFSIGMGAVPWVIMSEIFPIHVKGAAGSLVVLVNW  432

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             GAW  SYT+NFLM+W+S GT+ +Y+  ++L ILFV K+VPETKG+TLE+IQ+ IN+  R
Sbjct  433  LGAWAISYTYNFLMSWSSSGTYYIYSGFSLLTILFVAKLVPETKGKTLEEIQSCINS-GR  491

Query  174  TRRHK  160
            +RR  
Sbjct  492  SRRQD  496



>ref|XP_008438775.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Cucumis 
melo]
Length=465

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  PVL V G+++YI  FS+GMGAVPWVIMSEIFPINVKGV GS   LVNW 
Sbjct  340  LKGRGLLLDFVPVLVVAGVLIYIAFFSIGMGAVPWVIMSEIFPINVKGVGGSIVVLVNWL  399

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFV+K+VPETKGRTLE+IQA+IN+
Sbjct  400  GAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVMKLVPETKGRTLEEIQASINS  455



>ref|XP_011090877.1| PREDICTED: sugar transporter ERD6-like 16 [Sesamum indicum]
Length=484

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LAV+G++VYI +FS+GMG VPWVIMSEIFPI+VKGVAGS   LVNW GAW  SYTFNF
Sbjct  380  PILAVSGVLVYIATFSIGMGPVPWVIMSEIFPIHVKGVAGSLVVLVNWLGAWAVSYTFNF  439

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GTF++YA  +VL + FV KVVPETKG+TLE+IQA+IN+
Sbjct  440  LMSWSSTGTFLMYAGFSVLTVAFVAKVVPETKGKTLEEIQASINS  484



>ref|XP_010024484.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Eucalyptus 
grandis]
Length=440

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
             LK  N+     P++AVTG++++I SFS+GMGAVPW+IMSEIFPI++KG AGS   LVNW
Sbjct  315  FLKAHNMFPEFVPLMAVTGVLIFIASFSIGMGAVPWLIMSEIFPIDIKGAAGSLVVLVNW  374

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             GAW  SYTFNFLM W++ GTF +Y+  +VL ILFV K+VPETKG+TLE+IQA IN+ SR
Sbjct  375  LGAWAISYTFNFLMNWSNSGTFFIYSGFSVLTILFVAKLVPETKGKTLEEIQACINSDSR  434



>ref|XP_008795113.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Phoenix 
dactylifera]
Length=461

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     P+LA+ GI+VYIG+FS+GMGAVPWVIMSEIFPIN+KG+ G   TLVNWF
Sbjct  344  LKGQGMHAEWVPILALAGIIVYIGAFSIGMGAVPWVIMSEIFPINIKGIGGGLVTLVNWF  403

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            G+W  SY+FNFLM+W+S GTF +++  +   ILFV +VVPETKGRTLE+IQA++N+
Sbjct  404  GSWAISYSFNFLMSWSSAGTFFIFSAASAATILFVARVVPETKGRTLEEIQASLNS  459



>ref|XP_008438773.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Cucumis 
melo]
Length=496

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  PVL V G+++YI  FS+GMGAVPWVIMSEIFPINVKGV GS   LVNW 
Sbjct  371  LKGRGLLLDFVPVLVVAGVLIYIAFFSIGMGAVPWVIMSEIFPINVKGVGGSIVVLVNWL  430

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFV+K+VPETKGRTLE+IQA+IN+
Sbjct  431  GAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVMKLVPETKGRTLEEIQASINS  486



>ref|XP_006419729.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 ref|XP_006489198.1| PREDICTED: sugar transporter ERD6-like 16-like [Citrus sinensis]
 gb|ESR32969.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=490

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG N+  +  PVLAV GI++YI  FS+G GAVPWVIMSEIFPIN+KGVAGS   LVNW 
Sbjct  374  LKGQNMFLDWVPVLAVGGILIYIAFFSIGFGAVPWVIMSEIFPINIKGVAGSLVVLVNWS  433

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+  +V+ +LFV K VPETKG+TLEQIQA+IN
Sbjct  434  GAWAVSYTFNFLMSWSSSGTFFIYSAFSVITVLFVAKFVPETKGKTLEQIQASIN  488



>ref|XP_010024483.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Eucalyptus 
grandis]
 gb|KCW60928.1| hypothetical protein EUGRSUZ_H03662 [Eucalyptus grandis]
Length=497

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
             LK  N+     P++AVTG++++I SFS+GMGAVPW+IMSEIFPI++KG AGS   LVNW
Sbjct  372  FLKAHNMFPEFVPLMAVTGVLIFIASFSIGMGAVPWLIMSEIFPIDIKGAAGSLVVLVNW  431

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             GAW  SYTFNFLM W++ GTF +Y+  +VL ILFV K+VPETKG+TLE+IQA IN+ SR
Sbjct  432  LGAWAISYTFNFLMNWSNSGTFFIYSGFSVLTILFVAKLVPETKGKTLEEIQACINSDSR  491



>gb|KDP23565.1| hypothetical protein JCGZ_23398 [Jatropha curcas]
Length=385

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -3

Query  528  KGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFG  349
            K  ++A +  P+LA+TG+M+YI SFS+GMG +PWV+MSE+FP+++KG+AGS  TLVNWF 
Sbjct  272  KAHHLAIDLVPILAITGVMLYIASFSIGMGGIPWVLMSELFPLHLKGIAGSLVTLVNWFA  331

Query  348  AWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            +W  S TFN LM WNS+GTF LYA I + +I F+ K+VPETKGRTLE+IQA+ N
Sbjct  332  SWFISLTFNLLMEWNSYGTFFLYACICIYSIFFIAKLVPETKGRTLEEIQASAN  385



>ref|XP_008795112.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Phoenix 
dactylifera]
Length=483

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     P+LA+ GI+VYIG+FS+GMGAVPWVIMSEIFPIN+KG+ G   TLVNWF
Sbjct  366  LKGQGMHAEWVPILALAGIIVYIGAFSIGMGAVPWVIMSEIFPINIKGIGGGLVTLVNWF  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            G+W  SY+FNFLM+W+S GTF +++  +   ILFV +VVPETKGRTLE+IQA++N+
Sbjct  426  GSWAISYSFNFLMSWSSAGTFFIFSAASAATILFVARVVPETKGRTLEEIQASLNS  481



>emb|CDO98940.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG N+     P+LAV+G+++YI +FS+GMGAVPWVIMSEIFPINVKG AGS   LVNW 
Sbjct  373  LKGQNLLLEWVPLLAVSGVLIYIAAFSIGMGAVPWVIMSEIFPINVKGAAGSLVVLVNWI  432

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  S+TFNFLM+W+S GTF +YA   VL +LFV + VPETKG+TLE++QA+IN 
Sbjct  433  GAWAVSFTFNFLMSWSSTGTFFIYAGFCVLTVLFVARFVPETKGKTLEEVQASING  488



>ref|XP_007207811.1| hypothetical protein PRUPE_ppa023976mg, partial [Prunus persica]
 gb|EMJ09010.1| hypothetical protein PRUPE_ppa023976mg, partial [Prunus persica]
Length=92

 Score =   150 bits (378),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -3

Query  459  SFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILY  280
            SFS+GM  VPW++MSEIF IN++G A SFATLVNW GAWLCSYTFNFLM+W+S+GTFILY
Sbjct  1    SFSIGMRGVPWIVMSEIFAINIEGQARSFATLVNWLGAWLCSYTFNFLMSWSSYGTFILY  60

Query  279  ATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            A IN LAILFVI +VPETKG+TLEQIQ  IN
Sbjct  61   AAINALAILFVILMVPETKGKTLEQIQGDIN  91



>gb|KJB28573.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=480

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+     P+LAV G+++Y+ SFS+GMGAVPWVIMSEIFPIN+KGVAGS   LVNW 
Sbjct  365  LKEHNLLPEWVPILAVGGVLIYVASFSIGMGAVPWVIMSEIFPINIKGVAGSLVVLVNWL  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+S GTF +Y+  +++ IL+V K VPETKG+TLE+IQA IN+
Sbjct  425  GAWAVSYTFNFLMSWSSSGTFFIYSGFSLMTILYVAKFVPETKGKTLEEIQACINS  480



>ref|XP_009603615.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nicotiana 
tomentosiformis]
Length=386

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSEIFPI+VK  AGS   LVNW 
Sbjct  271  LKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSEIFPIHVKSAAGSLVVLVNWL  330

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  S+TF+FLMAW++ GTF+LYA   VL ILFV KVVPETKG+TLE+IQA IN+
Sbjct  331  GAWAVSFTFSFLMAWSATGTFMLYAGFCVLTILFVAKVVPETKGKTLEEIQAIINS  386



>ref|XP_007035424.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY06350.1| Major facilitator superfamily protein [Theobroma cacao]
Length=479

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++     P+LAV G+++YI SFS+GMGAVPWVIMSEIFPINVKGVAGS   LVNW 
Sbjct  364  LKDHSLLPEWVPILAVGGVLIYIASFSIGMGAVPWVIMSEIFPINVKGVAGSLVVLVNWL  423

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYTFNFLM+W+  GTF +Y+  +V+ +LFV K VPETKG+TLE+IQA+IN+
Sbjct  424  GAWAVSYTFNFLMSWSPSGTFFVYSGFSVMTVLFVAKFVPETKGKTLEEIQASINS  479



>ref|XP_010279404.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nelumbo 
nucifera]
Length=462

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     P+LAV+G+++YIGSFS+GMGAVPWV+MSEIFPIN+KG AGS  TLVNW 
Sbjct  347  LKGHQLLHAWVPMLAVSGVLIYIGSFSIGMGAVPWVMMSEIFPINIKGAAGSLVTLVNWL  406

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN LM  +S GTF+ YA    L +LFV KVVPETKGRTLE+IQA++N
Sbjct  407  GAWAVSYTFNLLMNLSSSGTFLFYAGFCALTVLFVAKVVPETKGRTLEEIQASMN  461



>dbj|BAH01094.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52442.1| hypothetical protein OsJ_34588 [Oryza sativa Japonica Group]
Length=462

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P++A+TGI+VYI S+S+GMGAVPWVIMSEIFPIN+KG+ GSF TLVNW G+W  S+ FNF
Sbjct  356  PIIALTGILVYIASYSIGMGAVPWVIMSEIFPINIKGIGGSFVTLVNWSGSWAVSFAFNF  415

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
             M+W+S GTF L+A +  +AILF++K+VPETKG+TLE+IQA++N+
Sbjct  416  FMSWSSSGTFFLFALVCAVAILFIVKIVPETKGKTLEEIQASMNS  460



>gb|ADP37168.1| putative ERD6-like transporter [Vitis vinifera]
Length=473

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A N  P+LAVTGI+VYIG +SVG+GA+PWVIMSEIFP+++KG AGS  TLVNW
Sbjct  358  LLKAHQLATNLVPILAVTGILVYIGFYSVGLGAIPWVIMSEIFPLHIKGTAGSLVTLVNW  417

