BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051E05

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    143   1e-36   Nicotiana tomentosiformis
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...    144   1e-36   Nicotiana sylvestris
gb|AAC25423.1|  calcium-dependent protein kinase                        143   2e-36   Nicotiana tabacum [American tobacco]
emb|CDP04396.1|  unnamed protein product                                142   3e-36   Coffea canephora [robusta coffee]
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      142   5e-36   Solanum tuberosum [potatoes]
ref|NP_001234806.1|  calcium-dependent protein kinase                   142   6e-36   Solanum lycopersicum
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...    138   2e-34   Nicotiana tomentosiformis
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 137   2e-34   Solanum tuberosum [potatoes]
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...    137   4e-34   Nicotiana sylvestris
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         134   5e-33   Ricinus communis
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    133   5e-33   Fragaria vesca subsp. vesca
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      133   9e-33   Prunus mume [ume]
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    132   1e-32   Sesamum indicum [beniseed]
gb|KDO62722.1|  hypothetical protein CISIN_1g0096581mg                  129   1e-32   Citrus sinensis [apfelsine]
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    132   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             130   5e-32   Prunus persica
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 130   5e-32   Morus notabilis
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      130   6e-32   
gb|KHN38276.1|  Calcium-dependent protein kinase 33                     129   8e-32   Glycine soja [wild soybean]
gb|KHN11921.1|  Calcium-dependent protein kinase 9                      129   9e-32   Glycine soja [wild soybean]
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...    130   1e-31   Solanum tuberosum [potatoes]
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    129   1e-31   Populus euphratica
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    129   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    129   2e-31   Sesamum indicum [beniseed]
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    129   2e-31   Populus euphratica
gb|AIO04122.1|  calcium-dependent protein kinase                        129   2e-31   Hevea brasiliensis [jebe]
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             129   2e-31   Citrus clementina [clementine]
ref|XP_008345823.1|  PREDICTED: calcium-dependent protein kinase ...    121   2e-31   
gb|AGG35970.1|  calcium-dependent protein kinase 21                     129   2e-31   Brassica napus [oilseed rape]
gb|AET00506.2|  calcium-dependent kinase                                129   2e-31   Medicago truncatula
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    128   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21     128   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             128   4e-31   Populus trichocarpa [western balsam poplar]
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    127   6e-31   Arabis alpina [alpine rockcress]
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...    127   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    127   7e-31   Glycine max [soybeans]
emb|CAN60225.1|  hypothetical protein VITISV_039919                     127   8e-31   Vitis vinifera
emb|CBI23246.3|  unnamed protein product                                127   1e-30   Vitis vinifera
gb|ACB71246.2|  calcium-dependent protein kinase 1                      127   1e-30   Hevea brasiliensis [jebe]
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     127   1e-30   Brassica rapa
ref|NP_192381.1|  calcium-dependent protein kinase 21                   127   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874811.1|  calcium-dependent protein kinase 21                127   1e-30   
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...    127   1e-30   Solanum lycopersicum
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2      127   1e-30   Vitis vinifera
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg             127   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             127   1e-30   Capsella rubella
ref|XP_008384073.1|  PREDICTED: calcium-dependent protein kinase ...    125   1e-30   
gb|AAK92828.1|  putative calcium dependent protein kinase               126   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ACY78680.1|  calcium-dependent protein kinase 1                      126   2e-30   Panax ginseng [Asiatic ginseng]
gb|AGG35967.1|  calcium-dependent protein kinase 15                     126   2e-30   Brassica napus [oilseed rape]
emb|CDX82886.1|  BnaC01g13360D                                          126   2e-30   
gb|KCW66998.1|  hypothetical protein EUGRSUZ_F007612                    120   3e-30   Eucalyptus grandis [rose gum]
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     125   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    125   4e-30   Camelina sativa [gold-of-pleasure]
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                125   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    125   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    125   5e-30   Cicer arietinum [garbanzo]
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15     125   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007212312.1|  hypothetical protein PRUPE_ppa006748mg             124   7e-30   
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...    125   7e-30   Camelina sativa [gold-of-pleasure]
tpg|DAA62901.2|  TPA: putative calcium-dependent protein kinase f...    118   9e-30   
ref|XP_006413708.1|  hypothetical protein EUTSA_v100267671mg            120   9e-30   
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                     124   1e-29   Vitis amurensis
gb|KFK28778.1|  hypothetical protein AALP_AA7G046400                    124   1e-29   Arabis alpina [alpine rockcress]
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg             124   1e-29   Capsella rubella
emb|CDX79112.1|  BnaA01g11790D                                          124   1e-29   
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15     124   1e-29   Brassica rapa
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    123   2e-29   Cucumis sativus [cucumbers]
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    123   2e-29   Cucumis melo [Oriental melon]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    125   2e-29   
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    124   2e-29   Prunus mume [ume]
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    124   2e-29   Cicer arietinum [garbanzo]
ref|XP_010093289.1|  Calcium-dependent protein kinase 15                123   2e-29   Morus notabilis
gb|KHN35744.1|  Calcium-dependent protein kinase 33                     122   2e-29   Glycine soja [wild soybean]
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            123   3e-29   Malus domestica [apple tree]
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    123   3e-29   Cucumis sativus [cucumbers]
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      123   3e-29   Cucumis melo [Oriental melon]
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    122   3e-29   Populus euphratica
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    122   4e-29   Glycine max [soybeans]
gb|KDP20751.1|  hypothetical protein JCGZ_21222                         123   4e-29   Jatropha curcas
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    122   4e-29   Pyrus x bretschneideri [bai li]
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      122   4e-29   
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    124   4e-29   
ref|NP_193925.1|  calcium-dependent protein kinase 15                   122   5e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ACR36994.1|  unknown                                                 116   5e-29   Zea mays [maize]
ref|NP_001190794.1|  calcium-dependent protein kinase 15                122   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    122   7e-29   Oryza brachyantha
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             122   7e-29   Citrus clementina [clementine]
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   122   8e-29   Citrus sinensis [apfelsine]
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    122   8e-29   Citrus sinensis [apfelsine]
ref|XP_003617547.1|  Calcium dependent protein kinase                   124   8e-29   
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...    122   1e-28   
gb|KDP39132.1|  hypothetical protein JCGZ_00889                         121   1e-28   Jatropha curcas
ref|XP_002869856.1|  calcium-dependent protein kinase 15                121   1e-28   Arabidopsis lyrata subsp. lyrata
dbj|BAE71239.1|  putative calcium dependent protein kinase              121   1e-28   Trifolium pratense [peavine clover]
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             121   1e-28   Phaseolus vulgaris [French bean]
emb|CDP05759.1|  unnamed protein product                                120   2e-28   Coffea canephora [robusta coffee]
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    121   2e-28   Pyrus x bretschneideri [bai li]
gb|EPS59225.1|  calcium-dependent protein kinase 1                      120   2e-28   Genlisea aurea
ref|XP_002869852.1|  hypothetical protein ARALYDRAFT_354567             120   2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_003610427.1|  Calcium-dependent protein kinase                   120   2e-28   
emb|CAA65500.1|  protein kinase                                         120   3e-28   Medicago sativa [alfalfa]
gb|ABE72958.1|  calcium dependent protein kinase 3                      120   3e-28   Medicago truncatula
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     120   3e-28   Eucalyptus grandis [rose gum]
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   120   3e-28   Medicago truncatula
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    120   4e-28   
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    120   4e-28   
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g             120   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    120   4e-28   Eucalyptus grandis [rose gum]
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    119   5e-28   Fragaria vesca subsp. vesca
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    119   6e-28   Sesamum indicum [beniseed]
gb|ACR34538.1|  unknown                                                 119   8e-28   Zea mays [maize]
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    119   9e-28   
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         119   9e-28   Ricinus communis
emb|CBI26637.3|  unnamed protein product                                117   1e-27   Vitis vinifera
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             118   1e-27   Phaseolus vulgaris [French bean]
gb|AHN49725.1|  calcium-dependent protein kinase 1                      118   1e-27   Hippeastrum hybrid cultivar
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    118   1e-27   
gb|KJB62816.1|  hypothetical protein B456_009G438300                    118   1e-27   Gossypium raimondii
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 118   1e-27   
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      118   1e-27   Gossypium arboreum [tree cotton]
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           118   2e-27   Cicer arietinum [garbanzo]
gb|EAZ40006.1|  hypothetical protein OsJ_24444                          117   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    118   2e-27   Glycine max [soybeans]
gb|ABB54456.1|  calcium-dependent protein kinase                        117   2e-27   Hordeum brevisubulatum
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    117   3e-27   Phoenix dactylifera
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    117   3e-27   Elaeis guineensis
ref|NP_001059775.1|  Os07g0515100                                       117   4e-27   
emb|CAA57157.1|  calcium-dependent protein kinase                       117   4e-27   Oryza sativa Japonica Group [Japonica rice]
gb|KJB69279.1|  hypothetical protein B456_011G014200                    117   4e-27   Gossypium raimondii
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    117   4e-27   Elaeis guineensis
ref|NP_001105306.1|  calcium-dependent protein kinase                   117   5e-27   Zea mays [maize]
ref|XP_002869854.1|  hypothetical protein ARALYDRAFT_914449             119   5e-27   
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       117   5e-27   
dbj|BAJ99143.1|  predicted protein                                      117   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABD98804.1|  calcium-dependent protein kinase                        117   6e-27   Triticum aestivum [Canadian hard winter wheat]
gb|ABC59619.1|  calcium-dependent protein kinase                        117   6e-27   Triticum aestivum [Canadian hard winter wheat]
gb|ABD98803.1|  calcium-dependent protein kinase                        116   6e-27   Triticum aestivum [Canadian hard winter wheat]
gb|ABC59620.1|  calcium-dependent protein kinase                        116   6e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      116   6e-27   Vitis vinifera
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    116   7e-27   
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      116   8e-27   Phoenix dactylifera
gb|AFR11230.1|  calcium dependent protein kinase 1                      116   8e-27   Chenopodium album [lamb's-quarters]
gb|KJB13679.1|  hypothetical protein B456_002G088800                    116   9e-27   Gossypium raimondii
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      116   9e-27   Gossypium arboreum [tree cotton]
dbj|BAA13440.1|  calcium dependent protein kinase                       115   1e-26   Ipomoea batatas [batate]
gb|ADM14342.1|  calcium-dependent protein kinase 19                     115   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     116   1e-26   Gossypium arboreum [tree cotton]
ref|XP_009414250.1|  PREDICTED: calcium-dependent protein kinase ...    114   1e-26   
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...    116   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...    115   1e-26   Elaeis guineensis
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                     115   3e-26   Vitis amurensis
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    114   3e-26   Nicotiana sylvestris
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    114   3e-26   Nicotiana tomentosiformis
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    114   4e-26   Arabis alpina [alpine rockcress]
gb|AAP03014.1|  seed calcium dependent protein kinase c                 114   5e-26   Glycine max [soybeans]
gb|AIU98504.1|  calcium-dependent protein kinase                        114   5e-26   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     114   5e-26   Tarenaya hassleriana [spider flower]
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    114   6e-26   
gb|ACJ61504.1|  calcium-dependent protein kinase                        114   8e-26   Glycine max [soybeans]
ref|XP_009414364.1|  PREDICTED: calcium-dependent protein kinase ...    110   9e-26   
gb|AGA83664.1|  calcium-dependent protein kinase 1                      113   1e-25   Dendrobium officinale
ref|NP_175485.1|  calcium-dependent protein kinase 33                   113   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891589.1|  calcium-dependent protein kinase 33                113   1e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2      113   1e-25   
ref|NP_001275322.1|  calcium-dependent protein kinase                   113   1e-25   Solanum tuberosum [potatoes]
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    113   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      112   2e-25   Nicotiana tomentosiformis
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 112   2e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    112   2e-25   Nicotiana sylvestris
gb|KHN02836.1|  Calcium-dependent protein kinase 9                      112   2e-25   Glycine soja [wild soybean]
gb|AAD28192.2|  calcium-dependent protein kinase                        112   2e-25   Solanum tuberosum [potatoes]
gb|KJB68586.1|  hypothetical protein B456_010G252400                    112   2e-25   Gossypium raimondii
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     112   2e-25   Camelina sativa [gold-of-pleasure]
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                112   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    112   3e-25   Solanum tuberosum [potatoes]
ref|XP_002874810.1|  hypothetical protein ARALYDRAFT_490109             111   3e-25   
gb|AAQ17506.1|  calcium dependent protein kinase 3                      112   3e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAD70165.1|  calcium-dependent protein kinase                       112   3e-25   Landoltia punctata
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             112   3e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             111   4e-25   Capsella rubella
ref|XP_002874812.1|  calcium-dependent protein kinase 23                111   5e-25   Arabidopsis lyrata subsp. lyrata
gb|AAD17800.1|  Ca2+-dependent protein kinase                           111   5e-25   Mesembryanthemum crystallinum
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             111   5e-25   
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             111   6e-25   Capsella rubella
gb|AFY10519.1|  calcium dependent protein kinase 1                      111   6e-25   Dendrobium officinale
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    111   7e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    110   7e-25   Arabis alpina [alpine rockcress]
ref|NP_177731.2|  calcium-dependent protein kinase 29                   108   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81727.1|  hypothetical protein B456_013G159300                    110   2e-24   Gossypium raimondii
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      109   2e-24   Gossypium arboreum [tree cotton]
ref|XP_010100127.1|  Calcium-dependent protein kinase 29                109   2e-24   Morus notabilis
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      109   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            108   3e-24   Phaseolus vulgaris [French bean]
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780          108   4e-24   Amborella trichopoda
gb|KFK30982.1|  hypothetical protein AALP_AA6G053400                    108   4e-24   Arabis alpina [alpine rockcress]
gb|AIU98507.1|  calcium-dependent protein kinase                        108   5e-24   Musa acuminata AAA Group [Cavendish banana]
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 108   5e-24   Solanum tuberosum [potatoes]
emb|CDX94570.1|  BnaC09g22660D                                          109   6e-24   
ref|XP_010536433.1|  PREDICTED: calcium-dependent protein kinase 29     108   6e-24   Tarenaya hassleriana [spider flower]
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    108   7e-24   Eucalyptus grandis [rose gum]
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      108   7e-24   Brassica rapa
emb|CDX82244.1|  BnaA03g35770D                                          108   7e-24   
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29     108   8e-24   Prunus mume [ume]
gb|AGG35978.1|  calcium-dependent protein kinase 9                      108   8e-24   Brassica napus [oilseed rape]
emb|CDY36037.1|  BnaC03g41610D                                          108   8e-24   Brassica napus [oilseed rape]
ref|XP_006287505.1|  hypothetical protein CARUB_v10000714mg             108   8e-24   
ref|NP_192383.1|  calcium-dependent protein kinase 23                   107   9e-24   
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...    107   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q8RWL2.2|CDPKT_ARATH  RecName: Full=Calcium-dependent protein ...    107   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391947.1|  hypothetical protein EUTSA_v10023804mg             107   1e-23   Eutrema salsugineum [saltwater cress]
ref|NP_974150.2|  calcium-dependent protein kinase 29                   107   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDP36877.1|  hypothetical protein JCGZ_08168                         107   1e-23   Jatropha curcas
ref|XP_007017899.1|  Calcium-dependent protein kinase 29                107   1e-23   
gb|AGJ83805.1|  calcium-dependent protein kinase 1a                     107   1e-23   Vitis amurensis
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg             107   2e-23   Prunus persica
gb|KJB63479.1|  hypothetical protein B456_010G001300                    107   2e-23   Gossypium raimondii
emb|CAN67210.1|  hypothetical protein VITISV_026712                     107   2e-23   Vitis vinifera
ref|XP_002284750.2|  PREDICTED: calcium-dependent protein kinase 29     107   2e-23   Vitis vinifera
ref|XP_010471751.1|  PREDICTED: calcium-dependent protein kinase ...    107   3e-23   
ref|XP_010428653.1|  PREDICTED: calcium-dependent protein kinase ...    107   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010428651.1|  PREDICTED: calcium-dependent protein kinase ...    106   3e-23   
ref|XP_010416511.1|  PREDICTED: calcium-dependent protein kinase ...    106   3e-23   Camelina sativa [gold-of-pleasure]
gb|AAD03455.1|  contains similarity to eukaryotic protein kinase ...    107   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    106   3e-23   Nelumbo nucifera [Indian lotus]
gb|AES59823.2|  calcium-dependent kinase                                106   3e-23   Medicago truncatula
ref|XP_004164365.1|  PREDICTED: calcium-dependent protein kinase ...    104   4e-23   
emb|CDP07348.1|  unnamed protein product                                106   4e-23   Coffea canephora [robusta coffee]
gb|AEY99979.1|  calcium-dependent protein kinase                        106   4e-23   Nicotiana tabacum [American tobacco]