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W  SYTFNFLM W+S GTF  YA +   A++F++ +VPETKGRTLE+IQA++N
Sbjct  418  CGSWAVSYTFNFLMNWSSHGTFFGYAFVCAAAVVFIVMLVPETKGRTLEEIQASMN  473



>ref|XP_004134178.1| PREDICTED: sugar transporter ERD6-like 16-like [Cucumis sativus]
 gb|KGN57056.1| hypothetical protein Csa_3G150850 [Cucumis sativus]
Length=482

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  P+L V G+++YI  FS+GMGAVPWVIMSEIFPINVKGV GS   LVNW 
Sbjct  366  LKGRGLLLDFVPMLVVAGVLIYIAFFSIGMGAVPWVIMSEIFPINVKGVGGSIVVLVNWL  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFVIK+VPETKGRTLE+IQ +IN+
Sbjct  426  GAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVIKLVPETKGRTLEEIQTSINS  481



>ref|XP_010279395.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     P+LAV+G+++YIGSFS+GMGAVPWV+MSEIFPIN+KG AGS  TLVNW 
Sbjct  363  LKGHQLLHAWVPMLAVSGVLIYIGSFSIGMGAVPWVMMSEIFPINIKGAAGSLVTLVNWL  422

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN LM  +S GTF+ YA    L +LFV KVVPETKGRTLE+IQA++N
Sbjct  423  GAWAVSYTFNLLMNLSSSGTFLFYAGFCALTVLFVAKVVPETKGRTLEEIQASMN  477



>ref|XP_010660046.1| PREDICTED: sugar transporter ERD6-like 8 isoform X4 [Vitis vinifera]
Length=450

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
             LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEIFP++VK +AGS  TLVNW
Sbjct  334  FLKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEIFPLHVKAIAGSLVTLVNW  393

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FGAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPETKG+TLE+IQA++N
Sbjct  394  FGAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPETKGQTLEEIQASMN  449



>ref|XP_010660047.1| PREDICTED: sugar transporter ERD6-like 8 [Vitis vinifera]
Length=471

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A N  P+LAVTGI+VYIG +SVG+GA+PWVIMSEIFP+++KG AGS  TLVNW
Sbjct  356  LLKAHQLATNLVPILAVTGILVYIGFYSVGLGAIPWVIMSEIFPLHIKGTAGSLVTLVNW  415

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W  SYTFNFLM W+S GTF  YA +   A++F++ +VPETKGRTLE+IQA++N
Sbjct  416  CGSWAVSYTFNFLMNWSSHGTFFGYAFVCAAAVVFIVMLVPETKGRTLEEIQASMN  471



>ref|XP_010660044.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 ref|XP_010660045.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 gb|ADP37167.1| putative ERD6-like transporter [Vitis vinifera]
Length=474

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEIFP++VK +AGS  TLVNWF
Sbjct  359  LKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEIFPLHVKAIAGSLVTLVNWF  418

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPETKG+TLE+IQA++N
Sbjct  419  GAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPETKGQTLEEIQASMN  473



>ref|XP_006577261.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X2 [Glycine 
max]
Length=497

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +L+ L+     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEIFPINVKG AGS  TLV+W
Sbjct  376  ILQDLHKWKGVSPILALVGVLVYVGSYSIGMGAIPWVIMSEIFPINVKGSAGSLVTLVSW  435

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
              +W+ SY+FNFLM+W+S GTF+++++I    +LFV K+VPETKGRTLE+IQA++N+ S 
Sbjct  436  LCSWIISYSFNFLMSWSSAGTFLMFSSICGFTVLFVAKLVPETKGRTLEEIQASLNSFSS  495

Query  174  TR  169
             R
Sbjct  496  KR  497



>ref|XP_003521722.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X1 [Glycine 
max]
 gb|KHN04026.1| Sugar transporter ERD6-like 5 [Glycine soja]
Length=482

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +L+ L+     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEIFPINVKG AGS  TLV+W
Sbjct  361  ILQDLHKWKGVSPILALVGVLVYVGSYSIGMGAIPWVIMSEIFPINVKGSAGSLVTLVSW  420

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
              +W+ SY+FNFLM+W+S GTF+++++I    +LFV K+VPETKGRTLE+IQA++N+ S 
Sbjct  421  LCSWIISYSFNFLMSWSSAGTFLMFSSICGFTVLFVAKLVPETKGRTLEEIQASLNSFSS  480

Query  174  TR  169
             R
Sbjct  481  KR  482



>ref|XP_003609563.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES91760.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=490

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+     P+LAV GI++Y+ +FS+GMG VPWVIMSEIFPI+VKG AGS   L+NW 
Sbjct  373  LKDQNLLLELVPILAVAGILIYVAAFSIGMGPVPWVIMSEIFPIHVKGTAGSLVVLINWL  432

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ SYTFNFLM+W+S GT  LYA  ++L ILFV K+VPETKG+TLE+IQA +N+
Sbjct  433  GAWVVSYTFNFLMSWSSPGTLFLYAGCSLLTILFVAKLVPETKGKTLEEIQACLNS  488



>gb|KHG12382.1| hypothetical protein F383_10647 [Gossypium arboreum]
Length=493

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L       P+L++ G++VY GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W
Sbjct  366  LLQDLQQWKEVTPILSLVGVLVYTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSW  425

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ S+ FNFLM W+S GTF ++ATI  L +LFV K+VPETKGRTLE+IQA++N  S 
Sbjct  426  LGSWIISFAFNFLMKWSSTGTFFIFATICGLTVLFVAKLVPETKGRTLEEIQASMNPVSL  485

Query  174  TRR  166
             RR
Sbjct  486  ERR  488



>emb|CBI26138.3| unnamed protein product [Vitis vinifera]
 gb|ADP37170.1| putative ERD6-like transporter [Vitis vinifera]
Length=438

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            PVLA+ G+++YI SFS+GMGAVPWVIMSEIFPINVKG AGS   LVNW GAW+ SYTFNF
Sbjct  334  PVLAIGGVLLYIASFSIGMGAVPWVIMSEIFPINVKGAAGSLVVLVNWLGAWVVSYTFNF  393

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+  GTF +YA  + + ILFV K+VPETKG+TLE+IQA I++
Sbjct  394  LMSWSPTGTFSIYAGFSAMTILFVAKIVPETKGKTLEEIQACIDS  438



>emb|CDY13925.1| BnaC09g39010D [Brassica napus]
Length=121

 Score =   149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  540  LVLLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLV  361
            ++ ++G ++     P LAV G+++YI +FS+GMG VPWVIMSEIFPINVKG+AGS   LV
Sbjct  1    MLWIQGQSLLLEWVPFLAVGGVLIYIAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLV  60

Query  360  NWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            NW GAW  SYTFNFLM+W S GTF +Y+    + I+FV K+VPETKG+TLE+IQA+I 
Sbjct  61   NWSGAWAVSYTFNFLMSWTSPGTFYMYSAFAAMTIIFVAKMVPETKGKTLEEIQASIR  118



>ref|XP_009603614.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
tomentosiformis]
Length=481

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSEIFPI+VK  AGS   LVNW 
Sbjct  366  LKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSEIFPIHVKSAAGSLVVLVNWL  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  S+TF+FLMAW++ GTF+LYA   VL ILFV KVVPETKG+TLE+IQA IN+
Sbjct  426  GAWAVSFTFSFLMAWSATGTFMLYAGFCVLTILFVAKVVPETKGKTLEEIQAIINS  481



>ref|XP_009414205.1| PREDICTED: sugar transporter ERD6-like 16 [Musa acuminata subsp. 
malaccensis]
Length=481

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  I  +  P LA++GI+VY+GS+S+GMGAVPWV+MSEIFP+N+KGV GS  TLV+WF
Sbjct  364  LKGQGIYMDCVPTLALSGILVYLGSYSIGMGAVPWVMMSEIFPLNIKGVGGSLVTLVSWF  423

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            G+W  SY FNFLM+W+S GTF L++      +LFV +VVPETKGR+LE+IQ ++N+
Sbjct  424  GSWAVSYAFNFLMSWSSAGTFFLFSAAGAATLLFVARVVPETKGRSLEEIQESLNS  479



>ref|XP_010660042.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Vitis vinifera]
Length=497

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEIFP++VK +AGS  TLVNWF
Sbjct  382  LKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEIFPLHVKAIAGSLVTLVNWF  441

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPETKG+TLE+IQA++N
Sbjct  442  GAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPETKGQTLEEIQASMN  496



>ref|XP_010660043.1| PREDICTED: sugar transporter ERD6-like 8 isoform X2 [Vitis vinifera]
Length=492

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEIFP++VK +AGS  TLVNWF
Sbjct  377  LKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEIFPLHVKAIAGSLVTLVNWF  436

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPETKG+TLE+IQA++N
Sbjct  437  GAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPETKGQTLEEIQASMN  491



>ref|XP_002278197.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Vitis vinifera]
Length=492

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            PVLA+ G+++YI SFS+GMGAVPWVIMSEIFPINVKG AGS   LVNW GAW+ SYTFNF
Sbjct  388  PVLAIGGVLLYIASFSIGMGAVPWVIMSEIFPINVKGAAGSLVVLVNWLGAWVVSYTFNF  447

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+  GTF +YA  + + ILFV K+VPETKG+TLE+IQA I++
Sbjct  448  LMSWSPTGTFSIYAGFSAMTILFVAKIVPETKGKTLEEIQACIDS  492



>emb|CBI34327.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEIFP++VK +AGS  TLVNWF
Sbjct  487  LKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEIFPLHVKAIAGSLVTLVNWF  546

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPETKG+TLE+IQA++N
Sbjct  547  GAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPETKGQTLEEIQASMN  601



>gb|EYU43869.1| hypothetical protein MIMGU_mgv1a018596mg [Erythranthe guttata]
Length=480

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 101/131 (77%), Gaps = 7/131 (5%)
 Frame = -3

Query  576  IRTASRLYINRRLVLLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPIN  397
            I T +  Y+  + +LL+ +       P+LAV+G++V++ +FS+GMGAVPWVIMSEIFPI+
Sbjct  357  ILTGASFYLKGQALLLEWV-------PILAVSGVLVFVAAFSIGMGAVPWVIMSEIFPIH  409

Query  396  VKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGR  217
            VKGVAGS   LVNW GAW  SYTFNFLM+W+S GTF +YA +  + ++FV KVVPETKG+
Sbjct  410  VKGVAGSLVVLVNWLGAWAVSYTFNFLMSWSSTGTFSIYAGVCAMTVVFVAKVVPETKGK  469

Query  216  TLEQIQATINA  184
            TLE+IQA+ N+
Sbjct  470  TLEEIQASFNS  480



>ref|XP_003575758.2| PREDICTED: sugar transporter ERD6-like 16 [Brachypodium distachyon]
Length=440

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   I     PV+A+TGI+VYI SFS+GMG+VPWVIMSEIFPIN+KG+ GSF TLVNWF
Sbjct  323  LKTHGIFAEQVPVIALTGILVYIASFSLGMGSVPWVIMSEIFPINMKGIGGSFVTLVNWF  382

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            G+   S+ FNF M+W+S GTF  +A +  +AILF++KVVPETKG+TLE+IQ +IN
Sbjct  383  GSLAVSFAFNFFMSWSSSGTFFFFAFVCAMAILFIVKVVPETKGKTLEEIQVSIN  437



>ref|XP_002882396.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58655.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  355  LLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINMKGTAGGLVTVVNW  414

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +WL S+TFNFLM W++ GTF +Y  + VLAI+F+ K+VPETKGRTLE+IQA
Sbjct  415  LSSWLVSFTFNFLMIWSTHGTFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQA  467



>tpg|DAA53930.1| TPA: hypothetical protein ZEAMMB73_856317 [Zea mays]
Length=220

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = -3

Query  495  VLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFL  316
            VLA+ G++V+IGSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G+W+ SY FNFL
Sbjct  109  VLALAGLLVFIGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSWLGSWIVSYAFNFL  168

Query  315  MAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTRRHK  160
            + W+S+GTF ++A I  L ++FV ++VPETKGRTLE+IQA++N+ S T  HK
Sbjct  169  LIWSSYGTFFIFAAICGLTVVFVHRLVPETKGRTLEEIQASMNS-SLTPFHK  219



>ref|XP_002512323.1| sugar transporter, putative [Ricinus communis]
 gb|EEF49775.1| sugar transporter, putative [Ricinus communis]
Length=488

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L+   N +P LA+TG+++Y GSFS+GMG +PWVIMSE+FPIN+KG AGS  TLV+W
Sbjct  367  LLQDLHTWMNFSPFLALTGVLIYTGSFSLGMGGIPWVIMSEVFPINMKGSAGSLVTLVSW  426

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W+ SY FNFLM W+S GTF+++++I  L +LFV K+VPETKGRTLE+IQA++N
Sbjct  427  LGSWIISYAFNFLMTWSSAGTFLIFSSICGLTVLFVAKLVPETKGRTLEEIQASMN  482



>gb|AAF27021.1|AC009177_11 putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  348  LLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNW  407

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +WL S+TFNFLM W+  GTF +Y  + VLAI+F+ K+VPETKGRTLE+IQA
Sbjct  408  LSSWLVSFTFNFLMIWSPHGTFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQA  460



>ref|NP_187166.2| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 sp|Q0WQ63.1|ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 dbj|BAF00736.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEE74191.1| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
Length=470

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  355  LLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNW  414

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +WL S+TFNFLM W+  GTF +Y  + VLAI+F+ K+VPETKGRTLE+IQA
Sbjct  415  LSSWLVSFTFNFLMIWSPHGTFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQA  467



>ref|XP_003626331.1| Sugar transporter ERD6, putative [Medicago truncatula]
Length=495

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  519  NIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWL  340
            ++    +P+LA+ G++VY GSFS+GMG +PWVIMSEIFPINVKG AGSF T V+W  +W+
Sbjct  363  DLHKEFSPILALVGVLVYTGSFSLGMGGIPWVIMSEIFPINVKGSAGSFVTFVHWLCSWI  422

Query  339  CSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             SY FNFLM+WNS GTF +++TI  L ILFV K+VPETKGRTLE++QA++N
Sbjct  423  VSYAFNFLMSWNSAGTFFIFSTICGLTILFVAKLVPETKGRTLEEVQASLN  473



>gb|KHN43250.1| Sugar transporter ERD6-like 5 [Glycine soja]
Length=434

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +L+ L+     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEIFPINVKG AGS  TLV+W
Sbjct  313  VLQDLHKWKGVSPILALVGVLVYVGSYSIGMGAIPWVIMSEIFPINVKGSAGSLVTLVSW  372

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
              +W+ SY FNFLM+W+S GTF +++ I    +LFV K+VPETKGRTLE+IQA++N+ S 
Sbjct  373  LCSWIISYAFNFLMSWSSAGTFFMFSGICGFTVLFVAKLVPETKGRTLEEIQASLNSYSS  432

Query  174  TR  169
             R
Sbjct  433  KR  434



>emb|CBI34326.3| unnamed protein product [Vitis vinifera]
Length=874

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A N  P+LAVTGI+VYIG +SVG+GA+PWVIMSEIFP+++KG AGS  TLVNW
Sbjct  759  LLKAHQLATNLVPILAVTGILVYIGFYSVGLGAIPWVIMSEIFPLHIKGTAGSLVTLVNW  818

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W  SYTFNFLM W+S GTF  YA +   A++F++ +VPETKGRTLE+IQA++N
Sbjct  819  CGSWAVSYTFNFLMNWSSHGTFFGYAFVCAAAVVFIVMLVPETKGRTLEEIQASMN  874



>gb|ABN09011.1| General substrate transporter; Sugar transporter superfamily 
[Medicago truncatula]
 gb|AES82549.2| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=481

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  519  NIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWL  340
            ++    +P+LA+ G++VY GSFS+GMG +PWVIMSEIFPINVKG AGSF T V+W  +W+
Sbjct  349  DLHKEFSPILALVGVLVYTGSFSLGMGGIPWVIMSEIFPINVKGSAGSFVTFVHWLCSWI  408

Query  339  CSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             SY FNFLM+WNS GTF +++TI  L ILFV K+VPETKGRTLE++QA++N
Sbjct  409  VSYAFNFLMSWNSAGTFFIFSTICGLTILFVAKLVPETKGRTLEEVQASLN  459



>ref|XP_009774898.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009774899.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nicotiana 
sylvestris]
Length=393

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSE+FPI+VK   GS   LVNW 
Sbjct  271  LKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSEVFPIHVKSAGGSLVVLVNWL  330

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAW  S+TF+FLM+W++ GTF+LYA   VL ILFV KVVPETKG+TLE+IQA IN  SRT
Sbjct  331  GAWAVSFTFSFLMSWSATGTFMLYAGFCVLTILFVAKVVPETKGKTLEEIQAIIN--SRT  388



>gb|KJB45167.1| hypothetical protein B456_007G293200 [Gossypium raimondii]
Length=487

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L       P+L++ G++VY GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W
Sbjct  366  LLQDLQQWKEVTPILSLVGVLVYTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSW  425

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ S+ FNFLM W+S GTF ++ATI  L +LFV K+VPETKGRTLE+IQA++N  S 
Sbjct  426  LGSWIISFAFNFLMKWSSTGTFFIFATICGLTVLFVAKLVPETKGRTLEEIQASMNPVSL  485

Query  174  TR  169
             R
Sbjct  486  ER  487



>ref|XP_006663074.1| PREDICTED: sugar transporter ERD6-like 16-like [Oryza brachyantha]
Length=463

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P++A+TGI++YI S+S+GMGAVPWVIMSEIFPIN+KG+ GSF TLVNW G+W  S+ FNF
Sbjct  356  PIIALTGILIYIASYSIGMGAVPWVIMSEIFPINIKGIGGSFVTLVNWSGSWAVSFAFNF  415

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
             M+W+S GTF ++A +  +AILF++K VPETKG+TLE+IQA++N+
Sbjct  416  FMSWSSSGTFFVFALVCAVAILFIVKAVPETKGKTLEEIQASMNS  460



>ref|XP_007205125.1| hypothetical protein PRUPE_ppa004943mg [Prunus persica]
 gb|EMJ06324.1| hypothetical protein PRUPE_ppa004943mg [Prunus persica]
Length=484

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L    +  P+LA+ GI+V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W
Sbjct  363  LLQNLQQWKHVTPILALVGILVFTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSW  422

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM WNS GTF +++ ++ + ILFV K+VPETKGRTLE+IQ ++N  S 
Sbjct  423  LGSWIVSYAFNFLMDWNSAGTFFMFSCVSGVTILFVAKLVPETKGRTLEEIQTSMNRFSE  482

Query  174  TR  169
             R
Sbjct  483  KR  484



>ref|XP_003553740.2| PREDICTED: sugar transporter ERD6-like 5-like [Glycine max]
Length=503

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +L+ L+     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEIFPINVKG AGS  TLV+W
Sbjct  382  VLQDLHKWKGVSPILALVGVLVYVGSYSIGMGAIPWVIMSEIFPINVKGSAGSLVTLVSW  441

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
              +W+ SY FNFLM+W+S GTF +++ I    +LFV K+VPETKGRTLE+IQA++N+ S 
Sbjct  442  LCSWIISYAFNFLMSWSSAGTFFMFSGICGFTVLFVAKLVPETKGRTLEEIQASLNSYSS  501

Query  174  TR  169
             R
Sbjct  502  KR  503



>ref|XP_009774897.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
sylvestris]
Length=488

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSE+FPI+VK   GS   LVNW 
Sbjct  366  LKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSEVFPIHVKSAGGSLVVLVNWL  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAW  S+TF+FLM+W++ GTF+LYA   VL ILFV KVVPETKG+TLE+IQA IN  SRT
Sbjct  426  GAWAVSFTFSFLMSWSATGTFMLYAGFCVLTILFVAKVVPETKGKTLEEIQAIIN--SRT  483



>ref|XP_008458507.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458508.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458509.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
Length=494

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 94/122 (77%), Gaps = 3/122 (2%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     P+LA+ G++ YI SFS+GMGAVPWVIMSEIFPI+VKG AGS   LVNW 
Sbjct  370  LKGHGLLLEWIPILAILGVLTYIASFSIGMGAVPWVIMSEIFPIHVKGAAGSLVVLVNWL  429

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAW  SYTFNFLM+W+  GTF +Y+  ++L I+FV K+VPETKG+TLE+IQATIN    T
Sbjct  430  GAWAVSYTFNFLMSWSPSGTFFVYSGFSLLTIVFVAKLVPETKGKTLEEIQATINP---T  486

Query  171  RR  166
            R+
Sbjct  487  RK  488



>ref|XP_006299027.1| hypothetical protein CARUB_v10015164mg [Capsella rubella]
 gb|EOA31925.1| hypothetical protein CARUB_v10015164mg [Capsella rubella]
Length=473

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  358  LLKAHGLAVDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINIKGTAGGLVTVVNW  417

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +WL S+TFNFLM W+  G F +Y  + VLAI+F+ K+VPETKGRTLE+IQA
Sbjct  418  LSSWLVSFTFNFLMLWSPHGAFYVYGGVCVLAIVFIAKLVPETKGRTLEEIQA  470



>ref|XP_008246533.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Prunus mume]
Length=482

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W
Sbjct  361  LLQNLQQWKQVTPILALVGVLVFTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSW  420

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM WNS GTF +++ ++ + ILFV K+VPETKGRTLE+IQ ++N  S 
Sbjct  421  LGSWIVSYAFNFLMDWNSAGTFFMFSCVSGVTILFVAKLVPETKGRTLEEIQTSMNRFSE  480

Query  174  TR  169
             R
Sbjct  481  KR  482



>gb|AES77878.2| sugar transporter [Medicago truncatula]
Length=143

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 17/107 (16%)
 Frame = -3

Query  504  AAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTF  325
            A   LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+N+KG AGS AT+VNWFGAWLCSYTF
Sbjct  54   AVSTLAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNIKGQAGSIATIVNWFGAWLCSYTF  113