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    106   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_007017897.1|  Calcium-dependent protein kinase 29                106   4e-23   
ref|XP_011083439.1|  PREDICTED: calcium-dependent protein kinase 29     105   5e-23   Sesamum indicum [beniseed]
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     105   5e-23   Phoenix dactylifera
ref|XP_004499307.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    106   8e-23   Cicer arietinum [garbanzo]
ref|XP_006302092.1|  hypothetical protein CARUB_v10020082mg             105   8e-23   Capsella rubella
ref|XP_006390245.1|  hypothetical protein EUTSA_v10018359mg             105   9e-23   Eutrema salsugineum [saltwater cress]
ref|XP_003589572.1|  Calcium-dependent protein kinase                   106   1e-22   
ref|XP_003545013.1|  PREDICTED: calcium-dependent protein kinase ...    105   1e-22   Glycine max [soybeans]
ref|XP_006596531.1|  PREDICTED: calcium-dependent protein kinase ...    105   1e-22   
ref|XP_006301218.1|  hypothetical protein CARUB_v10021616mg             105   1e-22   Capsella rubella
ref|XP_002888057.1|  predicted protein                                  105   1e-22   
ref|XP_003611046.1|  Calcium dependent protein kinase                   104   1e-22   Medicago truncatula
ref|NP_001053548.1|  Os04g0560600                                       104   2e-22   
gb|AGG35971.1|  calcium-dependent protein kinase 29                     104   2e-22   Brassica napus [oilseed rape]
gb|KFK42039.1|  hypothetical protein AALP_AA2G204000                    104   2e-22   Arabis alpina [alpine rockcress]
emb|CDX73219.1|  BnaC06g36670D                                          104   2e-22   
ref|XP_009106253.1|  PREDICTED: calcium-dependent protein kinase 29     104   2e-22   Brassica rapa
ref|XP_006396673.1|  hypothetical protein EUTSA_v10028617mg             103   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006342079.1|  PREDICTED: calcium-dependent protein kinase ...    104   2e-22   Solanum tuberosum [potatoes]
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29     103   2e-22   Solanum lycopersicum
gb|KHG01345.1|  Calcium-dependent protein kinase 29                     102   2e-22   Gossypium arboreum [tree cotton]
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...    103   2e-22   Citrus sinensis [apfelsine]
emb|CDY07254.1|  BnaC04g19170D                                          103   3e-22   
ref|XP_010061106.1|  PREDICTED: calcium-dependent protein kinase ...    103   3e-22   Eucalyptus grandis [rose gum]
ref|XP_006435253.1|  hypothetical protein CICLE_v10000897mg             103   3e-22   Citrus clementina [clementine]
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...    103   3e-22   Citrus sinensis [apfelsine]
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                    103   4e-22   Arabis alpina [alpine rockcress]
ref|XP_008387908.1|  PREDICTED: calcium-dependent protein kinase 29     103   5e-22   Malus domestica [apple tree]
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       103   5e-22   Cucumis sativus [cucumbers]
ref|NP_176386.2|  calcium-dependent protein kinase 19                   103   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g             104   6e-22   Phaseolus vulgaris [French bean]
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g             103   6e-22   Populus trichocarpa [western balsam poplar]
gb|AAC28510.1|  Similar to gb|AF072908 calcium-dependent protein ...    103   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...    103   6e-22   
sp|Q9ZSA3.2|CDPKM_ARATH  RecName: Full=Calcium-dependent protein ...    102   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192380.1|  calcium-dependent protein kinase 22                   102   8e-22   
ref|XP_009798869.1|  PREDICTED: calcium-dependent protein kinase 29     102   8e-22   Nicotiana sylvestris
ref|XP_009114553.1|  PREDICTED: calcium-dependent protein kinase 22     102   9e-22   Brassica rapa
ref|XP_003610425.1|  Calcium-dependent protein kinase                   102   9e-22   Medicago truncatula
ref|XP_009620047.1|  PREDICTED: calcium-dependent protein kinase 29     102   9e-22   Nicotiana tomentosiformis
gb|AGF69185.1|  calcium-dependent protein kinase 3-like 1             99.0    1e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006653668.1|  PREDICTED: calcium-dependent protein kinase ...    101   1e-21   
gb|KCW45109.1|  hypothetical protein EUGRSUZ_L012821                  99.8    1e-21   Eucalyptus grandis [rose gum]
ref|XP_010240253.1|  PREDICTED: calcium-dependent protein kinase ...    102   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29     102   2e-21   Populus euphratica
emb|CAC83060.1|  calcium dependent calmodulin independent protein...    100   2e-21   Cucumis sativus [cucumbers]
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    101   2e-21   
gb|AEY99978.1|  calcium-dependent protein kinase                        101   2e-21   
ref|XP_002510594.1|  calcium-dependent protein kinase, putative         101   2e-21   
gb|KCW68006.1|  hypothetical protein EUGRSUZ_F01695                     100   2e-21   
ref|XP_010533815.1|  PREDICTED: calcium-dependent protein kinase 19     101   2e-21   
ref|XP_010061107.1|  PREDICTED: calcium-dependent protein kinase ...    101   2e-21   
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    101   2e-21   
gb|KDO37230.1|  hypothetical protein CISIN_1g047606mg                   100   2e-21   
ref|XP_009113383.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    101   2e-21   
emb|CDY24863.1|  BnaA03g59670D                                          101   3e-21   
gb|AAD48958.1|AF149414_7  similar to Pfam families PF00069 (Eukar...    100   3e-21   
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             100   3e-21   
ref|XP_011003084.1|  PREDICTED: calcium-dependent protein kinase ...    100   3e-21   
ref|XP_010430219.1|  PREDICTED: calcium-dependent protein kinase 19     100   3e-21   
gb|KHN35055.1|  Calcium-dependent protein kinase 3                    99.4    3e-21   
gb|EEC79771.1|  hypothetical protein OsI_21169                        99.4    4e-21   
ref|XP_006452356.1|  hypothetical protein CICLE_v10010666mg             100   4e-21   
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     100   4e-21   
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            100   4e-21   
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     100   4e-21   
gb|KHN25667.1|  Calcium-dependent protein kinase 3                    99.0    4e-21   
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    100   4e-21   
gb|KHN48531.1|  Calcium-dependent protein kinase 29                   99.0    5e-21   
ref|NP_680596.2|  calcium-dependent protein kinase 31                 99.8    5e-21   
emb|CDP12100.1|  unnamed protein product                              98.6    6e-21   
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   100   6e-21   
ref|XP_002306955.1|  hypothetical protein POPTR_0005s26640g           99.8    7e-21   
ref|XP_011003085.1|  PREDICTED: calcium-dependent protein kinase ...  99.8    8e-21   
gb|EMS46165.1|  Calcium-dependent protein kinase 3                    98.2    8e-21   
gb|EMT20115.1|  Calcium-dependent protein kinase 3                    97.8    8e-21   
ref|XP_010418170.1|  PREDICTED: calcium-dependent protein kinase ...  99.8    9e-21   
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3    99.4    1e-20   
ref|XP_004976490.1|  PREDICTED: calcium-dependent protein kinase ...  99.4    1e-20   
gb|KHN16773.1|  Calcium-dependent protein kinase 3                    96.7    1e-20   
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...  99.4    1e-20   
ref|XP_006475079.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    1e-20   
ref|XP_002448323.1|  hypothetical protein SORBIDRAFT_06g025220        99.4    1e-20   
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    1e-20   
gb|EEE64852.1|  hypothetical protein OsJ_19709                        99.4    1e-20   
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...  99.0    1e-20   
ref|NP_001151970.1|  calcium-dependent protein kinase                 99.0    1e-20   
dbj|BAD61167.1|  putative calcium-dependent protein kinase            99.8    1e-20   
gb|AFW59214.1|  putative calcium-dependent protein kinase family ...  99.0    2e-20   
ref|XP_003569386.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    2e-20   
dbj|BAA81749.1|  calcium-dependent protein kinase                     99.0    2e-20   
ref|NP_001056455.1|  Os05g0585500                                     99.0    2e-20   
gb|KHG03431.1|  Calcium-dependent protein kinase 3                    99.4    2e-20   
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...  99.0    2e-20   
ref|XP_010040549.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    2e-20   
gb|KJB58044.1|  hypothetical protein B456_009G191500                  99.8    2e-20   
gb|KJB52214.1|  hypothetical protein B456_008G251000                  97.1    2e-20   
dbj|BAA81748.1|  calcium-dependent protein kinase                     98.6    2e-20   
ref|XP_006475082.1|  PREDICTED: calcium-dependent protein kinase ...  98.2    2e-20   
ref|XP_002298000.1|  calcium-dependent protein kinase 1               98.2    2e-20   
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1     98.6    2e-20   
gb|EMT22025.1|  Calcium-dependent protein kinase 3                    97.8    2e-20   
gb|EYU17566.1|  hypothetical protein MIMGU_mgv1a004597mg              98.2    2e-20   
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3    98.2    3e-20   
ref|XP_006413705.1|  hypothetical protein EUTSA_v10027200mg           96.3    3e-20   
tpg|DAA58513.1|  TPA: putative calcium-dependent protein kinase f...  95.9    3e-20   
gb|KDO62708.1|  hypothetical protein CISIN_1g018604mg                 96.3    3e-20   
dbj|BAJ94561.1|  predicted protein                                    97.8    3e-20   
emb|CAF18446.1|  putative calcium-dependent protein kinase            97.8    3e-20   
ref|XP_006475081.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    3e-20   
dbj|BAJ95679.1|  predicted protein                                    97.8    4e-20   
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...  97.8    4e-20   
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34   97.8    4e-20   
dbj|BAJ96684.1|  predicted protein                                    97.8    4e-20   
ref|XP_002874809.1|  calcium-dependent protein kinase 31              97.1    5e-20   
ref|XP_008239005.1|  PREDICTED: calcium-dependent protein kinase 3    95.9    6e-20   
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    8e-20   
gb|KHG11508.1|  Calcium-dependent protein kinase 3                    97.1    8e-20   
gb|KJB52213.1|  hypothetical protein B456_008G251000                  97.1    8e-20   
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                 96.7    9e-20   
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...  96.7    9e-20   
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg           96.7    9e-20   
emb|CBI34415.3|  unnamed protein product                              95.1    1e-19   
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2      96.7    1e-19   
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3    96.7    1e-19   
gb|KDP25359.1|  hypothetical protein JCGZ_20515                       96.3    1e-19   
ref|XP_004969206.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    1e-19   
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g           96.3    1e-19   
ref|XP_009334623.1|  PREDICTED: calcium-dependent protein kinase 29   96.7    1e-19   
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    1e-19   
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...  96.3    1e-19   
gb|KJB19075.1|  hypothetical protein B456_003G084000                  95.9    2e-19   
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3    95.9    2e-19   
ref|XP_010106587.1|  Calcium-dependent protein kinase 3               96.3    2e-19   
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg           95.9    2e-19   
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950        95.9    2e-19   
ref|XP_006452359.1|  hypothetical protein CICLE_v10007873mg           95.9    2e-19   
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3    95.9    2e-19   
ref|XP_001781985.1|  predicted protein                                95.5    2e-19   
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                95.5    2e-19   
ref|XP_006452350.1|  hypothetical protein CICLE_v10007950mg           95.9    2e-19   
ref|XP_002509886.1|  calcium-dependent protein kinase, putative       95.9    2e-19   
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...  95.9    2e-19   
emb|CAN61364.1|  hypothetical protein VITISV_032639                   95.5    2e-19   
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg           95.5    2e-19   
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...  95.1    2e-19   
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3    95.5    2e-19   
gb|EEC71113.1|  hypothetical protein OsI_02910                        95.5    2e-19   
gb|KDP43197.1|  hypothetical protein JCGZ_22749                       95.5    2e-19   
gb|EAZ12734.1|  hypothetical protein OsJ_02652                        95.5    2e-19   
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    3e-19   
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    3e-19   
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    3e-19   
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...  95.5    3e-19   
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    3e-19   
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...  95.1    3e-19   
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340        95.1    3e-19   
ref|XP_010455760.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    3e-19   
gb|AGS15000.1|  calcium-dependent protein kinase 3                    95.1    4e-19   
ref|XP_006845045.1|  hypothetical protein AMTR_s00269p00011940        95.1    4e-19   
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3    95.1    4e-19   
gb|ABV22565.1|  calcium-dependent protein kinase                      95.1    4e-19   
gb|ABY59014.1|  calcium-dependent protein kinase                      95.1    4e-19   
gb|EMT13147.1|  hypothetical protein F775_52284                       95.1    4e-19   
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg           95.1    4e-19   
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                  95.1    4e-19   
ref|NP_001169721.1|  uncharacterized LOC100383602                     94.7    4e-19   
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34   94.7    4e-19   
gb|ABY59010.1|  calcium-dependent protein kinase                      94.7    4e-19   
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    4e-19   
emb|CDY13993.1|  BnaC09g38330D                                        94.7    5e-19   
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    5e-19   
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g           94.4    5e-19   
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    5e-19   
gb|AGG35954.1|  calcium-dependent protein kinase 34                   94.4    5e-19   
gb|EPS60659.1|  calcium-dependent protein kinase 17                   89.0    5e-19   
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...  94.7    5e-19   
ref|NP_197437.1|  calcium-dependent protein kinase 34                 94.4    5e-19   
emb|CDY10955.1|  BnaA03g46140D                                        92.8    6e-19   
emb|CDY44912.1|  BnaA02g04170D                                        94.4    6e-19   
ref|XP_011090473.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-19   
ref|XP_009137376.1|  PREDICTED: calcium-dependent protein kinase 3    92.8    6e-19   
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-19   
emb|CDX78468.1|  BnaA03g03800D                                        94.4    6e-19   
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-19   
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3    94.4    6e-19   
ref|XP_010106395.1|  Calcium-dependent protein kinase 17              94.4    6e-19   
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34   94.4    6e-19   
ref|XP_010266343.1|  PREDICTED: uncharacterized protein LOC104603873  95.5    6e-19   
ref|XP_010099802.1|  Calcium-dependent protein kinase 17              94.4    6e-19   
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34   94.4    6e-19   
gb|AHG06449.1|  calcium-dependent protein kinase 17                   94.4    6e-19   
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-19   
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-19   
emb|CDY63783.1|  BnaCnng42690D                                        94.4    6e-19   
gb|KJB09335.1|  hypothetical protein B456_001G135000                  94.4    6e-19   
gb|KJB35709.1|  hypothetical protein B456_006G124800                  94.4    6e-19   
gb|KJB21813.1|  hypothetical protein B456_004G015100                  94.4    6e-19   
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    6e-19   
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg           94.4    7e-19   
ref|XP_002873943.1|  calcium-dependent protein kinase 34              94.4    7e-19   
gb|KDO62709.1|  hypothetical protein CISIN_1g010756mg                 94.0    7e-19   
ref|XP_006452360.1|  hypothetical protein CICLE_v10010555mg           94.0    7e-19   
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...  94.4    7e-19   
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg           94.0    8e-19   
ref|XP_006644382.1|  PREDICTED: calcium-dependent protein kinase ...  93.6    8e-19   
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    8e-19   
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...  94.0    8e-19   
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase            94.0    9e-19   
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg              94.0    9e-19   
emb|CDX70450.1|  BnaC03g05340D                                        93.6    1e-18   
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                  93.6    1e-18   
emb|CDX97174.1|  BnaC09g44510D                                        93.6    1e-18   
gb|AAL59948.1|  putative calcium-dependent protein kinase             93.6    1e-18   
ref|NP_196779.1|  calcium-dependent protein kinase 17                 93.6    1e-18   
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg           93.6    1e-18   
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3    93.6    1e-18   
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17   93.6    1e-18   
ref|XP_002979552.1|  calcium dependent protein kinase 17              94.0    1e-18   
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...  93.6    1e-18   
ref|XP_002871516.1|  calcium-dependent protein kinase 17              93.6    1e-18   
gb|KJB83565.1|  hypothetical protein B456_013G253100                  93.6    1e-18   
ref|XP_002977722.1|  calcium dependent protein kinase 17              94.0    1e-18   
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...  93.6    1e-18   
emb|CDX91168.1|  BnaC02g04290D                                        93.6    1e-18   
gb|ABC47163.2|  CDPK1                                                 93.6    1e-18   
ref|XP_002526062.1|  calcium-dependent protein kinase, putative       93.6    1e-18   
ref|XP_010422291.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    1e-18   
ref|XP_010432452.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    1e-18   
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-18   
ref|XP_002313265.1|  calcium-dependent protein kinase                 93.2    2e-18   
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg           93.2    2e-18   
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    2e-18   
ref|XP_007015253.1|  Calcium-dependent protein kinase 17              93.2    2e-18   
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17   93.2    2e-18   
emb|CDY16652.1|  BnaA09g20300D                                        92.4    2e-18   
gb|ACA63885.1|  calcium-dependent protein kinase                      92.8    2e-18   
gb|KDO40822.1|  hypothetical protein CISIN_1g048406mg                 87.4    2e-18   
ref|XP_009350446.1|  PREDICTED: calcium-dependent protein kinase ...  91.3    2e-18   
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    2e-18   
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    2e-18   
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    2e-18   
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...  92.8    3e-18   
gb|EMT23982.1|  Calcium-dependent protein kinase 17                   92.8    3e-18   
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    3e-18   
emb|CDY44125.1|  BnaA01g13330D                                        92.4    3e-18   
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17   92.4    3e-18   
gb|AGG35973.1|  calcium-dependent protein kinase 3                    92.4    3e-18   
ref|XP_009137374.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    3e-18   
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    3e-18   
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...  92.4    3e-18   
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-18   
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3    92.0    4e-18   
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                 92.0    4e-18   
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-18   
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-18   
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                  92.0    4e-18   
emb|CDX85697.1|  BnaA02g01160D                                        92.0    4e-18   
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-18   
ref|NP_192379.2|  calcium-dependent protein kinase 27                 91.7    4e-18   
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3    92.0    4e-18   
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...  92.0    4e-18   
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg           92.0    4e-18   
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...  92.4    5e-18   
gb|AHN16201.1|  CPK3-2.1                                              92.0    5e-18   
emb|CDY62741.1|  BnaC07g50270D                                        92.4    5e-18   
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg           92.0    5e-18   