Query  324  NFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            NFLM+W+S+                 + VVPETKG++LEQ+QA INA
Sbjct  114  NFLMSWSSY-----------------VAVVPETKGKSLEQLQAAINA  143



>ref|XP_004494647.1| PREDICTED: sugar transporter ERD6-like 5-like [Cicer arietinum]
Length=490

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+ ++     +PVLA+ G++VY+GS+S+G+GA+PWVIMSEIFPINVKG AGS  TL+NW 
Sbjct  370  LQDMHKWKEVSPVLALVGVLVYVGSYSLGIGAIPWVIMSEIFPINVKGSAGSLVTLINWL  429

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
             +W+ SYTFNFLM W+S GTF  +A I    +LFV K+VPETKGRTLE+IQA++N+ S  
Sbjct  430  CSWIVSYTFNFLMTWSSTGTFFGFAVICGFTVLFVAKLVPETKGRTLEEIQASLNSNSTK  489

Query  171  R  169
            R
Sbjct  490  R  490



>ref|XP_008388978.1| PREDICTED: sugar transporter ERD6-like 5 [Malus domestica]
Length=332

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W 
Sbjct  213  LQNLQQWKQITPILALVGVLVFTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLITLVSWL  272

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            G+W+ SYTFNFLM W+S GTF L+++++ + +LFV K+VPETKGRTLE+IQ ++N
Sbjct  273  GSWIVSYTFNFLMDWSSAGTFFLFSSVSAVTVLFVAKLVPETKGRTLEEIQTSLN  327



>ref|XP_010941736.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=473

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK   I  +  P+LA+TGI+ ++GSFS+GMGA+PWVIMSEIFPIN+KGVAGS  TLVNWF
Sbjct  356  LKDKGIYMDWVPLLALTGILGFLGSFSIGMGAIPWVIMSEIFPINIKGVAGSLVTLVNWF  415

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
             +W  SY FNFL++W+S GTF ++A     +++FV KVVPETKGRTLE+IQA++N+
Sbjct  416  ASWAVSYAFNFLVSWSSSGTFFVFAAFCATSVVFVAKVVPETKGRTLEEIQASMNS  471



>ref|XP_008246532.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Prunus mume]
Length=495

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W
Sbjct  374  LLQNLQQWKQVTPILALVGVLVFTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSW  433

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM WNS GTF +++ ++ + ILFV K+VPETKGRTLE+IQ ++N  S 
Sbjct  434  LGSWIVSYAFNFLMDWNSAGTFFMFSCVSGVTILFVAKLVPETKGRTLEEIQTSMNRFSE  493

Query  174  TR  169
             R
Sbjct  494  KR  495



>ref|XP_010485917.1| PREDICTED: sugar transporter ERD6-like 8 [Camelina sativa]
Length=471

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAVTG++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  356  LLKAHGLALDLIPALAVTGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNW  415

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +W  S+TFNFLM W+  G F +Y  + VLAI+F+ K+VPETKGRTLE+IQA
Sbjct  416  LSSWFVSFTFNFLMIWSPHGAFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQA  468



>ref|XP_011090878.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Sesamum 
indicum]
Length=485

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LA++G+++YI +FS+GMGAVPWVIM EIFPI +KG+AGS   LV+W  AWL SYTFNF
Sbjct  367  PMLAISGVLLYIATFSIGMGAVPWVIMGEIFPIYIKGIAGSLVCLVHWSVAWLISYTFNF  426

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTRRHKN  157
            LM WN+ GTF +YA  ++L +LFV KVVPETKG+TLE+IQA ++A  RT +++N
Sbjct  427  LMTWNAIGTFWIYAGFSMLTVLFVAKVVPETKGKTLEEIQAALSA-HRTAKNRN  479



>ref|XP_009419855.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P LA+ GI+VY+G+FS+GMGAVPWVIMSE+FPIN+KG+ GS  TLVNWFG+W  SY FNF
Sbjct  359  PTLALCGILVYVGAFSIGMGAVPWVIMSEVFPINIKGIGGSLVTLVNWFGSWAVSYAFNF  418

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GTF +++  N   I+FV  VVPETKGR+LE+IQ ++N+
Sbjct  419  LMSWSSAGTFFIFSAANAATIVFVAMVVPETKGRSLEEIQESLNS  463



>ref|XP_010423926.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Camelina 
sativa]
 ref|XP_010423997.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Camelina 
sativa]
Length=366

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  251  LLKAHGLALDLIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNW  310

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +W  S+TFNFLM W+  G F +Y  + VLAI+F+ K+VPETKGRTLE+IQA
Sbjct  311  LSSWFVSFTFNFLMLWSLHGAFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQA  363



>ref|XP_007226898.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
 gb|EMJ28097.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
Length=490

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  P++AV+G+++Y+  FS+GMGA PWVIMSEIFPI++KGV GS   LVNW 
Sbjct  369  LKGQGLLLDWVPIIAVSGVLIYVAFFSIGMGAGPWVIMSEIFPIDIKGVGGSLVVLVNWS  428

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAW+ SYT+NFLM W+S GT+ LY+ + +L ILFV KVVPETKG+TLE+IQA++N     
Sbjct  429  GAWIVSYTYNFLMRWSSPGTYFLYSAVCLLTILFVAKVVPETKGKTLEEIQASLNP---D  485

Query  171  RRHK  160
            RR  
Sbjct  486  RRQS  489



>ref|XP_009419854.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P LA+ GI+VY+G+FS+GMGAVPWVIMSE+FPIN+KG+ GS  TLVNWFG+W  SY FNF
Sbjct  375  PTLALCGILVYVGAFSIGMGAVPWVIMSEVFPINIKGIGGSLVTLVNWFGSWAVSYAFNF  434

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GTF +++  N   I+FV  VVPETKGR+LE+IQ ++N+
Sbjct  435  LMSWSSAGTFFIFSAANAATIVFVAMVVPETKGRSLEEIQESLNS  479



>ref|XP_002319570.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE95493.2| sugar transporter family protein [Populus trichocarpa]
Length=477

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ LN +   +P LA+ G+++Y GSFS+GMG +PWVIMSE+FPIN KG AGS  TLV+W
Sbjct  356  LLQYLNKSVAVSPFLALFGVLIYTGSFSLGMGGIPWVIMSEVFPINTKGSAGSLVTLVSW  415

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM W+S GTF +++ I  L +LFV K+VPETKGRTLE+IQA++N  S 
Sbjct  416  LGSWIISYAFNFLMDWSSAGTFFIFSCICGLTVLFVAKLVPETKGRTLEEIQASMNPLSA  475

Query  174  TR  169
             R
Sbjct  476  KR  477



>ref|XP_004508324.1| PREDICTED: sugar transporter ERD6-like 16-like [Cicer arietinum]
Length=488

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+     P+LAV G+++Y+ +FS+G+G VPWVIMSEIFPI+VKG AGS   L+NW 
Sbjct  373  LKDQNLMLEWVPILAVAGVLIYVAAFSIGLGPVPWVIMSEIFPIHVKGTAGSLVVLINWL  432

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ SYTFN LM+W+S GT  LYA  ++L ILFV K+VPETKG+TLE+IQA IN+
Sbjct  433  GAWIVSYTFNLLMSWSSPGTLFLYAGCSLLTILFVAKLVPETKGKTLEEIQACINS  488



>ref|XP_002263418.1| PREDICTED: sugar transporter ERD6-like 5 [Vitis vinifera]
 gb|ADP37156.1| putative ERD6-like transporter [Vitis vinifera]
Length=488

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+GL       P+ A+ G+++Y G+FS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W
Sbjct  362  LLQGLQGWKELGPIFALLGVLIYDGAFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSW  421

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM W+S GTF ++++I  + +LFV K+VPETKGRTLE+IQA++N  S 
Sbjct  422  LGSWIISYAFNFLMKWSSAGTFFIFSSICGITVLFVAKLVPETKGRTLEEIQASMNPLSA  481

Query  174  TRRHKNS  154
               H  S
Sbjct  482  KDIHSIS  488



>ref|XP_010912097.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Elaeis guineensis]
Length=480

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 97/120 (81%), Gaps = 6/120 (5%)
 Frame = -3

Query  528  KGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFG  349
            K +NIA      LA+TG++V+ GSFS+G+GA+PWVIMSEIFPIN+KG AGS  TLVNW G
Sbjct  366  KEINIA------LALTGMLVFTGSFSLGLGAIPWVIMSEIFPINMKGSAGSLVTLVNWLG  419

Query  348  AWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTR  169
            +W+ SYTFNFL+ W+S GTF L+A+I  L +LFV ++VPETKGRTLE+IQA++N+ S  +
Sbjct  420  SWIISYTFNFLITWSSAGTFFLFASICGLTVLFVERLVPETKGRTLEEIQASLNSFSSDK  479



>ref|XP_003621660.1| Sugar transporter ERD6-like protein [Medicago truncatula]
Length=130

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 17/107 (16%)
 Frame = -3

Query  504  AAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTF  325
            A   LAVTGI+VYIGSFS+GMGA+PWV+MSEIFP+N+KG AGS AT+VNWFGAWLCSYTF
Sbjct  41   AVSTLAVTGILVYIGSFSIGMGAIPWVVMSEIFPVNIKGQAGSIATIVNWFGAWLCSYTF  100

Query  324  NFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            NFLM+W+S+                 + VVPETKG++LEQ+QA INA
Sbjct  101  NFLMSWSSY-----------------VAVVPETKGKSLEQLQAAINA  130



>ref|XP_006400440.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
 gb|ESQ41893.1| hypothetical protein EUTSA_v10013389mg [Eutrema salsugineum]
Length=487

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +LKG ++     PVLAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW
Sbjct  369  VLKGQSLLLEWVPVLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNW  428

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             GAW  SYTFNFLM+W+S GTF +Y+   V  I+FV K+VPETKG+TLE+IQA I 
Sbjct  429  SGAWAVSYTFNFLMSWSSPGTFYMYSAFAVTTIIFVAKMVPETKGKTLEEIQACIR  484



>ref|XP_011462680.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=404

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P +AV+G+++YI  FS+GMGAVPWVIMSEIFPI+VKG AGS   LVNW GAW  SYT+NF
Sbjct  291  PTIAVSGVLIYIAFFSIGMGAVPWVIMSEIFPIHVKGAAGSLVVLVNWLGAWGVSYTYNF  350

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTRRHKN  157
            LM W+S+ T+ +Y+  ++L ILFV K+VPETKG+TLE+IQA IN+    RR ++
Sbjct  351  LMRWSSYRTYYMYSGFSLLTILFVAKLVPETKGKTLEEIQACINS---DRREQD  401



>ref|XP_009620983.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=389

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             ++P LA+ GI+V+ GSFS+GMG +PWVIMSEIFPINVKG+AGS  T+VNWFG+W+ SY+
Sbjct  277  KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEIFPINVKGLAGSLVTVVNWFGSWIVSYS  336

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FNFLM W+S GTF +++ +  L I+FV K+VPETKGRTLE+IQ ++N
Sbjct  337  FNFLMLWSSEGTFFIFSAVCGLTIMFVAKLVPETKGRTLEEIQLSMN  383