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD DHSGFITRDEL+SAM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  459  ERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEE  518

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ KLF
Sbjct  519  FCAMMRSGTQPQPKLF  534



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD DHSGFITRDEL+SAM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  467  ERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEE  526

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ KLF
Sbjct  527  FCAMMRSGTQPQPKLF  542



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD DHSGFITRDEL+SAM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  465  ERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEE  524

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ KLF
Sbjct  525  FCAMMRSGTQPQPKLF  540



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD DHSGFITRDEL+SAMMEYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  474  ERDEHLYKAFQHFDTDHSGFITRDELESAMMEYGMGDEATIKEIISEVDTDNDGRINYEE  533

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGT  Q KLF
Sbjct  534  FCAMMRSGTAAQGKLF  549



>gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=554

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD DHSGFITRDEL++AM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  478  ERDEHLFKAFQHFDKDHSGFITRDELENAMKEYGMGDEATIKEIITEVDTDNDGRINYEE  537

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQQKLF
Sbjct  538  FCAMMRSGTTQPQQKLF  554



>ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum]
 emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum]
Length=553

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD DHSGFITRDEL++AM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  477  ERDEHLFKAFQHFDKDHSGFITRDELENAMKEYGMGDEATIKEIIAEVDTDNDGRINYEE  536

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQQKLF
Sbjct  537  FCAMMRSGTTQPQQKLF  553



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQ+FD DHSGFIT+DEL+SAM EYGMGDEATIKDII EVDTD+DGRINY E
Sbjct  464  ERDDHLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEATIKDIIAEVDTDHDGRINYEE  523

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ+K F
Sbjct  524  FCAMMRSGTQPQEKKF  539



>ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
 gb|AAQ08324.2| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=558

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD DHSGFITRDEL++AM EYGMGDE TIK+II EVDTDNDGRINY E
Sbjct  482  ERDEHLFKAFQNFDKDHSGFITRDELENAMKEYGMGDETTIKEIIAEVDTDNDGRINYEE  541

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQQKLF
Sbjct  542  FCAMMRSGTTQPQQKLF  558



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQ FD DHSGFIT+DEL+SAM EYGMGDEATIK+II EVDTD+DGRINY E
Sbjct  476  ERDDHLFKAFQFFDTDHSGFITKDELESAMKEYGMGDEATIKEIIAEVDTDHDGRINYEE  535

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ+K+F
Sbjct  536  FCAMMRSGTQPQEKIF  551



>ref|XP_002518484.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=551

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D SG+ITRDEL+SAM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  476  ERDEHLYKAFQHFDKDSSGYITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEE  535

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q  +KLF
Sbjct  536  FCAMMRSGIQQAEKLF  551



>ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+ AM EYGMGDEATI+DII EVDTDNDGRINY E
Sbjct  466  ERDEHLYKAFQYFDTDNSGFITRDELEKAMKEYGMGDEATIRDIISEVDTDNDGRINYEE  525

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQ Q KLF
Sbjct  526  FCTMMRSGTQQQGKLF  541



>ref|XP_008226901.1| PREDICTED: calcium-dependent protein kinase 2 [Prunus mume]
Length=545

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SAM EYGMGD+ATI++II EVDTDNDGRINY E
Sbjct  470  ERDEHLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIREIISEVDTDNDGRINYEE  529

Query  412  FCAMMRSGTQPQQKLF  365
            F  MMRSGTQPQ KLF
Sbjct  530  FSTMMRSGTQPQPKLF  545



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ FD D SG+ITRDEL++AM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  466  ERDEHLFKAFQFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYEE  525

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ Q KLF
Sbjct  526  FCAMMRSGTQQQVKLF  541



>gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
 gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
Length=293

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQHFD D+SGFIT DEL+ AM +YGMGD+ TIK+II EVDTDNDGRINY E
Sbjct  218  ERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDE  277

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ KLF
Sbjct  278  FCAMMRSGTQPQAKLF  293



>ref|XP_009360996.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=544

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SAM EYGMGDEATI++II EVDTDNDGRINY E
Sbjct  469  ERDEHLYKAFQYFDKDNSGFITRDELESAMKEYGMGDEATIREIISEVDTDNDGRINYEE  528

Query  412  FCAMMRSGTQPQQKLF  365
            F  MMRSG QPQ KLF
Sbjct  529  FSTMMRSGMQPQAKLF  544



>ref|XP_007213894.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
 gb|EMJ15093.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
Length=545

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SAM EYGMGD+ TI++II EVDTDNDGRINY E
Sbjct  470  ERDEHLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDQTIREIISEVDTDNDGRINYEE  529

Query  412  FCAMMRSGTQPQQKLF  365
            F  MMRSGTQPQ KLF
Sbjct  530  FSTMMRSGTQPQAKLF  545



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+EHL KAFQ FD D SGFITRDEL++AM +YGMGDEATI++II EVDTDNDGRINYSE
Sbjct  473  EREEHLFKAFQFFDKDSSGFITRDELETAMKDYGMGDEATIREIISEVDTDNDGRINYSE  532

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ Q KLF
Sbjct  533  FCAMMRSGTQHQGKLF  548



>ref|XP_008365060.1| PREDICTED: calcium-dependent protein kinase 2 [Malus domestica]
Length=544

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SAM EYGMGDEATI++II EVDTDNDGRINY E
Sbjct  469  ERDEHLYKAFQYFDKDNSGFITRDELESAMKEYGMGDEATIREIISEVDTDNDGRINYEE  528

Query  412  FCAMMRSGTQPQQKLF  365
            F  MM+SG QPQ KLF
Sbjct  529  FSTMMKSGMQPQAKLF  544



>gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=391

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM EYGMGDEATI++II EVDTDNDGRINY E
Sbjct  316  ERDEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGDEATIREIISEVDTDNDGRINYDE  375

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQ Q KLF
Sbjct  376  FCTMMRSGTQQQGKLF  391



>gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=404

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+ AM EYGMGDEATI++II EVDTDNDGRINY E
Sbjct  329  ERDEHLYKAFQYFDKDGSGYITRDELEIAMKEYGMGDEATIREIISEVDTDNDGRINYEE  388

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQ Q KLF
Sbjct  389  FCTMMRSGTQQQGKLF  404



>ref|XP_006350481.1| PREDICTED: calcium-dependent protein kinase-like [Solanum tuberosum]
Length=545

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+ L KAFQ+FD DHSGFIT+DEL+SAM EYGMGDE TI++II EVDTD+DGRINY E
Sbjct  470  ERDDDLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEDTIREIIVEVDTDHDGRINYEE  529

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ KLF
Sbjct  530  FCAMMRSGTQPQDKLF  545



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+SAM EYGMGDEATIK+II EVD DNDGRINY E
Sbjct  458  ERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYEE  517

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ   KLF
Sbjct  518  FCAMMRSGTQHAGKLF  533



>ref|XP_010278695.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=539

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D SGFITRDEL++AM EYGMGDEA+I++II EVDTDNDGRINY E
Sbjct  464  ERDEHLYKAFQHFDKDQSGFITRDELETAMKEYGMGDEASIREIISEVDTDNDGRINYEE  523

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG Q   KLF
Sbjct  524  FCTMMRSGLQQHAKLF  539



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL  AFQ+FD D SG+ITRDEL++AM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  468  ERDEHLYSAFQYFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYDE  527

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ   KLF
Sbjct  528  FCAMMRSGTQQPVKLF  543



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+SAM EYGMGDEATIK+II EVD DNDGRINY E
Sbjct  469  ERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYEE  528

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ   KLF
Sbjct  529  FCAMMRSGTQHAGKLF  544



>gb|AIO04122.1| calcium-dependent protein kinase [Hevea brasiliensis]
Length=556

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+SAMMEYGMGDEA+IK+II EVDTDNDG+INY E
Sbjct  481  ERDEHLYKAFQYFDKDSSGYITRDELESAMMEYGMGDEASIKEIISEVDTDNDGKINYEE  540

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG Q   KLF
Sbjct  541  FCTMMRSGVQQPGKLF  556



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQHFD D+SGFIT DEL+ AM +YGMGD+ TIK+II EVDTDNDGRINY E
Sbjct  454  ERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDE  513

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ KLF
Sbjct  514  FCAMMRSGTQPQAKLF  529



>ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase 2-like [Malus domestica]
Length=103

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM E+GMGD+ TI++II EVD DNDGRINYSE
Sbjct  28   ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSE  87

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q   KLF
Sbjct  88   FCAMMRSGAQQPAKLF  103



>gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus]
Length=525

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ E
Sbjct  446  DRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEE  505

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KLF
Sbjct  506  FCAMMRSGTTQPQGKLF  522



>gb|AET00506.2| calcium-dependent kinase [Medicago truncatula]
Length=540

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++AM EYGMGDE TI++II EVDTDNDGRINY E
Sbjct  465  ERDEHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYEE  524

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG Q Q KLF
Sbjct  525  FCTMMRSGVQQQGKLF  540



>ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=538

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD DHSGFITRDEL++AM EYGMGDEA+IK+II EVDTDNDGRINY E
Sbjct  463  ERDEHLYKAFQYFDKDHSGFITRDELETAMKEYGMGDEASIKEIISEVDTDNDGRINYEE  522

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG Q   KL 
Sbjct  523  FCTMMRSGMQQPVKLI  538



>ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase 21 [Tarenaya hassleriana]
Length=544

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAF+HFD D SG+ITRDEL++AM EYGMGDE +I+++I EVDTDNDGRINY E
Sbjct  465  ERDEHLYKAFKHFDKDSSGYITRDELETAMKEYGMGDEDSIREVIAEVDTDNDGRINYQE  524

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KLF
Sbjct  525  FCAMMRSGTTQPQGKLF  541



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+SAM EYGMGDEATIK+II EVD DNDG+INY E
Sbjct  457  ERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGKINYEE  516

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ   KLF
Sbjct  517  FCAMMRSGTQHAGKLF  532



>gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina]
Length=538

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ E
Sbjct  459  DRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEE  518

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KL 
Sbjct  519  FCAMMRSGSTQPQNKLL  535



>ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya 
hassleriana]
Length=545

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQ+FD D+SG+ITRDEL++AM EYGMGDEA+I+++I EVDTDNDGRINY E
Sbjct  466  ERDDHLYKAFQYFDKDNSGYITRDELETAMKEYGMGDEASIREVIAEVDTDNDGRINYEE  525

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQP+ KLF
Sbjct  526  FCAMMRSGSTQPEGKLF  542



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM EYGMG+EATI++II EVDTDNDGRINY E
Sbjct  453  ERDEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGNEATIREIISEVDTDNDGRINYDE  512

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQ Q KLF
Sbjct  513  FCTMMRSGTQQQGKLF  528



>emb|CAN60225.1| hypothetical protein VITISV_039919 [Vitis vinifera]
Length=467

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAF +FD D+SGFITRDEL++AM EYGMGDE +IK+II+EVDTD DGRINY E
Sbjct  392  ERDEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKE  451

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQP  KLF
Sbjct  452  FCTMMRSGTQPPVKLF  467



>emb|CBI23246.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAF +FD D+SGFITRDEL++AM EYGMGDE +IK+II+EVDTD DGRINY E
Sbjct  439  ERDEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKE  498

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQP  KLF
Sbjct  499  FCTMMRSGTQPPVKLF  514



>gb|ACB71246.2| calcium-dependent protein kinase 1 [Hevea brasiliensis]
Length=556

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+SAMMEYGMGDEA+IK+II EVDTDNDG+INY E
Sbjct  481  ERDEHLYKAFQYFDKDSSGYITRDELESAMMEYGMGDEASIKEIISEVDTDNDGKINYEE  540

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMR G Q   KLF
Sbjct  541  FCTMMRRGVQQPGKLF  556



>ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica rapa]
 emb|CDX97315.1| BnaA02g21060D [Brassica napus]
Length=520

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ EF
Sbjct  442  RDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEF  501

Query  409  CAMMRSG-TQPQQKLF  365
            CAMMRSG TQPQ KL 
Sbjct  502  CAMMRSGTTQPQGKLL  517



>ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
 sp|Q9ZSA2.1|CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21 [Arabidopsis 
thaliana]
 gb|AAD03453.1| contains similarity to eukaryotic protein kinase domains (Pfam: 
PF00069, score=312.6, E=4.7e-90, N=1) and EF hand domains 
(Pfam: PF00036, score=131, E=2.1e-35, N=4) [Arabidopsis thaliana]
 emb|CAB80837.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
 gb|AAN13018.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE82416.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
Length=531

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ E
Sbjct  452  DRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEE  511

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KL 
Sbjct  512  FCAMMRSGSTQPQGKLL  528



>ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ E
Sbjct  455  DRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEE  514

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KL 
Sbjct  515  FCAMMRSGTTQPQGKLL  531



>ref|XP_004231610.1| PREDICTED: calcium-dependent protein kinase 2-like [Solanum lycopersicum]
Length=527

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+ L KAFQ+FD DHSGFIT+DEL+SAM EYGMGDE TI++II EVDTD+DGRINY E
Sbjct  452  ERDDDLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEDTIREIIVEVDTDHDGRINYEE  511

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQPQ K F
Sbjct  512  FCAMMRSGTQPQDKPF  527



>ref|XP_002268814.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=545

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAF +FD D+SGFITRDEL++AM EYGMGDE +IK+II+EVDTD DGRINY E
Sbjct  470  ERDEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKE  529

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQP  KLF
Sbjct  530  FCTMMRSGTQPPVKLF  545



>ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
 gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
Length=535

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ E
Sbjct  456  DRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEE  515

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KL 
Sbjct  516  FCAMMRSGTTQPQGKLL  532



>ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
 gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
Length=534

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ E
Sbjct  455  DRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEE  514

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KL 
Sbjct  515  FCAMMRSGTTQPQGKLL  531



>ref|XP_008384073.1| PREDICTED: calcium-dependent protein kinase 33-like [Malus domestica]
Length=397

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM EYGMGD+ TI++II EVD DNDG+INYSE
Sbjct  322  ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEYGMGDDNTIREIISEVDADNDGKINYSE  381

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ   KLF
Sbjct  382  FCAMMRSGTQQPAKLF  397



>gb|AAK92828.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
Length=531

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDGRIN+ E
Sbjct  452  DRDEHVYKAFQHFDKDSSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEE  511