>emb|CBI34338.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+GL       P+ A+ G+++Y G+FS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W
Sbjct  391  LLQGLQGWKELGPIFALLGVLIYDGAFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSW  450

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM W+S GTF ++++I  + +LFV K+VPETKGRTLE+IQA++N  S 
Sbjct  451  LGSWIISYAFNFLMKWSSAGTFFIFSSICGITVLFVAKLVPETKGRTLEEIQASMNPLSA  510

Query  174  TRRHKNS  154
               H  S
Sbjct  511  KDIHSIS  517



>ref|XP_007030780.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY11282.1| Major facilitator superfamily protein [Theobroma cacao]
Length=486

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+ L       P+L++ G++VY GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W 
Sbjct  366  LQDLQQWKEGTPILSLVGVLVYTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSWL  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            G+W+ S+ FNFL+ W+S GTF ++A+I  L +LFV K+VPETKGRTLE+IQA+IN  S  
Sbjct  426  GSWIISFAFNFLLKWSSAGTFFIFASICGLTVLFVAKLVPETKGRTLEEIQASINPVSLE  485

Query  171  R  169
            R
Sbjct  486  R  486



>ref|XP_002315546.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
 gb|EEF01717.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
Length=488

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     P+L + G+++Y+ +FS+GMGAVPWVIMSEIFPIN+KG+AGS   LVNW 
Sbjct  373  LKGQGLLLEWVPILTIAGVLIYVSAFSIGMGAVPWVIMSEIFPINIKGIAGSLVVLVNWS  432

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  S+TFNFLM W+S GTF++Y+  +VL +L+V K VPETKG+TLE+IQ +IN+
Sbjct  433  GAWAVSFTFNFLMDWSSSGTFLVYSGFSVLTVLYVAKFVPETKGKTLEEIQKSINS  488



>ref|XP_010464026.1| PREDICTED: sugar transporter ERD6-like 8 [Camelina sativa]
Length=471

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  356  LLKAHGLALDLIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNW  415

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +W  S+TFNFLM W+  G F +Y  + VLAI+F+ K+VPETKGRTLE+IQA
Sbjct  416  LSSWFVSFTFNFLMLWSPHGAFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQA  468



>ref|XP_007147846.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
 gb|ESW19840.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
Length=523

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LAVTG+++YI +FS+GMG VPWVIMSEIFPINVKG AGS   L+NW GAW+ SYTFNF
Sbjct  419  PILAVTGVLIYIAAFSIGMGPVPWVIMSEIFPINVKGTAGSLVVLLNWLGAWIVSYTFNF  478

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GT  LYA  ++L I+FV K+VPETKG+TLE+IQ  I++
Sbjct  479  LMSWSSPGTLFLYAGSSLLTIVFVAKLVPETKGKTLEEIQDCISS  523



>ref|XP_010043109.1| PREDICTED: sugar transporter ERD6-like 5 [Eucalyptus grandis]
 gb|KCW85183.1| hypothetical protein EUGRSUZ_B02014 [Eucalyptus grandis]
Length=482

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LA+ G++VY GSFS+GMG +PWVIMSEIFPIN+KG AGS  T+V+W G+W+ SYTFNF
Sbjct  377  PILALVGVLVYTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTVVSWLGSWIISYTFNF  436

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            +M W+S GTF ++++I  L +LFV K+VPETKGRTLE+IQAT+N
Sbjct  437  MMDWSSAGTFFIFSSICGLTVLFVAKLVPETKGRTLEEIQATMN  480



>ref|XP_010666329.1| PREDICTED: sugar transporter ERD6-like 16 [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P LAV G++ YI +FS+G G VPWVIMSEIFPINVKGVAGS   LVNW GAWL SYT+NF
Sbjct  385  PTLAVGGVLTYISAFSIGFGGVPWVIMSEIFPINVKGVAGSLVVLVNWSGAWLISYTYNF  444

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
            +M W++FGTF +YA   VL ILFV K VPETKG+TLE+IQ +I + S 
Sbjct  445  MMRWSTFGTFYIYAAFCVLTILFVAKFVPETKGKTLEEIQESIRSKSE  492



>emb|CDX92578.1| BnaA10g16170D [Brassica napus]
Length=485

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG ++     P LAV G+++YI +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW 
Sbjct  368  LKGQSLLLEWVPFLAVGGVLIYIAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWS  427

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VPETKG+TLE+IQA+I 
Sbjct  428  GAWAVSYTFNFLMSWSSPGTFYMYSAFAAMTIIFVAKMVPETKGKTLEEIQASIR  482



>ref|XP_010492922.1| PREDICTED: sugar transporter ERD6-like 16 [Camelina sativa]
Length=482

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG N+  +  P+LAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW 
Sbjct  365  LKGQNLLLDWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWS  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VPETKG+TLE+IQ  I 
Sbjct  425  GAWAVSYTFNFLMSWSSPGTFYIYSAFAAMTIIFVAKMVPETKGKTLEEIQTCIR  479



>ref|XP_004296777.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P +AV+G+++YI  FS+GMGAVPWVIMSEIFPI+VKG AGS   LVNW GAW  SYT+NF
Sbjct  377  PTIAVSGVLIYIAFFSIGMGAVPWVIMSEIFPIHVKGAAGSLVVLVNWLGAWGVSYTYNF  436

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTRRHKN  157
            LM W+S+ T+ +Y+  ++L ILFV K+VPETKG+TLE+IQA IN+    RR ++
Sbjct  437  LMRWSSYRTYYMYSGFSLLTILFVAKLVPETKGKTLEEIQACINS---DRREQD  487



>ref|XP_011023522.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Populus 
euphratica]
Length=477

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ LN +   +P LA+ G+++Y GSFS+GMG +PWVIMSE+FPIN+KG AGS  TLV+W
Sbjct  356  LLQYLNKSVAVSPFLALFGVLIYTGSFSLGMGGIPWVIMSEVFPINMKGSAGSLVTLVSW  415

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM W+S GTF + + I  L +LFV K+VPETKGRTLE+IQA++N  S 
Sbjct  416  LGSWIISYAFNFLMDWSSAGTFFILSCICGLTVLFVAKLVPETKGRTLEEIQASMNPLSA  475

Query  174  TR  169
             R
Sbjct  476  KR  477



>ref|XP_009120937.1| PREDICTED: sugar transporter ERD6-like 16 [Brassica rapa]
Length=485

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG ++     P LAV G+++YI +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW 
Sbjct  368  LKGQSLLLEWVPFLAVGGVLIYIAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWS  427

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VPETKG+TLE+IQA+I 
Sbjct  428  GAWAVSYTFNFLMSWSSPGTFYMYSAFAAMTIIFVAKMVPETKGKTLEEIQASIR  482



>ref|XP_011466327.1| PREDICTED: sugar transporter ERD6-like 5 [Fragaria vesca subsp. 
vesca]
Length=492

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L       PV A+ G++VY GSFS+GMG +PWVIMSEIFPIN+KG AGS  T+V+W
Sbjct  371  LLQDLQGWSQVTPVFALVGVLVYTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTVVSW  430

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SR  175
             G+W+ SY FNFLM WNS GTF ++++I  + ++FV K+VPETKGRTLE+IQA++N  S 
Sbjct  431  LGSWIVSYAFNFLMDWNSAGTFFMFSSICGVTVIFVAKLVPETKGRTLEEIQASMNPFSV  490

Query  174  TR  169
             R
Sbjct  491  KR  492



>ref|XP_009782756.1| PREDICTED: sugar transporter ERD6-like 5 [Nicotiana sylvestris]
Length=421

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             ++P LA+ GI+V+ GSFS+GMG +PWVIMSEIFPINVKG+AGS  T+VNWFG+W+ SY+
Sbjct  312  KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEIFPINVKGLAGSIVTVVNWFGSWIVSYS  371

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            FNFLM W+S GTF +++ +  L ++FV K+VPETKGRTLE+IQ ++N+
Sbjct  372  FNFLMLWSSEGTFFIFSAVCGLTVMFVAKLVPETKGRTLEEIQLSMNS  419



>ref|XP_007050737.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX94894.1| Major facilitator superfamily protein [Theobroma cacao]
Length=484

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            L+K  N+     P+  + G+++++GSFS+GMGAVPWV+MSEIFPIN+KG AGS   L++W
Sbjct  368  LMKEHNLLQEWIPLFVLCGMLIFMGSFSIGMGAVPWVLMSEIFPINIKGAAGSLVNLIHW  427

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            FGAW  SYTFNFLM W+  GTF LY+ +   ++LFV KVVPETKGR LE+IQA++N+
Sbjct  428  FGAWAVSYTFNFLMDWSPSGTFFLYSGVCAASVLFVAKVVPETKGRALEEIQASMNS  484



>ref|XP_008223079.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=490

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  P++A++G+++Y+  FS+GMGA PWVIMSEIFPI++KGV GS   LVNW 
Sbjct  369  LKGQGLLLDWVPIIAMSGVLIYVAFFSIGMGAGPWVIMSEIFPIDIKGVGGSLVVLVNWS  428

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAW+ SYT+NFLM W+S GT+ LY+ + +L ILFV K+VPETKG+TLE+IQA++N     
Sbjct  429  GAWIVSYTYNFLMRWSSPGTYFLYSAVCLLTILFVAKIVPETKGKTLEEIQASLNP---D  485

Query  171  RRHK  160
            RR  
Sbjct  486  RRQS  489



>ref|XP_010454136.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Camelina 
sativa]
 ref|XP_010454137.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Camelina 
sativa]
Length=482

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG ++     P+LAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKGVAGS   LVNW 
Sbjct  365  LKGQSLLLEWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGVAGSLVVLVNWS  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VPETKG+TLE+IQA I 
Sbjct  425  GAWAVSYTFNFLMSWSSPGTFYIYSAFAAMTIIFVAKMVPETKGKTLEEIQACIR  479



>ref|NP_568367.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 sp|Q8LBI9.2|EDL16_ARATH RecName: Full=Sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 gb|AAL36051.1| AT5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AAN18269.1| At5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AED92620.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
Length=482

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLKG ++     P LAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW
Sbjct  364  LLKGQSLLLEWVPSLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNW  423

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             GAW  SYTFNFLM+W+S GTF LY+      I+FV K+VPETKG+TLE+IQA I 
Sbjct  424  SGAWAVSYTFNFLMSWSSPGTFYLYSAFAAATIIFVAKMVPETKGKTLEEIQACIR  479



>gb|AAM64736.1| sugar transporter-like protein [Arabidopsis thaliana]
Length=482

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLKG ++     P LAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW
Sbjct  364  LLKGQSLLLEWVPSLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNW  423

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             GAW  SYTFNFLM+W+S GTF LY+      I+FV K+VPETKG+TLE+IQA I 
Sbjct  424  SGAWAVSYTFNFLMSWSSPGTFYLYSAFAAATIIFVAKMVPETKGKTLEEIQACIR  479



>gb|KDP40049.1| hypothetical protein JCGZ_02047 [Jatropha curcas]
Length=490

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LAV G++V+I +FS+GMGAVPW+IMSEIFPIN+KGV GS   LVNW GAW+ SYTFNF
Sbjct  386  PILAVAGVLVFISAFSIGMGAVPWLIMSEIFPINIKGVGGSLVVLVNWLGAWIVSYTFNF  445

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            L++W+S G F LY+  +++ ILFV K VPETKG+TLE+IQ  IN+
Sbjct  446  LISWSSSGNFFLYSGFSLMTILFVAKFVPETKGKTLEEIQECINS  490



>ref|XP_009620982.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=470

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             ++P LA+ GI+V+ GSFS+GMG +PWVIMSEIFPINVKG+AGS  T+VNWFG+W+ SY+
Sbjct  358  KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEIFPINVKGLAGSLVTVVNWFGSWIVSYS  417

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FNFLM W+S GTF +++ +  L I+FV K+VPETKGRTLE+IQ ++N
Sbjct  418  FNFLMLWSSEGTFFIFSAVCGLTIMFVAKLVPETKGRTLEEIQLSMN  464



>ref|XP_008340870.1| PREDICTED: sugar transporter ERD6-like 16 [Malus domestica]
Length=496

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  +  P++AV+G+++YI SFS+GMGAVPWVIMSE+FPI+VKG AGS   L+NW 
Sbjct  372  LKGNGLLLDWVPIIAVSGVLIYIASFSLGMGAVPWVIMSEVFPIHVKGAAGSLVVLMNWL  431

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  SYT+NFLM+W+S  T+ +YA  ++L I+FV K+VPETKG+TLE+IQA IN+
Sbjct  432  GAWAVSYTYNFLMSWSSSRTYYIYAGFSLLTIIFVAKLVPETKGKTLEEIQACINS  487



>ref|XP_011011018.1| PREDICTED: sugar transporter ERD6-like 16 [Populus euphratica]
Length=488

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG     +  P+LA+ G+++Y+ +FS+GMGAVPWVIMSEIFPIN+KG+AGS   LVNW 
Sbjct  373  LKGHGWLLDWVPILAIAGVLIYVSAFSIGMGAVPWVIMSEIFPINIKGIAGSLVVLVNWS  432

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW  S+TFNFLM W+S GTF +Y+  +VL  L+V K VPETKG+TLE+IQ +IN+
Sbjct  433  GAWAVSFTFNFLMDWSSSGTFFVYSGFSVLTFLYVAKFVPETKGKTLEEIQKSINS  488



>ref|XP_008359875.1| PREDICTED: sugar transporter ERD6-like 5 [Malus domestica]
Length=486

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W 
Sbjct  367  LQNLQQWKQITPILALVGVLVFTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLITLVSWL  426

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            G+W+ SYTFNFLM W+S GTF L+++++ + +LFV K+VPETKGRTLE+IQ ++N
Sbjct  427  GSWIVSYTFNFLMDWSSAGTFFLFSSVSAVTVLFVAKLVPETKGRTLEEIQTSLN  481



>ref|XP_009417911.1| PREDICTED: sugar transporter ERD6-like 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417912.1| PREDICTED: sugar transporter ERD6-like 5 [Musa acuminata subsp. 
malaccensis]
Length=469

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +LKG   +     VLA+ GI+ Y GSFS+GMG +PWVIMSEIFP+N+KG AGS  TLV+W
Sbjct  350  MLKGHEFSKELNTVLALAGILTYTGSFSLGMGGIPWVIMSEIFPLNMKGTAGSLVTLVSW  409

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W+ SYTFNFLM W+S GTF ++A+I  L +LFV ++VPETKGRTLE+IQA+++
Sbjct  410  VGSWIISYTFNFLMMWSSAGTFFIFASICGLTVLFVERLVPETKGRTLEEIQASMS  465



>ref|XP_010546662.1| PREDICTED: sugar transporter ERD6-like 8 [Tarenaya hassleriana]
Length=471

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +LK   +A +  P LA+ G++VYIGSFS+GMGAVPWVIMSEIFPIN+KG+AG   TLVNW
Sbjct  354  ILKAHGLALHLIPTLAMGGVLVYIGSFSMGMGAVPWVIMSEIFPINLKGIAGGLVTLVNW  413

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATI  190
              +W  S+TFN LM W+ +GTF +Y  + VLAI+F++K+VPETKG+TLE+IQ  +
Sbjct  414  LSSWFVSFTFNLLMLWSPYGTFYVYGVVCVLAIIFIVKLVPETKGKTLEEIQDMV  468



>ref|XP_010420663.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Camelina 
sativa]
Length=482

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG ++     P+LAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW 
Sbjct  365  LKGQSLLLEWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWS  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VPETKG+TLE+IQA I 
Sbjct  425  GAWAVSYTFNFLMSWSSPGTFYIYSAFAAMTIIFVAKMVPETKGKTLEEIQACIR  479



>ref|XP_008672347.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=453

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = -3

Query  495  VLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFL  316
            VLA+ G++V+IGSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G+W+ SY FNFL
Sbjct  342  VLALAGLLVFIGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSWLGSWIVSYAFNFL  401

Query  315  MAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTRRHK  160
            + W+S+GTF ++A I  L ++FV ++VPETKGRTLE+IQA++N+ S T  HK
Sbjct  402  LIWSSYGTFFIFAAICGLTVVFVHRLVPETKGRTLEEIQASMNS-SLTPFHK  452



>ref|XP_010420662.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Camelina 
sativa]
Length=483

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG ++     P+LAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW 
Sbjct  366  LKGQSLLLEWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWS  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VPETKG+TLE+IQA I 
Sbjct  426  GAWAVSYTFNFLMSWSSPGTFYIYSAFAAMTIIFVAKMVPETKGKTLEEIQACIR  480



>gb|KDO44993.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=396

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             A P LA+ G++VY GSFS+GMG +PWVIMSE+FPIN+KG AGS  TLV+W G+W+ S+T
Sbjct  287  KATPFLALVGVLVYTGSFSLGMGGIPWVIMSEVFPINMKGSAGSLVTLVSWLGSWIISFT  346

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FNFLM W+S GTF  ++ I  L +LFV K+VPETKGRTLE+IQA++N
Sbjct  347  FNFLMKWSSTGTFFAFSAICSLTVLFVAKLVPETKGRTLEEIQASMN  393



>ref|XP_003520821.1| PREDICTED: sugar transporter ERD6-like 5-like [Glycine max]
 gb|KHN04023.1| Sugar transporter ERD6-like 5 [Glycine soja]
Length=486

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+ L+     +P+LA+ G++VY GSFS+GMG +PWVIMSEIFPINVKG AGS  TLV+W 
Sbjct  366  LQDLHKWKEGSPILALAGVLVYTGSFSLGMGGIPWVIMSEIFPINVKGSAGSLVTLVSWL  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             +W+ SY FNFLM+W+S GTF ++++I    ILFV K+VPETKGRTLE++QA++N
Sbjct  426  CSWIVSYAFNFLMSWSSAGTFFIFSSICGFTILFVAKLVPETKGRTLEEVQASLN  480



>ref|XP_009352178.1| PREDICTED: sugar transporter ERD6-like 16 [Pyrus x bretschneideri]
Length=496

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 96/129 (74%), Gaps = 6/129 (5%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +  N  P++AV+G+++YI SFS+GMGAVPWVIMSE+FPI+VKG AGS   LVNW 
Sbjct  372  LKGNGLLLNWVPIIAVSGVLIYIASFSLGMGAVPWVIMSEVFPIHVKGAAGSLVVLVNWL  431

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            GAW  SYT+NFLM+W+S  T+ +YA  ++L I+ V K+VPETKG+TLE+IQA IN+    
Sbjct  432  GAWAVSYTYNFLMSWSSSRTYYIYAGFSLLTIICVAKLVPETKGKTLEEIQACINS----  487

Query  171  RRHKNSRQD  145
               K  + D
Sbjct  488  --DKGGQDD  494



>gb|KDO44992.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=474

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             A P LA+ G++VY GSFS+GMG +PWVIMSE+FPIN+KG AGS  TLV+W G+W+ S+T
Sbjct  365  KATPFLALVGVLVYTGSFSLGMGGIPWVIMSEVFPINMKGSAGSLVTLVSWLGSWIISFT  424

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FNFLM W+S GTF  ++ I  L +LFV K+VPETKGRTLE+IQA++N
Sbjct  425  FNFLMKWSSTGTFFAFSAICSLTVLFVAKLVPETKGRTLEEIQASMN  471



>ref|XP_009591842.1| PREDICTED: sugar transporter ERD6-like 8 [Nicotiana tomentosiformis]
Length=255

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  528  KGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFG  349
            K  ++A    P LA+ G++VYI  FS+GMGA PW+IMSE+FP++VKG+ G   TL+NWFG
Sbjct  141  KAHSVALTLVPNLAILGVLVYIAFFSIGMGAGPWLIMSEVFPLHVKGLGGGLVTLMNWFG  200

Query  348  AWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            +W+ SYTFNFLM W+S GTF LYA + +LA +F+ K++PETKGR LE+I A++N+
Sbjct  201  SWVISYTFNFLMLWSSHGTFFLYAFVCLLATIFIYKMIPETKGRRLEEIHASLNS  255



>ref|XP_006433198.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
 ref|XP_006471872.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR46438.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
Length=474

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
             A P LA+ G++VY GSFS+GMG +PWVIMSE+FPIN+KG AGS  TLV+W G+W+ S+T
Sbjct  365  KATPFLALVGVLVYTGSFSLGMGGIPWVIMSEVFPINMKGSAGSLVTLVSWLGSWIISFT  424

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            FNFLM W+S GTF  ++ I  L +LFV K+VPETKGRTLE+IQA++N
Sbjct  425  FNFLMKWSSTGTFFAFSAICSLTVLFVAKLVPETKGRTLEEIQASMN  471



>ref|XP_011087867.1| PREDICTED: sugar transporter ERD6-like 5 [Sesamum indicum]
 ref|XP_011087877.1| PREDICTED: sugar transporter ERD6-like 5 [Sesamum indicum]
Length=479

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
            +++P LA+ G++V+ GSFS+GMG +PWVIMSEIFPINVKG+AGS  T+VNWFG+W+ +Y+
Sbjct  367  DSSPSLALVGVLVFTGSFSLGMGGIPWVIMSEIFPINVKGLAGSLVTVVNWFGSWIITYS  426

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATI  190
            FNFL  W+S GTF ++AT+  L I+F I++VPETKGRTLE+IQA++
Sbjct  427  FNFLAQWSSAGTFFIFATVCGLTIIFTIRLVPETKGRTLEEIQASM  472



>gb|ACN26851.1| unknown [Zea mays]
 tpg|DAA53932.1| TPA: hypothetical protein ZEAMMB73_856317 [Zea mays]
Length=482

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = -3

Query  495  VLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFL  316
            VLA+ G++V+IGSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G+W+ SY FNFL
Sbjct  371  VLALAGLLVFIGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSWLGSWIVSYAFNFL  430

Query  315  MAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTRRHK  160
            + W+S+GTF ++A I  L ++FV ++VPETKGRTLE+IQA++N+ S T  HK
Sbjct  431  LIWSSYGTFFIFAAICGLTVVFVHRLVPETKGRTLEEIQASMNS-SLTPFHK  481