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KL 
Sbjct  512  FCAMMRSGSTQPQGKLL  528



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SGFITRDEL+SAM EYGMGDEATIK+II EVDTDNDGRINY E
Sbjct  473  ERDEHLYKAFQYFDKDSSGFITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEE  532

Query  412  FCAMMRSG-TQPQQKL  368
            FC MMRSG TQ Q KL
Sbjct  533  FCTMMRSGTTQHQGKL  548



>gb|AGG35967.1| calcium-dependent protein kinase 15, partial [Brassica napus]
Length=570

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEHL KAFQ+FD D+SGFIT DELKSAM EYGMGDE +IK++I EVDTDNDGRINY EF
Sbjct  490  RDEHLFKAFQYFDKDNSGFITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEF  549

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  550  CAMMRSGTTQPQQ  562



>emb|CDX82886.1| BnaC01g13360D [Brassica napus]
Length=557

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEHL KAFQ+FD D+SGFIT DELKSAM EYGMGDE +IK++I EVDTDNDGRINY EF
Sbjct  475  RDEHLFKAFQYFDKDNSGFITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEF  534

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  535  CAMMRSGTTQPQQ  547



>gb|KCW66998.1| hypothetical protein EUGRSUZ_F007612, partial [Eucalyptus grandis]
Length=170

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DEHL KAFQHFD D+SGFIT DE+++A+  YGMGDE TI+DII EVDTDNDGRI+Y E
Sbjct  95   ETDEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQE  154

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q Q KLF
Sbjct  155  FCAMMRSGNQHQGKLF  170



>ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase 21 [Camelina sativa]
Length=534

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDG+IN+ E
Sbjct  455  DRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEE  514

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQPQ KL 
Sbjct  515  FCAMMRSGSTQPQGKLL  531



>ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=536

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDG+IN+ EF
Sbjct  458  RDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEEF  517

Query  409  CAMMRSG-TQPQQKLF  365
            CAMMRSG TQPQ KL 
Sbjct  518  CAMMRSGSTQPQGKLL  533



>gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata]
Length=539

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E+DEHL  AFQ FD D SG+ITRDELKSAM EYGMGDEATI++II EVDTDNDG+INY E
Sbjct  463  EKDEHLFGAFQFFDKDSSGYITRDELKSAMKEYGMGDEATIEEIISEVDTDNDGKINYEE  522

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG TQP  KLF
Sbjct  523  FCAMMRSGTTQPAVKLF  539



>ref|XP_009388872.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388873.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388874.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=557

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL +AFQ+FD D+SGFITRDEL+SAM E+GMGD ATIK+II EVDTDNDGRINY E
Sbjct  482  ERDEHLYRAFQYFDKDNSGFITRDELESAMQEHGMGDIATIKEIISEVDTDNDGRINYQE  541

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q   KL 
Sbjct  542  FCAMMRSGVQQPAKLI  557



>ref|XP_004500067.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Cicer 
arietinum]
Length=548

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIID-------EVDTDND  434
            ERD+HL KAFQ+FD D+SGFITRDEL++AM EYGMGD+ATIK+II        EVDTD+D
Sbjct  466  ERDDHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDDATIKEIISEVDTIIFEVDTDHD  525

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EFCAMMRSG QPQ KLF
Sbjct  526  GRINYEEFCAMMRSGNQPQVKLF  548



>ref|XP_010448965.1| PREDICTED: calcium-dependent protein kinase 15 [Camelina sativa]
Length=558

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQ+FD D+SGFIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY EF
Sbjct  479  RDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEF  538

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  539  CAMMRSGTTQPQQ  551



>ref|XP_007212312.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
 gb|EMJ13511.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
Length=397

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM E+ MGDE TI++II EVD DNDGRINYSE
Sbjct  322  ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHAMGDENTIREIISEVDADNDGRINYSE  381

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ   KLF
Sbjct  382  FCAMMRSGTQQPGKLF  397



>ref|XP_010439398.1| PREDICTED: calcium-dependent protein kinase 15-like [Camelina 
sativa]
Length=560

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQ+FD D+SGFIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY EF
Sbjct  481  RDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEF  540

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  541  CAMMRSGTTQPQQ  553



>tpg|DAA62901.2| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
Length=140

 Score =   118 bits (295),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIK+II EVDTDNDGRINY E
Sbjct  65   ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEE  124

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  125  FCAMMRGGMQQPMRL  139



>ref|XP_006413708.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
 gb|ESQ55161.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
Length=218

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEHL KAFQ+FD D+SGFIT DEL+SAM EY MGDEA+IK+II EVDTDNDGRINY E
Sbjct  117  DRDEHLFKAFQYFDKDNSGFITMDELESAMKEYDMGDEASIKEIIAEVDTDNDGRINYEE  176

Query  412  FCAMMRSG-TQPQ  377
            FCAMMRSG T+PQ
Sbjct  177  FCAMMRSGNTKPQ  189



>gb|AGJ83806.1| calcium-dependent protein kinase 1d [Vitis amurensis]
Length=545

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAF +FD D+SGFITRDEL++AM EYGMGD  +IK+II+EVDTD DGRINY E
Sbjct  470  ERDEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDGDSIKEIINEVDTDKDGRINYKE  529

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQP  KLF
Sbjct  530  FCTMMRSGTQPPVKLF  545



>gb|KFK28778.1| hypothetical protein AALP_AA7G046400 [Arabis alpina]
Length=502

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 2/78 (3%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDE+L KAFQ+FD D+SGFIT DEL+S M EYGMGDEA+IK++I EVDTDNDGRINY E
Sbjct  419  DRDENLFKAFQYFDKDNSGFITMDELESTMKEYGMGDEASIKEVIAEVDTDNDGRINYEE  478

Query  412  FCAMMRSG-TQPQQ-KLF  365
            FCAMMRSG TQPQQ KLF
Sbjct  479  FCAMMRSGTTQPQQGKLF  496



>ref|XP_006283446.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
 gb|EOA16344.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
Length=559

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQ+FD D+SGFIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY EF
Sbjct  471  RDEHVSKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEF  530

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  531  CAMMRSGTTQPQQ  543



>emb|CDX79112.1| BnaA01g11790D [Brassica napus]
Length=563

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEHL KAFQ+FD D+SGFIT DEL+SAM EYGMGDE +IK++I EVDTDNDGRINY EF
Sbjct  481  RDEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEF  540

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  541  CAMMRSGTTQPQQ  553



>ref|XP_009135461.1| PREDICTED: calcium-dependent protein kinase 15 [Brassica rapa]
Length=573

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEHL KAFQ+FD D+SGFIT DEL+SAM EYGMGDE +IK++I EVDTDNDGRINY EF
Sbjct  491  RDEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEF  550

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  551  CAMMRSGTTQPQQ  563



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQ+FD D+SGFIT DEL+SAM +YGMGDEA+IK+II EVDTDNDGRINY EF
Sbjct  477  RDEHVFKAFQYFDKDNSGFITMDELESAMKKYGMGDEASIKEIIAEVDTDNDGRINYEEF  536

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG TQPQQ
Sbjct  537  CAMMRSGTTQPQQ  549



>ref|XP_004152931.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 ref|XP_004172987.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 gb|KGN56125.1| hypothetical protein Csa_3G077600 [Cucumis sativus]
Length=519

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL KAFQHFD D+SG+ITRDELK+AM +YGMGDE TI++II EVD DNDGRINY E
Sbjct  445  EKEEHLYKAFQHFDKDNSGYITRDELKAAMKDYGMGDEETIREIISEVDADNDGRINYDE  504

Query  412  FCAMMRSGTQPQQKLF  365
            FC+MMRSGTQ Q KLF
Sbjct  505  FCSMMRSGTQ-QAKLF  519



>ref|XP_008463413.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis melo]
Length=519

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL KAFQHFD D+SG+ITRDELK+AM +YGMGDE TI++II EVD DNDGRINY E
Sbjct  445  EKEEHLYKAFQHFDKDNSGYITRDELKAAMKDYGMGDEETIREIISEVDADNDGRINYDE  504

Query  412  FCAMMRSGTQPQQKLF  365
            FC+MMRSGTQ Q KLF
Sbjct  505  FCSMMRSGTQ-QAKLF  519



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQHFD D+SGFIT DEL+ AM +YGMGD+ TIK+II EVDTDNDGRINY E
Sbjct  454  ERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDE  513

Query  412  FCAMMRSGTQPQQKLF*VIARMNLL*FSVMEPTCIVN  302
            FCAMMRSGTQPQ K      R+  + F+V  P    N
Sbjct  514  FCAMMRSGTQPQAKS--QEYRLTAVPFAVRIPWIFAN  548


 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  535  FITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEFCAMMRSGTQPQQKLF  365
            FIT DEL+ AM +YGMGD+ TIK+II EVDTDNDGRINY EFCAMMRSGTQPQ KLF
Sbjct  624  FITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKLF  680



>ref|XP_008224828.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
2-like [Prunus mume]
Length=560

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM E+ MGDE TI++II EVD DNDGRINYSE
Sbjct  485  ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHAMGDENTIREIISEVDADNDGRINYSE  544

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ   KLF
Sbjct  545  FCAMMRSGTQQPGKLF  560



>ref|XP_004491400.1| PREDICTED: calcium-dependent protein kinase 9-like [Cicer arietinum]
Length=559

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQ+FD D+SGFITRDEL++AM EYGMGDE TI++II +VD DNDGRINY E
Sbjct  484  ERDDHLYKAFQYFDRDNSGFITRDELETAMKEYGMGDEDTIREIISDVDKDNDGRINYEE  543

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q Q KLF
Sbjct  544  FCAMMRSGVQQQGKLF  559



>ref|XP_010093289.1| Calcium-dependent protein kinase 15 [Morus notabilis]
 gb|EXB53814.1| Calcium-dependent protein kinase 15 [Morus notabilis]
Length=539

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL K FQ+FD D+SGFITRDEL++AM E+G+GDEA IK+II EVDTDNDGRI+Y+E
Sbjct  464  ERDEHLYKVFQYFDKDNSGFITRDELETAMKEHGIGDEANIKEIISEVDTDNDGRIDYTE  523

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQ   KLF
Sbjct  524  FCTMMRSGTQQSTKLF  539



>gb|KHN35744.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=404

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+ITRDEL++AM ++GMGDEATIK+II EVDTDNDGRINY E
Sbjct  329  ERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEE  388

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +L 
Sbjct  389  FCAMMRSGMPHQGQLL  404



>ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Malus domestica]
 gb|AAR28084.1| calcium-dependent protein kinase [Malus domestica]
Length=543

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM E+GMGD+ TI++II EVD DNDGRINYSE
Sbjct  468  ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSE  527

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q   KLF
Sbjct  528  FCAMMRSGAQQPAKLF  543



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 ref|XP_004155602.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ FD D SG+IT+DEL++AM +YGMGDEA+I++II EVDTDNDGRINY E
Sbjct  477  ERDEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQE  536

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGT    KLF
Sbjct  537  FCAMMRSGTTQPGKLF  552



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ FD D SG+IT+DEL++AM +YGMGDEA+I++II EVDTDNDGRINY E
Sbjct  477  ERDEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQE  536

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGT    KLF
Sbjct  537  FCAMMRSGTTQPGKLF  552



>ref|XP_011037643.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037644.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037646.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
Length=532

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+EHL KAFQ+FD D SG+ITRDEL+ AM EYGMGDE++IK+II EVD DNDGRINY E
Sbjct  457  EREEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGT P   L+
Sbjct  517  FCAMMRSGTPPAPSLY  532



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+ITRDEL++AM ++GMGDEATIK+II EVDTDNDGRINY E
Sbjct  454  ERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEE  513

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +L 
Sbjct  514  FCAMMRSGMPHQGQLL  529



>gb|KDP20751.1| hypothetical protein JCGZ_21222 [Jatropha curcas]
Length=562

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+S+M EYGMGDEA+IK+II EVDTDNDGRINY E
Sbjct  493  ERDEHLYKAFQYFDKDSSGYITRDELESSMKEYGMGDEASIKEIISEVDTDNDGRINYEE  552

Query  412  FCAMMRSGTQ  383
            FC MMRSG Q
Sbjct  553  FCTMMRSGVQ  562



>ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=543

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM E+GMGD+ TI++II EVD DNDGRINYSE
Sbjct  468  ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSE  527

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q   KLF
Sbjct  528  FCAMMRSGAQQPAKLF  543



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+IT+DEL++AM EYGMGDEA+I+++I EVDTDNDG+INY E
Sbjct  463  ERDEHLYKAFQYFDKDNSGYITKDELETAMKEYGMGDEASIREVISEVDTDNDGKINYEE  522

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQ   K F
Sbjct  523  FCTMMRSGTQQTGKPF  538



>ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=873

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQHFD D+SG ITRDEL+SAM EYGMGDEA+I+++I EVDTDNDG+IN+ EF
Sbjct  795  RDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIREVISEVDTDNDGKINFEEF  854

Query  409  CAMMRSG-TQPQQKLF  365
            CAMMRSG TQPQ KL 
Sbjct  855  CAMMRSGSTQPQGKLL  870



>ref|NP_193925.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
 sp|O49717.1|CDPKF_ARATH RecName: Full=Calcium-dependent protein kinase 15 [Arabidopsis 
thaliana]
 emb|CAA17161.1| calcium-dependent protein kinase - like protein [Arabidopsis 
thaliana]
 emb|CAB79149.1| calcium-dependent protein kinase-like protein [Arabidopsis thaliana]
 gb|AAK59500.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAL34178.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE84532.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
Length=554

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQ+FD D+SGFIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY EF
Sbjct  475  RDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEF  534

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG T PQQ
Sbjct  535  CAMMRSGITLPQQ  547



>gb|ACR36994.1| unknown [Zea mays]
Length=140

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIK+II EVDTDNDGRINY E
Sbjct  65   ERDEYLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEE  124

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  125  FCAMMRGGMQQPMRL  139



>ref|NP_001190794.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
 gb|AEE84533.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
Length=561

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEH+ KAFQ+FD D+SGFIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY EF
Sbjct  475  RDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEF  534

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG T PQQ
Sbjct  535  CAMMRSGITLPQQ  547



>ref|XP_006657762.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Oryza brachyantha]
Length=531

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SGFITRDEL+SA++E+ MGD +TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDSSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQQ  374
            FCAMMR G QP +
Sbjct  517  FCAMMRGGVQPPR  529



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+ITRDEL++AM +YG+GDEA+IK+II EVDTDNDGRINY E
Sbjct  469  ERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEE  528

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGT    KL 
Sbjct  529  FCTMMRSGTPQPAKLI  544



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+ITRDEL++AM +YG+GDEA+IK+II EVDTDNDGRINY E
Sbjct  469  ERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEE  528

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGT    KL 
Sbjct  529  FCTMMRSGTPQPAKLI  544



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+ITRDEL++AM +YG+GDEA+IK+II EVDTDNDGRINY E
Sbjct  469  ERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEE  528

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGT    KL 
Sbjct  529  FCTMMRSGTPQPAKLI  544



>ref|XP_003617547.1| Calcium dependent protein kinase [Medicago truncatula]
Length=1052

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++AM EYGMGDE TI++II EVDTDNDGRINY E
Sbjct  491  ERDEHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYEE  550

Query  412  FCAMMRSGTQPQQK  371
            FC MMRSG Q Q K
Sbjct  551  FCTMMRSGVQQQGK  564



>ref|XP_006657761.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Oryza brachyantha]
Length=559

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SGFITRDEL+SA++E+ MGD +TIKDII EVDTDNDGRINY E
Sbjct  485  ERDEHLFKAFQYFDKDSSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEE  544

Query  412  FCAMMRSGTQPQQ  374
            FCAMMR G QP +
Sbjct  545  FCAMMRGGVQPPR  557



>gb|KDP39132.1| hypothetical protein JCGZ_00889 [Jatropha curcas]
Length=535

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+EHL KAFQ+FD D+SGFIT DEL++AM ++GMGD+ATIK+II EVDTDNDGRINY E
Sbjct  460  EREEHLYKAFQYFDKDNSGFITTDELETAMKDFGMGDDATIKEIISEVDTDNDGRINYEE  519

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMR+G Q Q +LF
Sbjct  520  FCAMMRTGNQHQGRLF  535



>ref|XP_002869856.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46115.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDEHL KAFQ+FD D+SGFIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY EF
Sbjct  471  RDEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEF  530