>ref|XP_008672346.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=483

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = -3

Query  495  VLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFL  316
            VLA+ G++V+IGSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G+W+ SY FNFL
Sbjct  372  VLALAGLLVFIGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVSWLGSWIVSYAFNFL  431

Query  315  MAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTRRHK  160
            + W+S+GTF ++A I  L ++FV ++VPETKGRTLE+IQA++N+ S T  HK
Sbjct  432  LIWSSYGTFFIFAAICGLTVVFVHRLVPETKGRTLEEIQASMNS-SLTPFHK  482



>ref|XP_009758159.1| PREDICTED: sugar transporter ERD6-like 8 [Nicotiana sylvestris]
Length=256

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -3

Query  528  KGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFG  349
            K  ++A    P LA+ G++VYI  FS+GMGA PW+IMSE+FP++VKG+ G   TL+NWFG
Sbjct  142  KAHSVAPTLVPNLAILGVLVYIAFFSIGMGAGPWLIMSEVFPLHVKGLGGGLVTLMNWFG  201

Query  348  AWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            +W+ SYTFNFLM W+S GTF LYA + +LA +F+ ++VPETKGR LE+I A++N+
Sbjct  202  SWVISYTFNFLMLWSSHGTFFLYAFVCLLAAIFIYQMVPETKGRRLEEIHASLNS  256



>ref|XP_002871845.1| hypothetical protein ARALYDRAFT_488771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48104.1| hypothetical protein ARALYDRAFT_488771 [Arabidopsis lyrata subsp. 
lyrata]
Length=483

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLKG ++     P LAV G+++Y+ +FS+GMG VPWVIMSEIFPIN+KG+AGS   LVNW
Sbjct  365  LLKGQSLLLEWVPTLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINIKGIAGSLVVLVNW  424

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             GAW  SYTFNFLM+W+S GTF +Y+      I+FV K+VPETKG+TLE+IQA I 
Sbjct  425  SGAWAISYTFNFLMSWSSPGTFYIYSAFAAATIIFVAKMVPETKGKTLEEIQACIR  480



>ref|XP_003626332.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|ABN08184.1| General substrate transporter [Medicago truncatula]
 gb|ABN09010.1| General substrate transporter [Medicago truncatula]
 gb|AES82550.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=502

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            L+ ++     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEIFPINVKG AGS  TLVNW 
Sbjct  382  LQDIHKWKEVSPILALVGVLVYVGSYSLGMGAIPWVIMSEIFPINVKGSAGSLVTLVNWL  441

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
             +W+ SY FNFLM W+S GTF  +A I    +LFV K+VPETKGRTLE+IQ ++N+ S  
Sbjct  442  CSWIISYAFNFLMTWSSTGTFFGFAAICGFTVLFVAKLVPETKGRTLEEIQVSLNSNSMK  501

Query  171  R  169
            +
Sbjct  502  K  502



>gb|KDP23561.1| hypothetical protein JCGZ_23394 [Jatropha curcas]
Length=485

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LL+ L+     +P LA+ G+++Y GSFS+GMG +PWVIMSE+FPIN+KG AGS  TLV+W
Sbjct  364  LLQDLHKWTAFSPFLALVGVLIYTGSFSLGMGGIPWVIMSEVFPINMKGPAGSLVTLVSW  423

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W+ SY FNFLM W+S GTF ++++I  L +LFV K+VPETKGRTLE+IQA++N
Sbjct  424  LGSWIISYAFNFLMDWSSTGTFFIFSSICGLTVLFVAKLVPETKGRTLEEIQASLN  479



>ref|XP_004164629.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 16-like 
[Cucumis sativus]
Length=441

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+L + G++ YI  FS+GMGAVPWVIMSEIFPI+VKG AGS   LVNW GAW  SYTFNF
Sbjct  328  PILTIFGVLTYIAFFSIGMGAVPWVIMSEIFPIHVKGAAGSLVVLVNWLGAWAVSYTFNF  387

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            LM+W+  GTF +Y+  ++L I+FV K+VPETKG+TLE+IQATIN
Sbjct  388  LMSWSPSGTFFVYSCFSLLTIVFVAKLVPETKGKTLEEIQATIN  431



>ref|XP_004157263.1| PREDICTED: sugar transporter ERD6-like 5-like [Cucumis sativus]
Length=479

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            L K L +  + +P++A+ G++VY GSFS+GMGA+PWVIMSEIFPIN+KG+AGS  TLV+W
Sbjct  358  LFKDLQLWQSGSPMMALAGVLVYSGSFSLGMGAIPWVIMSEIFPINMKGLAGSLVTLVSW  417

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W+ SY+FNFL+ W+S G F ++++I    +LFV K VPETKGRTLE+IQA +N
Sbjct  418  LGSWIVSYSFNFLLNWSSSGIFFIFSSICGFTVLFVAKFVPETKGRTLEEIQAAMN  473



>ref|XP_007147091.1| hypothetical protein PHAVU_006G095600g [Phaseolus vulgaris]
 gb|ESW19085.1| hypothetical protein PHAVU_006G095600g [Phaseolus vulgaris]
Length=500

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            +L+ L+     +P++A+ G++VY+GS+S+GMGA+PWVIMSEIFPINVKG AGS  TLV+W
Sbjct  378  ILQDLHQWKGVSPIMALVGVLVYVGSYSIGMGAIPWVIMSEIFPINVKGSAGSLVTLVSW  437

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +W+ SY FNFLM W+S GTF +++TI    +LFV K+VPETKGRTLE+IQA
Sbjct  438  LCSWIVSYAFNFLMNWSSAGTFFIFSTICGFTVLFVAKLVPETKGRTLEEIQA  490



>gb|KEH36721.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=396

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P LAV G+++YI +FS+G+G+VPWV+MSE+FPINVKG AGS   LV W GAW+ SYTFNF
Sbjct  292  PTLAVAGVLIYIAAFSIGLGSVPWVMMSEVFPINVKGTAGSLVVLVAWLGAWIVSYTFNF  351

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GT   YA  ++L ILFV KVVPETKG+TLE+IQA I++
Sbjct  352  LMSWSSPGTMFFYAGCSLLTILFVAKVVPETKGKTLEEIQACISS  396



>ref|XP_004135636.1| PREDICTED: sugar transporter ERD6-like 5-like [Cucumis sativus]
Length=479

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            L K L +  + +P++A+ G++VY GSFS+GMGA+PWVIMSEIFPIN+KG+AGS  TLV+W
Sbjct  358  LFKDLQLWQSGSPMMALAGVLVYSGSFSLGMGAIPWVIMSEIFPINMKGLAGSLVTLVSW  417

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W+ SY+FNFL+ W+S G F ++++I    +LFV K VPETKGRTLE+IQA +N
Sbjct  418  LGSWIVSYSFNFLLNWSSTGIFFIFSSICGFTVLFVAKFVPETKGRTLEEIQAAMN  473



>ref|XP_010546910.1| PREDICTED: sugar transporter ERD6-like 16 [Tarenaya hassleriana]
Length=494

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LKG  +     PVLAV G+++YI +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW 
Sbjct  375  LKGQGLLLEWVPVLAVGGVLIYIAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWS  434

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM+W+S  TF +Y+   ++ ILFV K+VPETKG+TLE+IQA + 
Sbjct  435  GAWAVSYTFNFLMSWSSPCTFYMYSAFALMTILFVGKMVPETKGKTLEEIQACLR  489



>ref|XP_004153836.1| PREDICTED: sugar transporter ERD6-like 16-like [Cucumis sativus]
Length=494

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+L + G++ YI  FS+GMGAVPWVIMSEIFPI+VKG AGS   LVNW GAW  SYTFNF
Sbjct  381  PILTIFGVLTYIAFFSIGMGAVPWVIMSEIFPIHVKGAAGSLVVLVNWLGAWAVSYTFNF  440

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            LM+W+  GTF +Y+  ++L I+FV K+VPETKG+TLE+IQATIN
Sbjct  441  LMSWSPSGTFFVYSCFSLLTIVFVAKLVPETKGKTLEEIQATIN  484



>gb|KGN66112.1| hypothetical protein Csa_1G571840 [Cucumis sativus]
Length=536

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            L K L +  + +P++A+ G++VY GSFS+GMGA+PWVIMSEIFPIN+KG+AGS  TLV+W
Sbjct  415  LFKDLQLWQSGSPMMALAGVLVYSGSFSLGMGAIPWVIMSEIFPINMKGLAGSLVTLVSW  474

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
             G+W+ SY+FNFL+ W+S G F ++++I    +LFV K VPETKGRTLE+IQA +N
Sbjct  475  LGSWIVSYSFNFLLNWSSTGIFFIFSSICGFTVLFVAKFVPETKGRTLEEIQAAMN  530



>ref|XP_004967879.1| PREDICTED: sugar transporter ERD6-like 5-like [Setaria italica]
Length=483

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = -3

Query  528  KGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFG  349
            K LNI      +LA+ GI+++ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G
Sbjct  368  KDLNI------LLALAGILIFTGSFSLGMGGIPWVIMSEIFPINMKGAAGSLVTLVSWLG  421

Query  348  AWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            +W+ SY FNFL+ WNS+GTF ++AT+  L ++FV ++VPETKGRTLE+IQA++N+
Sbjct  422  SWIISYAFNFLLVWNSYGTFFIFATVCGLTVVFVERLVPETKGRTLEEIQASMNS  476



>ref|XP_002457558.1| hypothetical protein SORBIDRAFT_03g009310 [Sorghum bicolor]
 gb|EES02678.1| hypothetical protein SORBIDRAFT_03g009310 [Sorghum bicolor]
Length=389

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  495  VLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFL  316
            VLA+ GI+++ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G+W+ SY FNFL
Sbjct  278  VLALAGILIFGGSFSLGMGGIPWVIMSEIFPINMKGAAGSLVTLVSWLGSWIVSYAFNFL  337

Query  315  MAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            + WNS+GTF ++A+I  L ++FV ++VPETKGRTLE+IQA++N+
Sbjct  338  LVWNSYGTFFIFASICGLTVVFVERLVPETKGRTLEEIQASMNS  381



>ref|XP_010242561.1| PREDICTED: sugar transporter ERD6-like 8 isoform X2 [Nelumbo 
nucifera]
Length=429

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -3

Query  477  IMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSF  298
            + VYIGSFSVGMGAVPWVIMSEIFPIN+KG+AGS  TLVNW G+WL SYTFNFL  W+++
Sbjct  332  LKVYIGSFSVGMGAVPWVIMSEIFPINLKGIAGSLVTLVNWLGSWLVSYTFNFLSVWSTY  391

Query  297  GTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            G F +Y+ I  + I F+ KVVPETKGRTLE+IQA++N+
Sbjct  392  GAFFVYSAICAIGIGFIFKVVPETKGRTLEEIQASMNS  429