Query  409  CAMMRSG-TQPQQ  374
            CAMMRSG T P Q
Sbjct  531  CAMMRSGITLPTQ  543



>dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense]
Length=558

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG ITR+EL++AM ++GMGDEATIK+II EVDTDNDGRINY E
Sbjct  483  ERDEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYEE  542

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  543  FCAMMRSGMPHQAQLF  558



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+ITRDEL++AM ++GMGDEATIK+II EVDTDNDGRINY E
Sbjct  464  ERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEE  523

Query  412  FCAMMRSGTQPQQ  374
            FCAMMRSG  P Q
Sbjct  524  FCAMMRSG-MPHQ  535



>emb|CDP05759.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L  AFQ+FD D+SGFITRDEL++AM +YGMGD ATIK+II EVDTDNDGRINY E
Sbjct  445  EREENLYTAFQYFDKDNSGFITRDELETAMKDYGMGDPATIKEIISEVDTDNDGRINYEE  504

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGT+   KLF
Sbjct  505  FCTMMRSGTKQPNKLF  520



>ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=546

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM E+GMGD+ TI++II EVD DNDG+INYSE
Sbjct  471  ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGKINYSE  530

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGTQ    LF
Sbjct  531  FCAMMRSGTQQPAMLF  546



>gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea]
Length=503

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL  AFQ FD D+SG+ITRDEL++AM +YGMGDEATI++II EVDTDNDGRINY E
Sbjct  427  ERDEHLFGAFQFFDTDNSGYITRDELETAMKKYGMGDEATIREIISEVDTDNDGRINYEE  486

Query  412  FCAMMRSGTQPQQ-KLF  365
            FC MMRSGT  Q  KLF
Sbjct  487  FCTMMRSGTTQQPVKLF  503



>ref|XP_002869852.1| hypothetical protein ARALYDRAFT_354567 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46111.1| hypothetical protein ARALYDRAFT_354567 [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQ+FD D+SGFIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY E
Sbjct  316  DRDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEE  375

Query  412  FCAMMRSG-TQPQQ  374
            FCAMMRSG T P Q
Sbjct  376  FCAMMRSGITLPTQ  389



>ref|XP_003610427.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92624.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=539

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG ITR+EL++AM ++GMGDEATIK+II EVDTDNDGRINY E
Sbjct  464  ERDEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYEE  523

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q  LF
Sbjct  524  FCAMMRSGMPHQGPLF  539



>emb|CAA65500.1| protein kinase [Medicago sativa]
Length=542

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 67/83 (81%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+HL KAFQ+FD D SGFITRDEL++AM EYGMGD+ATIK+       II EVDTD+D
Sbjct  460  ERDDHLYKAFQYFDKDSSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  519

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EFCAMMRSG Q Q KLF
Sbjct  520  GRINYEEFCAMMRSGNQQQVKLF  542



>gb|ABE72958.1| calcium dependent protein kinase 3 [Medicago truncatula]
Length=538

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 67/83 (81%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+HL KAFQ+FD D SGFITRDEL++AM EYGMGD+ATIK+       II EVDTD+D
Sbjct  456  ERDDHLYKAFQYFDKDSSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  515

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EFCAMMRSG Q Q KLF
Sbjct  516  GRINYEEFCAMMRSGNQQQVKLF  538



>gb|KCW67039.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=492

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DEHL KAFQHFD D+SGFIT DE+++A+  YGMGDE TI+DII EVDTDNDGRI+Y E
Sbjct  417  ETDEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQE  476

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q Q KLF
Sbjct  477  FCAMMRSGNQHQGKLF  492



>gb|KEH33831.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=538

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 67/83 (81%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+HL KAFQ+FD D SGFITRDEL++AM EYGMGD+ATIK+       II EVDTD+D
Sbjct  456  ERDDHLYKAFQYFDKDSSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  515

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EFCAMMRSG Q Q KLF
Sbjct  516  GRINYEEFCAMMRSGNQQQVKLF  538



>ref|XP_010060346.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X1 
[Eucalyptus grandis]
Length=535

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DEHL KAFQHFD D+SGFIT DE+++A+  YGMGDE TI+DII EVDTDNDGRI+Y E
Sbjct  460  ETDEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQE  519

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q Q KLF
Sbjct  520  FCAMMRSGNQHQGKLF  535



>ref|XP_010060348.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X2 
[Eucalyptus grandis]
Length=550

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DEHL KAFQHFD D+SGFIT DE+++A+  YGMGDE TI+DII EVDTDNDGRI+Y E
Sbjct  475  ETDEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQE  534

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q Q KLF
Sbjct  535  FCAMMRSGNQHQGKLF  550



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL+ AM EYGMGDE++IK+II EVD DNDGRINY E
Sbjct  457  ERDEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSGT     L+
Sbjct  517  FCAMMRSGTPHAPSLY  532



>ref|XP_010060380.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW67038.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=543

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DEHL KAFQHFD D+SGFIT DE+++A+  YGMGDE TI+DII EVDTDNDGRI+Y E
Sbjct  468  ETDEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQE  527

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG Q Q KLF
Sbjct  528  FCAMMRSGNQHQGKLF  543



>ref|XP_004293286.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SG+ITRDEL++AM E+GMGD+ TIK+II EVD DNDGRINY+E
Sbjct  469  ERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIKEIISEVDADNDGRINYTE  528

Query  412  FCAMMRSGTQPQQ  374
            FC MMRSG QP +
Sbjct  529  FCTMMRSGNQPTR  541



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D SGFITRDEL++AM EYG+GD +TIK+II EVDTDNDGRINY E
Sbjct  448  EREENLYKAFQYFDKDSSGFITRDELETAMQEYGIGDASTIKEIIAEVDTDNDGRINYEE  507

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMR+G   Q KLF
Sbjct  508  FCTMMRTGNPQQPKLF  523



>gb|ACR34538.1| unknown [Zea mays]
Length=531

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIK+II EVDTDNDGRINY E
Sbjct  456  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEE  515

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  516  FCAMMRGGMQQPMRL  530



>ref|XP_008651864.1| PREDICTED: calcium-dependent protein kinase 2 isoform X1 [Zea 
mays]
Length=531

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIK+II EVDTDNDGRINY E
Sbjct  456  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEE  515

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  516  FCAMMRGGMQQPMRL  530



>ref|XP_002532559.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF29820.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=533

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+EHL KAFQ+FD D+SGFITRDEL++AM +Y MGD+ATIK+II EVD DNDGRINY E
Sbjct  458  EREEHLYKAFQYFDKDNSGFITRDELETAMKDYEMGDDATIKEIISEVDADNDGRINYEE  517

Query  412  FCAMMRSGTQPQQKLF  365
            FC MM++G Q Q KLF
Sbjct  518  FCTMMKTGNQHQGKLF  533



>emb|CBI26637.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SGFITRDELK+AM E+GMGD+ TI +II EVDTDND +INY E
Sbjct  256  ERDEHLFKAFQYFDKDSSGFITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGE  315

Query  412  FCAMMRSGTQPQQKLF  365
            FC+MMR GTQ   K+F
Sbjct  316  FCSMMRGGTQQGLKVF  331



>ref|XP_007142270.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
 gb|ESW14264.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
Length=525

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL  AFQ+FD D SG+ITRDEL++AM E GMGDEATIKDII EVDTDNDGRINY E
Sbjct  451  ERDEHLYGAFQYFDKDGSGYITRDELETAMKENGMGDEATIKDIISEVDTDNDGRINYEE  510

Query  412  FCAMMRSGTQPQQKLF  365
            F  MMRSGTQ Q KLF
Sbjct  511  FSTMMRSGTQ-QGKLF  525



>gb|AHN49725.1| calcium-dependent protein kinase 1 [Hippeastrum hybrid cultivar]
Length=531

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+ AM E+G+GD++TIKDII EVD+DNDGRINY E
Sbjct  456  ERDEHLFKAFQYFDKDNSGFITRDELELAMKEHGLGDDSTIKDIISEVDSDNDGRINYDE  515

Query  412  FCAMMRSGTQPQQKL  368
            FCAMM+ G Q   KL
Sbjct  516  FCAMMKGGAQQPLKL  530



>ref|XP_004957849.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Setaria italica]
 gb|AGG54988.1| CDPK1, partial [Setaria italica]
Length=531

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIK+II EVDTDNDGRINY E
Sbjct  456  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEE  515

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  516  FCAMMRGGMQQPMRL  530



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D+SG ITRDEL++AM EYGMGD+ TIK+II EVDTDNDG+INY E
Sbjct  450  ERDEHLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEE  509

Query  412  FCAMMRSGTQPQQKLF  365
            F AMMRSGTQ Q +LF
Sbjct  510  FRAMMRSGTQ-QGQLF  524



>ref|NP_001105542.1| calcium-dependent protein kinase 2 [Zea mays]
 sp|P49101.1|CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2; Short=CDPK 
2 [Zea mays]
 gb|AAA69507.1| calcium-dependent protein kinase [Zea mays]
Length=513

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TI++II EVDTDNDGRINY E
Sbjct  438  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIREIISEVDTDNDGRINYEE  497

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  498  FCAMMRGGMQQPMRL  512



>gb|KHG26977.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=524

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D+SG ITRDEL++AM EYGMGD+ TIK+II EVDTDNDG+INY E
Sbjct  450  ERDEHLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEE  509

Query  412  FCAMMRSGTQPQQKLF  365
            F AMMRSGTQ Q +LF
Sbjct  510  FRAMMRSGTQ-QGQLF  524



>ref|NP_001266075.1| calcium-dependent protein kinase 21-like [Cicer arietinum]
 gb|AAP72281.2| calcium-dependent calmodulin-independent protein kinase isoform 
1 [Cicer arietinum]
Length=556

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG ITR+EL++AM ++GMGDEATIKDII EVDTD+DGRINY E
Sbjct  465  ERDEHLYKAFQYFDKDNSGHITREELETAMTQHGMGDEATIKDIISEVDTDHDGRINYEE  524

Query  412  FCAMMRSGTQP  380
            FCAMMRSG  P
Sbjct  525  FCAMMRSGMPP  535



>gb|EAZ40006.1| hypothetical protein OsJ_24444 [Oryza sativa Japonica Group]
Length=454

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIKDII EVDTDNDGRINY E
Sbjct  378  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEE  437

Query  412  FCAMMRSGTQPQ  377
            FCAMMR G   Q
Sbjct  438  FCAMMRGGGMQQ  449



>ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Glycine 
max]
 gb|KHN03472.1| Calcium-dependent protein kinase 21 [Glycine soja]
Length=538

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG+ITRDEL+ AM + GMGDEATIK+II EVD DNDGRINY E
Sbjct  463  ERDEHLYKAFQYFDKDNSGYITRDELEIAMTQNGMGDEATIKEIISEVDADNDGRINYEE  522

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +L 
Sbjct  523  FCAMMRSGMPHQGQLL  538



>gb|ABB54456.1| calcium-dependent protein kinase [Hordeum brevisubulatum]
Length=532

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++A++E+ MGD  TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   KL
Sbjct  517  FCAMMRGGIQQPIKL  531



>ref|XP_008804309.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Phoenix 
dactylifera]
Length=538

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL +AFQ+FD D+SGFITRDEL+SAM E+G+GD +TIK+II E+DTDNDGRINY E
Sbjct  463  ERDEHLYRAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEIDTDNDGRINYEE  522

Query  412  FCAMMRSGTQPQQKL  368
            FCAMM+ G Q   KL
Sbjct  523  FCAMMKGGIQQPVKL  537



>ref|XP_010923910.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Elaeis guineensis]
Length=503

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SAM E+G+GD +TIK+II EVDTDNDGRINY E
Sbjct  428  ERDEHLYKAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEVDTDNDGRINYEE  487

Query  412  FCAMMRSGTQ  383
            FCAMM+ G Q
Sbjct  488  FCAMMKGGIQ  497



>ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group]
 sp|P53683.2|CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform 2; Short=CDPK 
2 [Oryza sativa Japonica Group]
 dbj|BAC20693.1| CDP2_ORYSA Calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21689.1| Os07g0515100 [Oryza sativa Japonica Group]
Length=533

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQ  377
            FCAMMR G   Q
Sbjct  517  FCAMMRGGGMQQ  528



>emb|CAA57157.1| calcium-dependent protein kinase [Oryza sativa Japonica Group]
 gb|EAZ04052.1| hypothetical protein OsI_26188 [Oryza sativa Indica Group]
Length=533

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQ  377
            FCAMMR G   Q
Sbjct  517  FCAMMRGGGMQQ  528



>gb|KJB69279.1| hypothetical protein B456_011G014200 [Gossypium raimondii]
Length=551

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDE L KAFQ+FD D+SG+IT+DEL++AM EYGMGDEA+I+ +I EVDTDNDGRINY E
Sbjct  467  DRDELLYKAFQYFDKDNSGYITKDELETAMKEYGMGDEASIRAVISEVDTDNDGRINYEE  526

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMR GTQ  +K F
Sbjct  527  FCTMMRGGTQQTEKAF  542



>ref|XP_010923909.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Elaeis guineensis]
Length=551

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SAM E+G+GD +TIK+II EVDTDNDGRINY E
Sbjct  476  ERDEHLYKAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEVDTDNDGRINYEE  535

Query  412  FCAMMRSGTQPQQK  371
            FCAMM+ G Q   K
Sbjct  536  FCAMMKGGIQQPVK  549



>ref|NP_001105306.1| calcium-dependent protein kinase [Zea mays]
 dbj|BAA12715.1| calcium-dependent protein kinase [Zea mays]
 gb|ACN30810.1| unknown [Zea mays]
 gb|ACN34633.1| unknown [Zea mays]
 tpg|DAA40972.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA40973.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
 tpg|DAA40974.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 3 [Zea mays]
 tpg|DAA40975.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 4 [Zea mays]
Length=531

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIK+II EVDTDNDGRINY E
Sbjct  456  ERDEYLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEE  515

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  516  FCAMMRGGMQQPMRL  530



>ref|XP_002869854.1| hypothetical protein ARALYDRAFT_914449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46113.1| hypothetical protein ARALYDRAFT_914449 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score =   119 bits (297),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQ+FD D+S FIT DEL+SAM EYGMGDEA+IK++I EVDTDNDGRINY E
Sbjct  784  DRDEHVFKAFQYFDKDNSWFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEE  843

Query  412  FCAMMRSG-TQPQQKLF  365
            FCAMMRSG T P Q  F
Sbjct  844  FCAMMRSGITLPTQGNF  860



>ref|XP_007020820.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
 gb|EOY12345.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
Length=536

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D+SG+ITRDEL++AM EYGMGD  TIK+II EVDTDNDG+INY E
Sbjct  462  ERDEHLYKAFQHFDKDNSGYITRDELETAMKEYGMGDNDTIKEIISEVDTDNDGKINYEE  521

Query  412  FCAMMRSGTQPQQKLF  365
            F  MMRSGTQ Q +LF
Sbjct  522  FRDMMRSGTQ-QGQLF  536



>dbj|BAJ99143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++A++E+ MGD  TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  517  FCAMMRGGMQQPIRL  531



>gb|ABD98804.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++A++E+ MGD  TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  517  FCAMMRGGMQQPIRL  531



>gb|ABC59619.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMT05971.1| Calcium-dependent protein kinase isoform 2 [Aegilops tauschii]
Length=532

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++A++E+ MGD  TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  517  FCAMMRGGMQQPIRL  531



>gb|ABD98803.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|ABY59008.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMS66675.1| Calcium-dependent protein kinase isoform 2 [Triticum urartu]
Length=532

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++A++E+ MGD  TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  517  FCAMMRGGMQQPIRL  531



>gb|ABC59620.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL++A++E+ MGD  TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKL  368
            FCAMMR G Q   +L
Sbjct  517  FCAMMRGGMQQPIRL  531



>ref|XP_002278179.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=536

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SGFITRDELK+AM E+GMGD+ TI +II EVDTDND +INY E
Sbjct  461  ERDEHLFKAFQYFDKDSSGFITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGE  520

Query  412  FCAMMRSGTQPQQKLF  365
            FC+MMR GTQ   K+F
Sbjct  521  FCSMMRGGTQQGLKVF  536



>ref|XP_003563028.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Brachypodium 
distachyon]
Length=532

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SGFITRDEL++A++E+ MGD  TIKDII EVDTDNDGRINY E
Sbjct  456  ERDEHLFKAFQYFDKDSSGFITRDELETALIEHEMGDTDTIKDIISEVDTDNDGRINYDE  515

Query  412  FCAMMRSGTQPQ  377
            FCAMMR G Q Q
Sbjct  516  FCAMMRGGIQQQ  527



>ref|XP_008806408.1| PREDICTED: calcium-dependent protein kinase 2 [Phoenix dactylifera]
Length=548

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D SGFITRDEL+SAM E+G+GD +TIK+II EVD DNDGRINY E
Sbjct  473  ERDEHLYKAFQYFDKDSSGFITRDELESAMEEHGIGDASTIKEIISEVDADNDGRINYEE  532

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMM+ G Q   KL 
Sbjct  533  FCAMMKGGIQQPVKLM  548



>gb|AFR11230.1| calcium dependent protein kinase 1 [Chenopodium album]
Length=543

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DE+L+KAF++FD D+SGFIT DEL+S MMEYG+ DE++IK+I+ EVDTDNDG+INY E
Sbjct  468  ETDENLLKAFRYFDKDNSGFITMDELESEMMEYGIADESSIKEILSEVDTDNDGKINYDE  527

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMM+SGT  Q KLF
Sbjct  528  FCAMMKSGTTAQVKLF  543



>gb|KJB13679.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13680.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13682.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=537

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D+SG+ITRDEL++AM EYGMGD+ TIK+II EVDTDNDG+INY E
Sbjct  463  ERDEHLYKAFQHFDKDNSGYITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEE  522

Query  412  FCAMMRSGTQPQQ  374
            F  MMRSGTQ  Q
Sbjct  523  FRDMMRSGTQHTQ  535



>gb|KHG28675.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=537

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D+SG+ITRDEL++AM EYGMGD+ TIK+II EVDTDNDG+INY E
Sbjct  463  ERDEHLYKAFQHFDKDNSGYITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEE  522

Query  412  FCAMMRSGTQPQQ  374
            F  MMRSGTQ  Q
Sbjct  523  FRDMMRSGTQHTQ  535



>dbj|BAA13440.1| calcium dependent protein kinase [Ipomoea batatas]
Length=514

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D SGFITRDEL++AM E+G+ D ATIK+II EVD D+DGRINY E
Sbjct  439  EREENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEE  498

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGT+ Q KLF
Sbjct  499  FCTMMRSGTKQQAKLF  514



>gb|ADM14342.1| calcium-dependent protein kinase 19 [Oryza sativa Japonica Group]
Length=533

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIKDII EVDT+NDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTNNDGRINYEE  516

Query  412  FCAMMRSGTQPQ  377
            FCAMMR G   Q
Sbjct  517  FCAMMRGGGMQQ  528



>gb|KHG10851.1| Calcium-dependent protein kinase 21 [Gossypium arboreum]
Length=552

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDE L KAFQ+FD D+SG+IT+DEL++AM EYGM DEA+I+ +I EVDTDNDGRINY E
Sbjct  468  DRDELLYKAFQYFDKDNSGYITKDELETAMKEYGMVDEASIRAVISEVDTDNDGRINYEE  527

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGTQ  +K F
Sbjct  528  FCTMMRSGTQQTEKAF  543



>ref|XP_009414250.1| PREDICTED: calcium-dependent protein kinase 29-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL+KAF+HFD DHSG+ITRDELK AM +YGMGDEATI +++D+VDTD DGRINY E
Sbjct  305  EKEEHLLKAFEHFDKDHSGYITRDELKHAMSQYGMGDEATINEVLDDVDTDKDGRINYEE  364

Query  412  FCAMMRSG  389
            F AMMR+G
Sbjct  365  FVAMMRNG  372



>ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DE+L KAF++FD D+SGFIT DEL+ AMMEYG+ DE++IK+I+ EVDTDNDGRINY E
Sbjct  514  ETDENLSKAFRYFDKDNSGFITMDELEVAMMEYGIADESSIKEILSEVDTDNDGRINYEE  573

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSGT  Q KLF
Sbjct  574  FCTMMRSGTTQQVKLF  589



>ref|XP_010929942.1| PREDICTED: calcium-dependent protein kinase 2-like [Elaeis guineensis]
Length=544

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL +AFQ+FD D+SGFITRDEL+SAM E+G+GD +TIK+II E+DTDNDGRINY E
Sbjct  469  ERDEHLYRAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEIDTDNDGRINYEE  528

Query  412  FCAMMRSGTQPQQKL  368
            FCAMM+ G Q   +L
Sbjct  529  FCAMMKGGMQQPVEL  543



>gb|AGJ83807.1| calcium-dependent protein kinase 1e [Vitis amurensis]
Length=536

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL K FQ+FD D SGFITRDELK+AM E+GMGD+ TI +II EVDTDND +INY E
Sbjct  461  ERDEHLFKPFQYFDKDSSGFITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGE  520

Query  412  FCAMMRSGTQPQQKLF  365
            FC+MMR GTQ   K+F
Sbjct  521  FCSMMRGGTQQGLKVF  536



>ref|XP_009798561.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=521

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L  AFQ+FD D SGFITRDEL++AM E+G+GD A I++II EVDTDNDGRINY E
Sbjct  446  ERDENLYTAFQYFDKDGSGFITRDELETAMEEHGIGDPACIREIISEVDTDNDGRINYDE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG +   KLF
Sbjct  506  FCAMMRSGVKQPGKLF  521



>ref|XP_009604147.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
tomentosiformis]
Length=521

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L  AFQ+FD D SGFITRDEL++AM E+G+GD A I++II EVDTDNDGRINY E
Sbjct  446  ERDENLYTAFQYFDKDGSGFITRDELETAMEEHGIGDPACIREIITEVDTDNDGRINYEE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG +   KLF
Sbjct  506  FCAMMRSGVKQPGKLF  521



>gb|KFK39368.1| hypothetical protein AALP_AA3G235800 [Arabis alpina]
Length=535

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  460  ESNENLYKAFQHFDKDSSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  519

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  520  FCAMMRSGNPQQPRLF  535



>gb|AAP03014.1| seed calcium dependent protein kinase c [Glycine max]
Length=537

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+ L KAFQ+FD D+SGFITRDEL+SAM EYGMGD+ATIK+       II EVDTD+D
Sbjct  455  ERDDQLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  514

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EF AMM+SG Q Q KLF
Sbjct  515  GRINYEEFSAMMKSGNQQQGKLF  537



>gb|AIU98504.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=511

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL+KAF+HFD DHSG+ITRDELK AM +YGMGDEATI +++D+VDTD DGRINY E
Sbjct  442  EKEEHLLKAFEHFDKDHSGYITRDELKHAMSQYGMGDEATINEVLDDVDTDKDGRINYEE  501

Query  412  FCAMMRSG  389
            F AMMR G
Sbjct  502  FVAMMRKG  509



>ref|XP_010545509.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
 ref|XP_010545510.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
Length=534

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DE+L KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+I+ +VD+DNDGRINY E
Sbjct  459  ESDENLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDSDNDGRINYEE  518

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG   Q +LF
Sbjct  519  FCTMMRSGNPQQPRLF  534



>ref|NP_001235641.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
 gb|AAB80693.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
Length=538

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+ L KAFQ+FD D+SGFITRDEL+SAM EYGMGD+ATIK+       II EVDTD+D
Sbjct  456  ERDDQLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  515

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EF AMM+SG Q Q KLF
Sbjct  516  GRINYEEFSAMMKSGNQQQGKLF  538



>gb|ACJ61504.1| calcium-dependent protein kinase [Glycine max]
 gb|KHM99562.1| Calcium-dependent protein kinase isoform 2 [Glycine soja]
Length=551

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+ L KAFQ+FD D+SGFITRDEL+SAM EYGMGD+ATIK+       II EVDTD+D
Sbjct  469  ERDDQLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  528

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EF AMM+SG Q Q KLF
Sbjct  529  GRINYEEFSAMMKSGNQQQGKLF  551



>ref|XP_009414364.1| PREDICTED: calcium-dependent protein kinase 29-like, partial 
[Musa acuminata subsp. malaccensis]
Length=230

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL+KAF++FD DHSG+ITRDELK AM +YGMGDEATI +++D+VDTD DGRI+Y E
Sbjct  161  EKEEHLLKAFEYFDKDHSGYITRDELKHAMSQYGMGDEATINEVLDDVDTDKDGRISYEE  220

Query  412  FCAMMRSG  389
            F AMMR G
Sbjct  221  FVAMMRKG  228



>gb|AGA83664.1| calcium-dependent protein kinase 1 [Dendrobium catenatum]
Length=534

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L  AFQ+FD D SGFITRDEL++A+ E+GMGD ATIK+II EVD DNDGRINY E
Sbjct  459  ERDENLYSAFQYFDKDDSGFITRDELETALEEHGMGDAATIKEIISEVDADNDGRINYEE  518

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMM+SG Q   K+ 
Sbjct  519  FCAMMKSGLQQPAKII  534



>ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
 sp|Q9C6P3.1|CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33 [Arabidopsis 
thaliana]
 gb|AAG51192.1|AC079279_13 calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAT06478.1| At1g50700 [Arabidopsis thaliana]
 dbj|BAD43386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32581.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
Length=521

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E++ KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+I+ +VD DNDGRINY E
Sbjct  446  ESNENVYKAFQHFDKDGSGYITTDELEAALKEYGMGDDATIKEILSDVDADNDGRINYDE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  506  FCAMMRSGNPQQPRLF  521



>ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67848.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L +AFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+I+ +VD DNDGRINY E
Sbjct  446  ESNENLYRAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDADNDGRINYEE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  506  FCAMMRSGNPQQPRLF  521



>ref|XP_006365956.1| PREDICTED: calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=526

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L KAFQ+FD D SGFITRDEL+++M E+G+GD A+I++II EVD DNDGRINY E
Sbjct  451  ERDENLYKAFQYFDKDGSGFITRDELETSMEEHGIGDPASIREIISEVDADNDGRINYEE  510

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG +   KLF
Sbjct  511  FCTMMRSGAKQPGKLF  526



>ref|NP_001275322.1| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ACZ26302.1| calcium dependant protein kinase [Solanum tuberosum]
Length=532

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L KAFQ+FD D SGFITRDEL+++M E+G+GD A+I++II EVD DNDGRINY E
Sbjct  457  ERDENLYKAFQYFDKDGSGFITRDELETSMEEHGIGDPASIREIISEVDADNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG +   KLF
Sbjct  517  FCTMMRSGAKQPGKLF  532



>ref|NP_188676.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
 sp|Q38868.1|CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAB03242.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 dbj|BAB02824.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAM53285.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAP68337.1| At3g20410 [Arabidopsis thaliana]
 gb|AEE76375.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
Length=541

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL+SA+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  464  ESNENLYKAFQHFDKDSSGYITIDELESALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  523

Query  412  FCAMMRSGTQPQQK  371
            FCAMMRSG   QQ+
Sbjct  524  FCAMMRSGNPQQQQ  537



>ref|XP_009592788.1| PREDICTED: calcium-dependent protein kinase 2 [Nicotiana tomentosiformis]
Length=522

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D SGFITRDEL++AM E+G+GD A+I++II EVD DNDGRINY E
Sbjct  447  EREENLYKAFQYFDKDGSGFITRDELETAMEEHGIGDAASIREIISEVDADNDGRINYEE  506

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG +   KLF
Sbjct  507  FCTMMRSGAKQPGKLF  522



>ref|XP_002883243.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59502.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL+SA+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  464  ESNENLYKAFQHFDKDSSGYITIDELESALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  523

Query  412  FCAMMRSGTQPQQK  371
            FCAMMRSG   QQ+
Sbjct  524  FCAMMRSGNPQQQQ  537



>ref|XP_009783685.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=522

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D SGFITRDEL++AM E+G+GD A+I++II EVD DNDGRINY E
Sbjct  447  EREENLYKAFQYFDKDGSGFITRDELETAMEEHGVGDAASIREIISEVDADNDGRINYEE  506

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG +   KLF
Sbjct  507  FCTMMRSGAKQPGKLF  522



>gb|KHN02836.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=551

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 7/83 (8%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+ L KAFQ+FD D+SGFITRDEL++AM EYGMGD+ATIK+       II EVDTD+D
Sbjct  469  ERDDQLFKAFQYFDKDNSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  528

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EF AMM+SG Q Q KLF
Sbjct  529  GRINYEEFSAMMKSGNQQQGKLF  551



>gb|AAD28192.2| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ABF56558.1| calcium-dependent protein kinase 1 [Solanum tuberosum]
Length=532

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L KAFQ+FD D SGFITRDEL+++M E+G+GD A+I++II EVD DNDGRINY E
Sbjct  457  ERDENLYKAFQYFDKDGSGFITRDELETSMEEHGIGDPASIREIIAEVDADNDGRINYEE  516

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG +   KLF
Sbjct  517  FCTMMRSGAKQPGKLF  532



>gb|KJB68586.1| hypothetical protein B456_010G252400 [Gossypium raimondii]
Length=527

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE L KAFQ+FD D+SGFIT DEL++AM +Y MGDEA+IK II EVDTDNDG+INY E
Sbjct  452  ERDEDLYKAFQYFDKDNSGFITMDELEAAMKDYRMGDEASIKQIISEVDTDNDGKINYDE  511

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMR G     KLF
Sbjct  512  FCAMMRGGAPQTAKLF  527



>ref|XP_010479536.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=521

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E L KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+I+ +VD+DNDG+INY E
Sbjct  446  ESNESLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  506  FCAMMRSGNPQQPRLF  521



>ref|XP_010461925.1| PREDICTED: calcium-dependent protein kinase 33 [Camelina sativa]
Length=521

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E L KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+I+ +VD+DNDG+INY E
Sbjct  446  ESNESLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  506  FCAMMRSGNPQQPRLF  521



>gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Erythranthe guttata]
Length=528

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D SGFITRDEL++AM E+ +GD++TIKDII EVDTDNDGRINY E
Sbjct  450  EREENLYKAFQYFDKDSSGFITRDELEAAMQEHNVGDQSTIKDIIAEVDTDNDGRINYEE  509

Query  412  FCAMMRSGTQPQQ  374
            FC MMR+G+  QQ
Sbjct  510  FCNMMRTGSTQQQ  522



>ref|XP_006346214.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Solanum 
tuberosum]
Length=521

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L  AFQ+FD D SGFITRDEL++AM E+G+GD + I++II EVDTDNDGRINY E
Sbjct  446  ERDENLYTAFQYFDKDSSGFITRDELEAAMQEHGIGDPSCIREIISEVDTDNDGRINYEE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG +   K+F
Sbjct  506  FCTMMRSGAKQPGKVF  521



>ref|XP_002874810.1| hypothetical protein ARALYDRAFT_490109 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51069.1| hypothetical protein ARALYDRAFT_490109 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQHFD D+SG+IT+DEL+ AM E+GMGDEA  K+II EVD +NDG+I+Y E
Sbjct  416  ERDEHLHKAFQHFDKDNSGYITKDELEIAMKEHGMGDEANAKEIISEVDKNNDGKIDYEE  475

Query  412  FCAMMRSGT-QPQQKLF*V  359
            FC MMR+G  QPQ KL  V
Sbjct  476  FCTMMRNGNLQPQGKLLGV  494



>gb|AAQ17506.1| calcium dependent protein kinase 3 [Oryza sativa Japonica Group]
Length=527

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFITRDEL+SA++E+ MGD +TIKDII EVDTDNDGRINY E
Sbjct  457  ERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEE  516

Query  412  FCAMM  398
            FCAMM
Sbjct  517  FCAMM  521



>emb|CAD70165.1| calcium-dependent protein kinase [Landoltia punctata]
Length=548

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+EHL  AF +FD D+SG+ITRDELK A+ E+GMGD  +I++II EVDTDNDGRINY E
Sbjct  474  EREEHLYSAFSYFDKDNSGYITRDELKQALEEHGMGDADSIREIISEVDTDNDGRINYDE  533

Query  412  FCAMMRSGTQP  380
            FCAMMRSGT P
Sbjct  534  FCAMMRSGTHP  544



>ref|XP_010466227.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466228.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466229.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
Length=542

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  465  ESNENLYKAFQHFDKDSSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  524

Query  412  FCAMMRSGTQPQQK  371
            FCAMMRSG   QQ+
Sbjct  525  FCAMMRSGNPQQQQ  538



>ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
 gb|ESQ47838.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
Length=537

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL+ A+ EYGMGD+ TIK+++ +VD+DNDGRINY E
Sbjct  462  ESNENLYKAFQHFDKDSSGYITIDELEVALKEYGMGDDETIKEVLSDVDSDNDGRINYEE  521