>ref|XP_003547222.2| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=482

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+     P+LAV G+++YI +FS+G+G+VPWVIMSEIFP+++KG AGS   LV W 
Sbjct  365  LKDQNLLLEWVPILAVAGVLIYIAAFSIGLGSVPWVIMSEIFPLHLKGTAGSLVVLVAWL  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ SYTFNFLM+W+S GT  LYA  ++L ILFV K+VPETKG+TLE+IQA +++
Sbjct  425  GAWVVSYTFNFLMSWSSPGTLFLYAGCSLLTILFVAKLVPETKGKTLEEIQACLSS  480



>ref|XP_008366851.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 5 
[Malus domestica]
Length=493

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LA+ G++V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G+W+ SY FNF
Sbjct  385  PILALVGVLVFTGSFSLGMGGIPWVIMSEIFPINMKGSAGSLITLVSWLGSWIVSYXFNF  444

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            LM W+S GTF L+++++ + +LFV K+VPETKGRTLE+IQ ++N
Sbjct  445  LMDWSSAGTFFLFSSVSAVTVLFVAKLVPETKGRTLEEIQTSLN  488



>emb|CDY30026.1| BnaC01g39820D [Brassica napus]
Length=472

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  357  LLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNW  416

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +W  S TFNFLM W+  G F +Y  + VLAI+F+ K+VPETKG+TLE+IQA
Sbjct  417  LSSWFVSLTFNFLMIWSPHGAFYVYGGVCVLAIIFIAKLVPETKGKTLEEIQA  469



>ref|XP_009124970.1| PREDICTED: sugar transporter ERD6-like 8 [Brassica rapa]
 emb|CDY21102.1| BnaA01g33330D [Brassica napus]
Length=472

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -3

Query  534  LLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNW  355
            LLK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMSEIFPIN+KG AG   T+VNW
Sbjct  357  LLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNW  416

Query  354  FGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              +W  S TFNFLM W+  G F +Y  + VLAI+F+ K+VPETKG+TLE+IQA
Sbjct  417  LSSWFVSLTFNFLMIWSPHGAFYVYGGVCVLAIIFIAKLVPETKGKTLEEIQA  469



>ref|XP_006287631.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
 gb|EOA20529.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
Length=483

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  N+     P+LAV G+++Y+ +FS+GMG VPWVIMSEIFPINVKG+AGS   LVNW 
Sbjct  366  LKEQNLLLEWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSEIFPINVKGIAGSLVVLVNWS  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFNFLM W+S GTF +Y+    + I+FV K+VPETKG+TLE+IQA I 
Sbjct  426  GAWAVSYTFNFLMTWSSPGTFYIYSAFAAMTIIFVAKMVPETKGKTLEEIQACIR  480



>ref|XP_006845811.1| hypothetical protein AMTR_s00019p00256520, partial [Amborella 
trichopoda]
 gb|ERN07486.1| hypothetical protein AMTR_s00019p00256520, partial [Amborella 
trichopoda]
Length=360

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -3

Query  501  APVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFN  322
            AP+LA+TG++VYI +FS+GMGA+PWV+M+E+FP+NVKG AGS  +LV+WFG+W+ SY++N
Sbjct  243  APILALTGLLVYIAAFSLGMGAIPWVMMAEVFPLNVKGTAGSLVSLVHWFGSWIMSYSYN  302

Query  321  FLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRT  172
            F M+W+  GTF +++ +  + +LFV K+VPETKGRTLE+IQA++   S +
Sbjct  303  FFMSWSKAGTFFMFSGVCGVTVLFVAKLVPETKGRTLEEIQASMEHSSHS  352



>ref|XP_008795118.1| PREDICTED: sugar transporter ERD6-like 5 isoform X4 [Phoenix 
dactylifera]
Length=350

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  492  LAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLM  313
            LA+TGI+V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLVNW G+ + SYTFNFL+
Sbjct  242  LALTGILVFAGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVNWLGSGIVSYTFNFLI  301

Query  312  AWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTR  169
             W+S GTF ++A+I  L +LFV ++VPETKGRTLE+IQA++N+ S  +
Sbjct  302  TWSSAGTFFIFASICGLTVLFVERLVPETKGRTLEEIQASMNSFSSDK  349



>ref|XP_003594043.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES64294.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=485

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P LAV G+++YI +FS+G+G+VPWV+MSE+FPINVKG AGS   LV W GAW+ SYTFNF
Sbjct  381  PTLAVAGVLIYIAAFSIGLGSVPWVMMSEVFPINVKGTAGSLVVLVAWLGAWIVSYTFNF  440

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GT   YA  ++L ILFV KVVPETKG+TLE+IQA I++
Sbjct  441  LMSWSSPGTMFFYAGCSLLTILFVAKVVPETKGKTLEEIQACISS  485



>ref|XP_009373955.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 5 
[Pyrus x bretschneideri]
Length=512

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LA+ G++ + GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLVNW G+W+ SY FNF
Sbjct  403  PILALIGVLAFSGSFSLGMGGIPWVIMSEIFPINMKGSAGSLITLVNWLGSWIVSYAFNF  462

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            LM W+S GTF L+++++ + +LFV K+VPETKGRTLE+IQ ++N
Sbjct  463  LMDWSSAGTFFLFSSVSAVTVLFVAKLVPETKGRTLEEIQTSLN  506



>ref|XP_008795117.1| PREDICTED: sugar transporter ERD6-like 5 isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  492  LAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLM  313
            LA+TGI+V+ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLVNW G+ + SYTFNFL+
Sbjct  262  LALTGILVFAGSFSLGMGGIPWVIMSEIFPINMKGSAGSLVTLVNWLGSGIVSYTFNFLI  321

Query  312  AWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA*SRTR  169
             W+S GTF ++A+I  L +LFV ++VPETKGRTLE+IQA++N+ S  +
Sbjct  322  TWSSAGTFFIFASICGLTVLFVERLVPETKGRTLEEIQASMNSFSSDK  369



>gb|KHN33102.1| Sugar transporter ERD6-like 16 [Glycine soja]
Length=487

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LAV G+++YI +FS+G+G+VPWVIMSEIFP+++KG AGS   LV W GAW+ SYTFNF
Sbjct  381  PILAVAGVLIYIAAFSIGLGSVPWVIMSEIFPLHLKGTAGSLVVLVAWLGAWVVSYTFNF  440

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GT  LYA  ++L ILFV K+VPETKG+TLE+IQA +++
Sbjct  441  LMSWSSPGTLFLYAGCSLLTILFVAKLVPETKGKTLEEIQACLSS  485



>ref|XP_003580968.1| PREDICTED: sugar transporter ERD6-like 5 [Brachypodium distachyon]
Length=475

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = -3

Query  555  YINRRLVLLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGS  376
            ++++     K LN+      VLA+ GI+V+ GSFS+GMG +PWVIMSEIFPI++KG AGS
Sbjct  345  FLSKEYHWAKDLNV------VLALAGILVFTGSFSLGMGGIPWVIMSEIFPIHMKGSAGS  398

Query  375  FATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQA  196
              TLVNW G+W+ SY FNFL+ W+S+GTF ++A+I  L ++FV ++VPETKGRTLE+IQA
Sbjct  399  LVTLVNWLGSWIISYAFNFLLLWSSYGTFFMFASICGLTVVFVERLVPETKGRTLEEIQA  458

Query  195  TINA  184
            ++N+
Sbjct  459  SMNS  462



>ref|NP_001146190.1| uncharacterized protein LOC100279760 [Zea mays]
 gb|ACL53431.1| unknown [Zea mays]
Length=485

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  495  VLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFL  316
            VLA+ GI+++ GSFS+GMG +PWVIMSEIFPIN+KG AGS  TLV+W G+W+ SY FNFL
Sbjct  374  VLALAGILIFGGSFSLGMGGIPWVIMSEIFPINMKGAAGSLVTLVSWLGSWIVSYAFNFL  433

Query  315  MAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            + WNS+GTF ++A+I  L ++FV ++VPETKGRTLE+IQA++N+
Sbjct  434  LVWNSYGTFFIFASICGLTVVFVEQLVPETKGRTLEEIQASMNS  477



>gb|KHN37528.1| Sugar transporter ERD6-like 16 [Glycine soja]
Length=461

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  498  PVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNF  319
            P+LA  G+++YI +FS+G+G+VPWVIMSEIFPI++KG AGS   LV W GAW+ SYTFNF
Sbjct  357  PILAFAGVLIYIAAFSIGLGSVPWVIMSEIFPIHLKGTAGSLVVLVAWLGAWVVSYTFNF  416

Query  318  LMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            LM+W+S GT  LYA  ++L ILFV K+VPETKG+TLE+IQA I++
Sbjct  417  LMSWSSPGTLFLYAGCSLLTILFVAKLVPETKGKTLEEIQACISS  461



>gb|EEC80176.1| hypothetical protein OsI_22030 [Oryza sativa Indica Group]
Length=409

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -3

Query  477  IMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSF  298
            ++VYI S+S+GMGAVPWVIMSEIFPIN+KG+ GSF TLVNW G+W  S+ FNF M+W+S 
Sbjct  310  LLVYIASYSIGMGAVPWVIMSEIFPINIKGIGGSFVTLVNWSGSWAVSFAFNFFMSWSSS  369

Query  297  GTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GTF L+A +  +AILF++K+VPETKG+TLE+IQA++N+
Sbjct  370  GTFFLFALVCAVAILFIVKIVPETKGKTLEEIQASMNS  407



>gb|EYU27040.1| hypothetical protein MIMGU_mgv1a022081mg [Erythranthe guttata]
Length=306

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -3

Query  507  NAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYT  328
            + +P LA  G++++ GSFS+GMG +PWVIMSEIFPIN+KG+AGS  T+VNWFG W+ +Y+
Sbjct  194  DFSPSLAFGGVLIFSGSFSLGMGGIPWVIMSEIFPINIKGLAGSLVTVVNWFGTWIITYS  253

Query  327  FNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATI  190
            FNFL  W+S GTF+++A++  L ++F++K+VPETKGRTLE+IQA++
Sbjct  254  FNFLAQWSSAGTFLVFASVCGLTVIFIVKLVPETKGRTLEEIQASM  299



>ref|XP_010070278.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=463

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 18/115 (16%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEIFPIN+KGVAG FATLVNWF
Sbjct  365  LKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEIFPINIKGVAGGFATLVNWF  424

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  187
            GAW  SYTFN+LM+W+S+GTF+                  ETKGR+LEQIQA IN
Sbjct  425  GAWAVSYTFNYLMSWSSYGTFL------------------ETKGRSLEQIQAAIN  461



>ref|XP_003541649.1| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=481

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  531  LKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWF  352
            LK  ++     P+LA  G+++YI +FS+G+G+VPWVIMSEIFPI++KG AGS   LV W 
Sbjct  366  LKDQSLLPEWVPILAFAGVLIYIAAFSIGLGSVPWVIMSEIFPIHLKGTAGSLVVLVAWL  425

Query  351  GAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATINA  184
            GAW+ SYTFNFLM+W+S GT  LYA  ++L ILFV K+VPETKG+TLE+IQA I++
Sbjct  426  GAWVVSYTFNFLMSWSSPGTLFLYAGCSLLTILFVAKLVPETKGKTLEEIQACISS  481



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985