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q KLF
Sbjct  522  FCAMMRSGNPQQPKLF  537



>ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
 gb|EOA36868.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
Length=520

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL++A+ EYG+GD+ATIK+I+ +VD+DNDG+INY E
Sbjct  445  ESNENLYKAFQHFDKDGSGYITIDELEAALKEYGIGDDATIKEILSDVDSDNDGKINYEE  504

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  505  FCAMMRSGNPQQPRLF  520



>ref|XP_002874812.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51071.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            +RDEH+ KAFQHFD D++G ITR EL+S M EYGMGDEA+IK++I EVDTDNDG+IN+ E
Sbjct  456  DRDEHVHKAFQHFDKDNNGHITRAELESVMKEYGMGDEASIKEVISEVDTDNDGKINFEE  515

Query  412  FCAMMRSG-TQPQQKLF  365
            F AMMR G TQP+ K+F
Sbjct  516  FRAMMRCGTTQPKGKMF  532



>gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum crystallinum]
Length=534

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SGFIT DEL++AM EYG+ DE  I +I+ EVDTDNDGRINY E
Sbjct  458  ERDEHLYKAFQYFDKDNSGFITTDELETAMKEYGIADENCIAEILLEVDTDNDGRINYDE  517

Query  412  FCAMMRSGTQ-PQQKLF  365
            F AMMRSGTQ P  KL 
Sbjct  518  FSAMMRSGTQNPVTKLI  534



>ref|NP_001234582.1| calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
 gb|AAK52801.1|AF363784_1 calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
Length=521

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L  AFQ+FD D SGFITRDEL++AM E+G+GD + I++II EVDTDNDGRINY E
Sbjct  446  ERDENLYTAFQYFDKDSSGFITRDELEAAMEEHGIGDPSCIREIISEVDTDNDGRINYEE  505

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRSG +   K+F
Sbjct  506  FCTMMRSGAKQPGKVF  521



>ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
 gb|EOA30276.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
Length=540

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  463  ESNENLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  522

Query  412  FCAMMRSGTQPQQK  371
            FCAMMRSG   QQ+
Sbjct  523  FCAMMRSGNPQQQQ  536



>gb|AFY10519.1| calcium dependent protein kinase 1 [Dendrobium catenatum]
Length=525

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L  AFQ+FD D+SGFITRDEL++AM E+G+GD ATIK+II EVDTDNDGRINY E
Sbjct  450  EREENLYGAFQYFDKDNSGFITRDELETAMEEHGVGDAATIKEIILEVDTDNDGRINYEE  509

Query  412  FCAMMRSG-TQPQQ  374
            FCAMMRSG  QP +
Sbjct  510  FCAMMRSGLPQPAR  523



>ref|XP_010675716.1| PREDICTED: calcium-dependent protein kinase 33-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+ L KAFQ+FD D+SGFIT DEL++AM EYG+ DE  IKDI+ EVDTDNDGRIN+ E
Sbjct  460  ERDDQLYKAFQYFDKDNSGFITTDELEAAMREYGIADENCIKDILMEVDTDNDGRINFEE  519

Query  412  FCAMMRSGTQ-PQQKLF  365
            F AMMRSGTQ P  KLF
Sbjct  520  FVAMMRSGTQNPGAKLF  536



>gb|KFK35914.1| hypothetical protein AALP_AA4G052700 [Arabis alpina]
Length=512

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL++A+ EYGMGD+ TIK+I+ +VD DNDGRINY E
Sbjct  437  ESNENLDKAFQHFDKDGSGYITIDELEAALKEYGMGDDTTIKEILSDVDADNDGRINYEE  496

Query  412  FCAMMRSGTQPQQKLF  365
            FCAMMRSG   Q +LF
Sbjct  497  FCAMMRSGNPQQPRLF  512



>ref|NP_177731.2| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
 gb|AAM13021.1| calcium-dependent protein kinase, putative [Arabidopsis thaliana]
 gb|AAN15720.1| calcium-dependent protein kinase, putative [Arabidopsis thaliana]
 gb|AEE35788.1| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
Length=323

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF++FD D SGFITRDELK +M EYGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  246  EKEENLIEAFKYFDKDRSGFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRINYEE  305

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  306  FVAMMRKGT  314



>gb|KJB81727.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=536

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE L KAFQHFD D+SG ITRDEL++AM EYGMGD+ TIK+II EVDTDNDG+INY E
Sbjct  462  ERDEDLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEE  521

Query  412  FCAMMRSGTQ  383
            F  MMRSGTQ
Sbjct  522  FRDMMRSGTQ  531



>gb|KHG17079.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=536

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE L KAFQHFD D+SG ITRDEL++AM EYGMGD+ TIK+II EVDTDNDG+INY E
Sbjct  462  ERDEDLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEE  521

Query  412  FCAMMRSGTQ  383
            F  MMRSGTQ
Sbjct  522  FRDMMRSGTQ  531



>ref|XP_010100127.1| Calcium-dependent protein kinase 29 [Morus notabilis]
 gb|EXB81510.1| Calcium-dependent protein kinase 29 [Morus notabilis]
Length=526

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L KAFQ+FD D SGFITR+EL+ AM ++GMGDEATI +II++VDTD DGRINY E
Sbjct  453  ERDENLFKAFQYFDKDGSGFITREELRQAMTQHGMGDEATIDEIINDVDTDKDGRINYEE  512

Query  412  FCAMMRSGTQ  383
            F AMMR GTQ
Sbjct  513  FVAMMRKGTQ  522



>ref|XP_010508871.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
 ref|XP_010508878.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
Length=541

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E +E+L KAFQHFD D SG+IT DEL++A+ EYGMGD+ATIK+++ +VD+DNDGRIN+ E
Sbjct  464  ESNENLYKAFQHFDKDSSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINHEE  523

Query  412  FCAMMRSGTQPQQK  371
            FCAMMRSG   QQ+
Sbjct  524  FCAMMRSGNPQQQQ  537



>ref|XP_007146477.1| hypothetical protein PHAVU_006G0437000g, partial [Phaseolus vulgaris]
 gb|ESW18471.1| hypothetical protein PHAVU_006G0437000g, partial [Phaseolus vulgaris]
Length=459

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 8/83 (10%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKD-------IIDEVDTDND  434
            ERD+ L KAFQ+FD D+SG+ITRDEL+SAM EYGMGD+ATIK+       II EVDTD+D
Sbjct  378  ERDDQLFKAFQYFDKDNSGYITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHD  437

Query  433  GRINYSEFCAMMRSGTQPQQKLF  365
            GRINY EF AMM+SG Q Q KLF
Sbjct  438  GRINYEEFSAMMKSGNQ-QCKLF  459



>ref|XP_006828852.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
 gb|ERM96268.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
Length=532

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D+SGFITRDEL+ AM +YGMGD+ATIK++I EVDTDNDGRINY E
Sbjct  466  EREENLYKAFQYFDTDNSGFITRDELEIAMKDYGMGDDATIKEVIQEVDTDNDGRINYQE  525

Query  412  FCAMMR  395
            F AMMR
Sbjct  526  FVAMMR  531



>gb|KFK30982.1| hypothetical protein AALP_AA6G053400 [Arabis alpina]
Length=481

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAFQ+FD D+SG IT++EL+ AM E+GMGDEA  K+II EVD DNDG+I+Y E
Sbjct  402  ERDEHLYKAFQYFDKDNSGHITKEELEIAMKEHGMGDEANAKEIISEVDKDNDGKIDYEE  461

Query  412  FCAMMRSGT-QPQQKLF  365
            FCAMMR+G   PQ KL 
Sbjct  462  FCAMMRNGNLHPQGKLL  478



>gb|AIU98507.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=519

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+EHL +AFQ+FD D SGFITR+EL+SAM ++G+GD  TIK+II EVD D+DGRINY E
Sbjct  444  EREEHLYRAFQYFDKDRSGFITREELESAMKQHGVGDADTIKEIISEVDADHDGRINYEE  503

Query  412  FCAMMRSGTQPQQKL  368
            FC+MMRSG Q   +L
Sbjct  504  FCSMMRSGMQQPVQL  518



>ref|NP_001275371.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|AAL09044.3|AF418563_1 calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|ADK10908.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=515

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDE+L  AFQ+FD D SGFITRDEL++AM E+G+GD + I++II EVDTDNDGRINY E
Sbjct  446  ERDENLYTAFQYFDKDGSGFITRDELEAAMQEHGIGDPSCIREIISEVDTDNDGRINYEE  505

Query  412  FCAMMRSGTQ  383
            FC MMRSG +
Sbjct  506  FCTMMRSGAK  515



>emb|CDX94570.1| BnaC09g22660D [Brassica napus]
Length=742

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERDEHL KAF HFD D+SG+IT+DEL  AM E+GMGDEA +K+II EVD DNDGRINY E
Sbjct  390  ERDEHLHKAFLHFDKDNSGYITKDELDIAMKEHGMGDEACVKEIISEVDKDNDGRINYEE  449

Query  412  FCAMMRSGTQPQQK  371
            FCAMMRS    Q K
Sbjct  450  FCAMMRSDHVSQLK  463



>ref|XP_010536433.1| PREDICTED: calcium-dependent protein kinase 29 [Tarenaya hassleriana]
Length=535

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+LI+AF  FD D SGFITRDELK AM +YGMGD+ATI ++ID+VDTD DGRINY E
Sbjct  459  EREENLIQAFHFFDKDGSGFITRDELKHAMTDYGMGDDATIDEVIDDVDTDKDGRINYEE  518

Query  412  FCAMMRSG-TQPQQKL  368
            F AMMR G T+P+ KL
Sbjct  519  FVAMMRKGTTEPEGKL  534



>ref|XP_010057925.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW75311.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=546

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ERD+HL KAFQ+FD D SG+IT+DEL++AM E+ +GDEA IK+II EVD DNDGRI+Y E
Sbjct  471  ERDDHLHKAFQYFDKDGSGYITKDELEAAMKEHAIGDEANIKEIIAEVDKDNDGRIDYDE  530

Query  412  FCAMMRSGTQPQQKLF  365
            FC MMRS +Q  +KLF
Sbjct  531  FCTMMRSKSQHPEKLF  546



>ref|XP_009135689.1| PREDICTED: calcium-dependent protein kinase 9 [Brassica rapa]
Length=542

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DE+L KAFQHFD D SG+IT DEL+ A+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  461  ESDENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  520

Query  412  FCAMMRSG  389
            FCAMMRSG
Sbjct  521  FCAMMRSG  528



>emb|CDX82244.1| BnaA03g35770D [Brassica napus]
Length=534

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DE+L KAFQHFD D SG+IT DEL+ A+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  453  ESDENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  512

Query  412  FCAMMRSG  389
            FCAMMRSG
Sbjct  513  FCAMMRSG  520



>ref|XP_008221211.1| PREDICTED: calcium-dependent protein kinase 29 [Prunus mume]
Length=534

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ FD D SGFITRDEL+ AM +YGMGD+ATI +IID+VDTD DGRINY E
Sbjct  458  EKEENLFKAFQFFDKDQSGFITRDELRQAMTQYGMGDDATIDEIIDDVDTDKDGRINYEE  517

Query  412  FCAMMRSGTQ  383
            F AMMR G Q
Sbjct  518  FAAMMRQGVQ  527



>gb|AGG35978.1| calcium-dependent protein kinase 9, partial [Brassica napus]
Length=539

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DE+L KAFQHFD D SG+IT DEL+ A+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  459  ESDENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  518

Query  412  FCAMMRSG  389
            FCAMMRSG
Sbjct  519  FCAMMRSG  526



>emb|CDY36037.1| BnaC03g41610D [Brassica napus]
Length=531

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E DE+L KAFQHFD D SG+IT DEL+ A+ EYGMGD+ATIK+++ +VD+DNDGRINY E
Sbjct  451  ESDENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEE  510

Query  412  FCAMMRSG  389
            FCAMMRSG
Sbjct  511  FCAMMRSG  518



>ref|XP_006287505.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
 gb|EOA20403.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
Length=524

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = -3

Query  589  RDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEF  410
            RDE + KAFQHFD D++G+ITRDEL+ AM EYGMGDEA+ K+II  VDTDNDGRIN+ EF
Sbjct  452  RDEQVYKAFQHFDKDNNGYITRDELECAMTEYGMGDEASGKEIISGVDTDNDGRINFEEF  511

Query  409  CAMMRSG-TQPQQ  374
             A+MRSG TQPQ+
Sbjct  512  RAIMRSGTTQPQR  524



>ref|NP_192383.1| calcium-dependent protein kinase 23 [Arabidopsis thaliana]
 sp|Q9M101.1|CDPKN_ARATH RecName: Full=Calcium-dependent protein kinase 23 [Arabidopsis 
thaliana]
 emb|CAB80839.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
 gb|AAL24305.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10119.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82418.1| calcium-dependent protein kinase 23 [Arabidopsis thaliana]
Length=520

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -3

Query  586  DEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEFC  407
            DEH+ KAFQH D D +G ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDG+IN+ EF 
Sbjct  443  DEHVHKAFQHLDKDKNGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEEFR  502

Query  406  AMMRSG-TQPQQKLF  365
            AMMR G TQP+ K +
Sbjct  503  AMMRCGTTQPKGKQY  517



>ref|XP_009406510.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+EHL +AFQ+FD D SGFITR+EL+SAM ++G+GD  TIK+II EVD D+DGRINY E
Sbjct  444  EREEHLYRAFQYFDKDRSGFITREELESAMKQHGVGDADTIKEIISEVDADHDGRINYEE  503

Query  412  FCAMMRSGTQ  383
            FC+MMRSG Q
Sbjct  504  FCSMMRSGMQ  513



>sp|Q8RWL2.2|CDPKT_ARATH RecName: Full=Calcium-dependent protein kinase 29 [Arabidopsis 
thaliana]
Length=534

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF++FD D SGFITRDELK +M EYGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  457  EKEENLIEAFKYFDKDRSGFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRINYEE  516

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  517  FVAMMRKGT  525



>ref|XP_006391947.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
 gb|ESQ29233.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
Length=553

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  595  AERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYS  416
             ER+E+L KAFQHFD D+SGFITR EL++AM EY MGD+A IK+II EVD DNDG INY 
Sbjct  473  VEREENLFKAFQHFDKDNSGFITRQELETAMKEYNMGDDAMIKEIILEVDADNDGSINYQ  532

Query  415  EFCAMMRSGTQPQQ  374
            EFC MM+S +Q +Q
Sbjct  533  EFCNMMKSCSQSRQ  546



>ref|NP_974150.2| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
 gb|AEE35787.1| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
Length=561

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF++FD D SGFITRDELK +M EYGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  484  EKEENLIEAFKYFDKDRSGFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRINYEE  543

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  544  FVAMMRKGT  552



>gb|KDP36877.1| hypothetical protein JCGZ_08168 [Jatropha curcas]
Length=519

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL +AFQ+FD D+SGFITRDEL+ AM +YGMGDEATI +IID+VDT+ DG INY E
Sbjct  448  EKEEHLYRAFQYFDKDNSGFITRDELREAMAQYGMGDEATIDEIIDDVDTNKDGLINYEE  507

Query  412  FCAMMRSGTQ  383
            F  MMR GTQ
Sbjct  508  FVEMMRKGTQ  517



>ref|XP_007017899.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
 gb|EOY15124.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
Length=516

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER++++ KAFQ FD D+SGFITRDEL+ AM EYGMGDEATI ++I++VDTD DGRINY E
Sbjct  443  EREDNIYKAFQFFDKDNSGFITRDELRQAMTEYGMGDEATIDEVIEDVDTDKDGRINYEE  502

Query  412  FCAMMRSGTQ  383
            F AMM+ GTQ
Sbjct  503  FVAMMKRGTQ  512



>gb|AGJ83805.1| calcium-dependent protein kinase 1a [Vitis amurensis]
Length=523

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ FD D SGFITR+ELK AM +YGMGDEATI ++ID+VDTD DGRINY E
Sbjct  447  EKEENLFKAFQFFDKDSSGFITREELKQAMTQYGMGDEATIDEVIDDVDTDKDGRINYEE  506

Query  412  FCAMMRSGTQ  383
            F AMM+ G Q
Sbjct  507  FVAMMKKGPQ  516



>ref|XP_007222396.1| hypothetical protein PRUPE_ppa004027mg [Prunus persica]
 gb|EMJ23595.1| hypothetical protein PRUPE_ppa004027mg [Prunus persica]
Length=534

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ FD D SGFITRDEL+ AM +YGMGD+ATI +IID+VDTD DGRINY E
Sbjct  458  EKEENLYKAFQFFDKDQSGFITRDELRQAMTQYGMGDDATIDEIIDDVDTDKDGRINYEE  517

Query  412  FCAMMRSGTQ  383
            F AMMR G Q
Sbjct  518  FVAMMRQGVQ  527



>gb|KJB63479.1| hypothetical protein B456_010G001300 [Gossypium raimondii]
Length=526

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+++KAFQ FD D+SGFITRDEL+ AM +YGMGDEATI ++I++VDTD DGRINY E
Sbjct  445  EREENIVKAFQFFDKDNSGFITRDELRQAMTQYGMGDEATIDEVIEDVDTDKDGRINYEE  504

Query  412  FCAMMRSGT  386
            F AMM+ GT
Sbjct  505  FVAMMKRGT  513



>emb|CAN67210.1| hypothetical protein VITISV_026712 [Vitis vinifera]
Length=548

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ FD D SGFITR+ELK AM +YGMGDEATI ++ID+VDTD DGRINY E
Sbjct  447  EKEENLFKAFQFFDKDSSGFITREELKQAMTQYGMGDEATIDEVIDDVDTDKDGRINYEE  506

Query  412  FCAMMRSGTQ  383
            F AMM+ G Q
Sbjct  507  FVAMMKKGPQ  516



>ref|XP_002284750.2| PREDICTED: calcium-dependent protein kinase 29 [Vitis vinifera]
 emb|CBI18922.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ FD D SGFITR+ELK AM +YGMGDEATI ++ID+VDTD DGRINY E
Sbjct  447  EKEENLFKAFQFFDKDGSGFITREELKQAMTQYGMGDEATIDEVIDDVDTDKDGRINYEE  506

Query  412  FCAMMRSGTQ  383
            F AMM+ G Q
Sbjct  507  FVAMMKKGPQ  516



>ref|XP_010471751.1| PREDICTED: calcium-dependent protein kinase 29-like [Camelina 
sativa]
Length=560

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF+ FD D SGFITRDELK +M +YGMGD+ATI ++ID+VDTDNDGRINY E
Sbjct  483  EKEENLIEAFKFFDKDRSGFITRDELKHSMTQYGMGDDATIDEVIDDVDTDNDGRINYEE  542

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  543  FVAMMRKGT  551



>ref|XP_010428653.1| PREDICTED: calcium-dependent protein kinase 29 isoform X2 [Camelina 
sativa]
Length=563

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF+ FD D SGFITRDELK +M +YGMGD+ATI ++ID+VDTDNDGRINY E
Sbjct  486  EKEENLIEAFKFFDKDRSGFITRDELKHSMTQYGMGDDATIDEVIDDVDTDNDGRINYEE  545

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  546  FVAMMRKGT  554



>ref|XP_010428651.1| PREDICTED: calcium-dependent protein kinase 29 isoform X1 [Camelina 
sativa]
 ref|XP_010428652.1| PREDICTED: calcium-dependent protein kinase 29 isoform X1 [Camelina 
sativa]
Length=533

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF+ FD D SGFITRDELK +M +YGMGD+ATI ++ID+VDTDNDGRINY E
Sbjct  456  EKEENLIEAFKFFDKDRSGFITRDELKHSMTQYGMGDDATIDEVIDDVDTDNDGRINYEE  515

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  516  FVAMMRKGT  524



>ref|XP_010416511.1| PREDICTED: calcium-dependent protein kinase 29-like [Camelina 
sativa]
Length=560

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF+ FD D SGFITRDELK +M +YGMGD+ATI ++ID+VDTDNDGRINY E
Sbjct  483  EKEENLIEAFKFFDKDRSGFITRDELKHSMTQYGMGDDATIDEVIDDVDTDNDGRINYEE  542

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  543  FVAMMRKGT  551



>gb|AAD03455.1| contains similarity to eukaryotic protein kinase domains (Pfam: 
PF00069, score=253.1, E=3.8e-72, N=1) and EF hand domains 
(Pfam: PF00036, score=94.6, E=2e-24 , N=4) [Arabidopsis thaliana]
Length=584

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -3

Query  586  DEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEFC  407
            DEH+ KAFQH D D +G ITRDEL+SAM EYGMGDEA+IK++I EVDTDNDG+IN+ EF 
Sbjct  471  DEHVHKAFQHLDKDKNGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEEFR  530

Query  406  AMMRSG-TQPQQK  371
            AMMR G TQP+ K
Sbjct  531  AMMRCGTTQPKGK  543



>ref|XP_010266896.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Nelumbo nucifera]
Length=530

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL KAF+HFD D SGFIT+DELK A+ EYGMGDE+TI +II++VDTD DG+INY E
Sbjct  446  EKEEHLYKAFEHFDKDGSGFITKDELKQALTEYGMGDESTIDEIINDVDTDKDGKINYDE  505

Query  412  FCAMMRSGT  386
            F AMMR G+
Sbjct  506  FAAMMRKGS  514



>gb|AES59823.2| calcium-dependent kinase [Medicago truncatula]
Length=533

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D+SG++TR+EL+ A+ EY MGDEATI ++ID+VDTDNDGRINY E
Sbjct  455  EREENLFKAFQYFDKDNSGYVTREELRQALAEYQMGDEATIDEVIDDVDTDNDGRINYQE  514

Query  412  FCAMMRSGT  386
            F  MMR GT
Sbjct  515  FATMMRKGT  523



>ref|XP_004164365.1| PREDICTED: calcium-dependent protein kinase 3-like [Cucumis sativus]
Length=304

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  595  AERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYS  416
             ER++HL KAF++FD D SG+IT +EL++A+ +Y MGDE TIK+II EVDTDNDGRINY 
Sbjct  225  VEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYD  284

Query  415  EFCAMMRSGTQ  383
            EF AMMR G Q
Sbjct  285  EFVAMMRKGNQ  295



>emb|CDP07348.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E+++HL KAFQHFD D SGFITRDEL+ AM +YGMGDEATI +II++VD D DGRINY E
Sbjct  457  EKEDHLFKAFQHFDEDGSGFITRDELRHAMAKYGMGDEATIDEIINDVDIDKDGRINYEE  516

Query  412  FCAMMRSGT  386
            F  MMR GT
Sbjct  517  FVTMMRKGT  525



>gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=522

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  586  DEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSEFC  407
            +E+L KAFQ+FD D SGFITRDEL++AM E+G+GD A+I++I+ +VD DNDGRINY EFC
Sbjct  449  EENLYKAFQYFDKDSSGFITRDELETAMEEHGIGDAASIREIMSDVDADNDGRINYEEFC  508

Query  406  AMMRSGTQPQQKLF  365
             MMRSG +   KLF
Sbjct  509  TMMRSGAKQPGKLF  522



>ref|XP_010266895.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X1 
[Nelumbo nucifera]
Length=538

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL KAF+HFD D SGFIT+DELK A+ EYGMGDE+TI +II++VDTD DG+INY E
Sbjct  454  EKEEHLYKAFEHFDKDGSGFITKDELKQALTEYGMGDESTIDEIINDVDTDKDGKINYDE  513

Query  412  FCAMMRSGT  386
            F AMMR G+
Sbjct  514  FAAMMRKGS  522



>ref|XP_007017897.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
 gb|EOY15122.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
Length=527

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER++++ KAFQ FD D+SGFITRDEL+ AM EYGMGDEATI ++I++VD D DGRINY E
Sbjct  451  EREDNIYKAFQFFDKDNSGFITRDELRHAMTEYGMGDEATIDEVIEDVDIDKDGRINYEE  510

Query  412  FCAMMRSGTQ  383
            F AMMR GTQ
Sbjct  511  FVAMMRRGTQ  520



>ref|XP_011083439.1| PREDICTED: calcium-dependent protein kinase 29 [Sesamum indicum]
Length=524

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ+FD D+SG+ITRDEL+ AM +YGMGDEATI +++D+VDTD DGRINY E
Sbjct  445  EKEENLYKAFQYFDKDNSGYITRDELRHAMQQYGMGDEATIDEVLDDVDTDKDGRINYEE  504

Query  412  FCAMMRSGT  386
            F AMM+ GT
Sbjct  505  FAAMMKKGT  513



>ref|XP_008800033.1| PREDICTED: calcium-dependent protein kinase 29 [Phoenix dactylifera]
Length=514

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E+DE L+KAFQ+FD D SG+ITRDEL+ A+ +YGMGDEATI +II++VD DNDGRINY E
Sbjct  444  EKDEDLLKAFQYFDTDGSGYITRDELRQALSQYGMGDEATITEIIEDVDIDNDGRINYEE  503

Query  412  FCAMMRSG  389
            F AMMR G
Sbjct  504  FVAMMRRG  511



>ref|XP_004499307.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
29-like [Cicer arietinum]
Length=764

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D+SG++TR+EL+ A+ EY MGDEATI ++ID+VDTDNDGRINY E
Sbjct  686  EREENLFKAFQYFDKDNSGYVTREELRQALAEYQMGDEATIDEVIDDVDTDNDGRINYQE  745

Query  412  FCAMMRSGT  386
            F AMM+ GT
Sbjct  746  FVAMMKKGT  754



>ref|XP_006302092.1| hypothetical protein CARUB_v10020082mg [Capsella rubella]
 gb|EOA34990.1| hypothetical protein CARUB_v10020082mg [Capsella rubella]
Length=556

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+LI+AF+ FD D SG+ITRDELK +M +YGMGD+ATI ++ID+VDTDNDGRINY E
Sbjct  479  EKEENLIEAFKFFDKDRSGYITRDELKHSMTQYGMGDDATIDEVIDDVDTDNDGRINYEE  538

Query  412  FCAMMRSGT  386
            F AMMR GT
Sbjct  539  FVAMMRKGT  547



>ref|XP_006390245.1| hypothetical protein EUTSA_v10018359mg [Eutrema salsugineum]
 gb|ESQ27531.1| hypothetical protein EUTSA_v10018359mg [Eutrema salsugineum]
Length=555

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHLI+AF+ FD D SGFITRDELK +M +YGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  478  EKEEHLIEAFKFFDKDRSGFITRDELKHSMTQYGMGDDATIDEVINDVDTDNDGRINYEE  537

Query  412  FCAMMRSGT  386
            F AMM  GT
Sbjct  538  FVAMMTKGT  546



>ref|XP_003589572.1| Calcium-dependent protein kinase [Medicago truncatula]
Length=901

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER+E+L KAFQ+FD D+SG++TR+EL+ A+ EY MGDEATI ++ID+VDTDNDGRINY E
Sbjct  823  EREENLFKAFQYFDKDNSGYVTREELRQALAEYQMGDEATIDEVIDDVDTDNDGRINYQE  882

Query  412  FCAMMRSGT  386
            F  MMR GT
Sbjct  883  FATMMRKGT  891



>ref|XP_003545013.1| PREDICTED: calcium-dependent protein kinase 29-like isoformX1 
[Glycine max]
Length=526

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ+FD D SG+ITRDEL+ A+ EY MGDEATI ++ID+VDTDNDG+INY E
Sbjct  448  EKEENLFKAFQYFDKDSSGYITRDELRQALTEYQMGDEATIDEVIDDVDTDNDGKINYQE  507

Query  412  FCAMMRSG  389
            F AMMR G
Sbjct  508  FVAMMRKG  515



>ref|XP_006596531.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Glycine max]
 gb|KHN39399.1| Calcium-dependent protein kinase 29 [Glycine soja]
Length=537

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E+L KAFQ+FD D SG+ITRDEL+ A+ EY MGDEATI ++ID+VDTDNDG+INY E
Sbjct  459  EKEENLFKAFQYFDKDSSGYITRDELRQALTEYQMGDEATIDEVIDDVDTDNDGKINYQE  518

Query  412  FCAMMRSG  389
            F AMMR G
Sbjct  519  FVAMMRKG  526



>ref|XP_006301218.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
 gb|EOA34116.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
Length=547

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  595  AERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYS  416
             ER+E+L KAFQHFD D+SGFI+R EL++AM EY MGD+A IK+II EVD DNDG INY 
Sbjct  467  VEREENLFKAFQHFDKDNSGFISRLELETAMKEYNMGDDAMIKEIISEVDADNDGSINYQ  526

Query  415  EFCAMMRSGTQ  383
            EFC MM+S +Q
Sbjct  527  EFCNMMKSCSQ  537



>ref|XP_002888057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64316.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  595  AERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYS  416
             ER+E+L KAFQHFD D+SGFI+R EL++AM EY MGD+  IK+II EVD DNDG INY 
Sbjct  473  VEREENLFKAFQHFDKDNSGFISRQELETAMKEYNMGDDTMIKEIISEVDADNDGSINYQ  532

Query  415  EFCAMMRSGTQPQQ  374
            EFC MMRS ++  Q
Sbjct  533  EFCNMMRSCSKSHQ  546



>ref|XP_003611046.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AES94004.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=517

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            ER++HL KAF++FD D SG+IT++EL+SA+ +Y MGDE TIK+IIDEVD+DNDGRINY E
Sbjct  439  EREDHLYKAFEYFDNDKSGYITKEELESALTKYNMGDEKTIKEIIDEVDSDNDGRINYEE  498

Query  412  FCAMMRSG  389
            F AMMR G
Sbjct  499  FVAMMRKG  506



>ref|NP_001053548.1| Os04g0560600 [Oryza sativa Japonica Group]
 emb|CAE01846.2| OSJNBa0084K11.9 [Oryza sativa Japonica Group]
 dbj|BAF15462.1| Os04g0560600 [Oryza sativa Japonica Group]
 emb|CAH68059.1| B0103C08-B0602B01.16 [Oryza sativa Indica Group]
 gb|EAY95152.1| hypothetical protein OsI_16970 [Oryza sativa Indica Group]
 gb|EAZ31624.1| hypothetical protein OsJ_15768 [Oryza sativa Japonica Group]
Length=533

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++E L++AFQHFD D+SG+ITRDEL+ AM EYGMGDEA IK ++DEVD D DGRI+Y E
Sbjct  463  EKEEDLLRAFQHFDKDNSGYITRDELEQAMAEYGMGDEANIKQVLDEVDKDKDGRIDYEE  522

Query  412  FCAMMRSGTQ  383
            F  MMR G Q
Sbjct  523  FVEMMRKGIQ  532



>gb|AGG35971.1| calcium-dependent protein kinase 29 [Brassica napus]
Length=538

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL++AF++FD D SG+ITRDELK +M +YGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  460  EKEEHLLEAFKYFDKDRSGYITRDELKHSMTQYGMGDDATIDEVINDVDTDNDGRINYEE  519

Query  412  FCAMMRSGT  386
            F AMM  GT
Sbjct  520  FVAMMTKGT  528



>gb|KFK42039.1| hypothetical protein AALP_AA2G204000 [Arabis alpina]
Length=525

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL++AF+ FD D SGFITRDELK +M +YGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  447  EKEEHLLEAFKFFDKDRSGFITRDELKHSMTQYGMGDDATIDEVINDVDTDNDGRINYEE  506

Query  412  FCAMMRSGT  386
            F AMM  GT
Sbjct  507  FVAMMTKGT  515



>emb|CDX73219.1| BnaC06g36670D [Brassica napus]
Length=552

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL++AF++FD D SG+ITRDELK +M +YGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  474  EKEEHLLEAFKYFDKDRSGYITRDELKHSMTQYGMGDDATIDEVINDVDTDNDGRINYEE  533

Query  412  FCAMMRSGT  386
            F AMM  GT
Sbjct  534  FVAMMTKGT  542



>ref|XP_009106253.1| PREDICTED: calcium-dependent protein kinase 29 [Brassica rapa]
 emb|CDY66815.1| BnaCnng52460D [Brassica napus]
Length=552

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  592  ERDEHLIKAFQHFDADHSGFITRDELKSAMMEYGMGDEATIKDIIDEVDTDNDGRINYSE  413
            E++EHL++AF++FD D SG+ITRDELK +M +YGMGD+ATI ++I++VDTDNDGRINY E
Sbjct  474  EKEEHLLEAFKYFDKDRSGYITRDELKHSMTQYGMGDDATIDEVINDVDTDNDGRINYEE  533

Query  412  FCAMMRSGT  386
            F AMM  GT
Sbjct  534  FVAMMTKGT  542



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370