BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051C06

Length=473
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    166   1e-45   Sesamum indicum [beniseed]
gb|AGM38074.1|  putative phosphoethanolamine N-methyltransferase        155   5e-45   Stenocereus gummosus
gb|AAG52075.1|AC012679_13  putative S-adenosyl-methionine-sterol-...    160   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    164   1e-44   Sesamum indicum [beniseed]
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    164   1e-44   Sesamum indicum [beniseed]
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    162   7e-44   Fragaria vesca subsp. vesca
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    161   8e-44   Ricinus communis
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       160   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    160   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    160   2e-43   Arabidopsis thaliana [mouse-ear cress]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    161   2e-43
ref|XP_002887491.1|  predicted protein                                  160   3e-43   
ref|XP_006376720.1|  hypothetical protein POPTR_0012s044901g            157   4e-43   
ref|XP_002317876.2|  hypothetical protein POPTR_0012s044901g            157   4e-43   
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   5e-43   Eucalyptus grandis [rose gum]
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   6e-43   Solanum lycopersicum
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    159   7e-43   Populus euphratica
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   7e-43   
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             159   7e-43   Citrus clementina [clementine]
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 159   8e-43   Salicornia europaea [chicken-claws]
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   1e-42   Nicotiana tomentosiformis
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   1e-42   Nicotiana sylvestris
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   1e-42   Nicotiana sylvestris
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             158   1e-42   Capsella rubella
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                157   2e-42   Suaeda maritima
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             157   2e-42   
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                157   2e-42   Suaeda japonica
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                157   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   3e-42   Solanum tuberosum [potatoes]
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    157   3e-42   Arabis alpina [alpine rockcress]
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          157   3e-42   Amborella trichopoda
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   4e-42   Nicotiana tomentosiformis
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   4e-42   Nicotiana sylvestris
emb|CDY11100.1|  BnaC06g23520D                                          157   4e-42   Brassica napus [oilseed rape]
gb|AFZ78648.1|  methyl transferase                                      157   4e-42   Populus tomentosa [Chinese white poplar]
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                157   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   5e-42   
emb|CDX68222.1|  BnaA07g22620D                                          157   5e-42   
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   5e-42   Brassica rapa
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             156   6e-42   Eutrema salsugineum [saltwater cress]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             156   6e-42   
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   7e-42   Prunus mume [ume]
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    156   8e-42   Populus euphratica
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   8e-42   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98349.1|  unnamed protein product                                156   9e-42   Coffea canephora [robusta coffee]
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    155   1e-41   Tarenaya hassleriana [spider flower]
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 155   1e-41   Suaeda liaotungensis
gb|KJB30118.1|  hypothetical protein B456_005G132000                    153   1e-41   Gossypium raimondii
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    155   1e-41   Populus euphratica
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    155   1e-41   Populus euphratica
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   2e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   2e-41   Nicotiana tomentosiformis
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             155   2e-41   Prunus persica
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            155   2e-41   Solanum lycopersicum
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    154   3e-41   Nelumbo nucifera [Indian lotus]
ref|NP_001056231.2|  Os05g0548900                                       148   3e-41   
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    154   4e-41   Vitis vinifera
emb|CBI26877.3|  unnamed protein product                                154   4e-41   Vitis vinifera
gb|KJB30120.1|  hypothetical protein B456_005G132000                    154   5e-41   Gossypium raimondii
emb|CDX95799.1|  BnaC05g35500D                                          154   5e-41   
emb|CBI26879.3|  unnamed protein product                                153   6e-41   Vitis vinifera
gb|KJB30122.1|  hypothetical protein B456_005G132000                    154   6e-41   Gossypium raimondii
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             153   6e-41   
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    153   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   7e-41   Nelumbo nucifera [Indian lotus]
gb|KJB30117.1|  hypothetical protein B456_005G132000                    153   7e-41   Gossypium raimondii
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    153   7e-41   Arabis alpina [alpine rockcress]
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   8e-41   Cucumis sativus [cucumbers]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   8e-41   Solanum tuberosum [potatoes]
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   8e-41   
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    153   1e-40   Vitis vinifera
ref|XP_002883100.1|  N-methyltransferase 1                              153   1e-40   
gb|AAM13092.1|  unknown protein                                         153   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   1e-40   Vitis vinifera
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             153   1e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        153   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          153   1e-40   
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   1e-40   
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                152   2e-40   Tripolium pannonicum [sea starwort]
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   2e-40   
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    152   2e-40   
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    152   2e-40   Phoenix dactylifera
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    152   2e-40   Phoenix dactylifera
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   3e-40   Brassica rapa
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         152   3e-40   Jatropha curcas
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   3e-40   Cucumis melo [Oriental melon]
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          152   3e-40   Sorghum bicolor [broomcorn]
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    151   3e-40   Gossypium arboreum [tree cotton]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                151   4e-40   Beta vulgaris [beet]
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   4e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   4e-40   Setaria italica
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   4e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    151   5e-40   Arabis alpina [alpine rockcress]
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                151   5e-40   Atriplex nummularia
emb|CDX92181.1|  BnaA05g22260D                                          150   8e-40   
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 150   9e-40   Atriplex canescens [shadscale]
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             150   1e-39   Capsella rubella
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   1e-39   Cucumis melo [Oriental melon]
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    150   1e-39   Vitis vinifera
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 150   1e-39   Brassica napus [oilseed rape]
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 150   2e-39   Lycium barbarum [Duke of Argyll's teatree]
gb|EPS65842.1|  hypothetical protein M569_08933                         149   2e-39   Genlisea aurea
gb|AFW78991.1|  hypothetical protein ZEAMMB73_932976                    147   2e-39   
emb|CAN64744.1|  hypothetical protein VITISV_041321                     149   2e-39   Vitis vinifera
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    149   2e-39   Spinacia oleracea
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   2e-39   
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   2e-39   Elaeis guineensis
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 149   3e-39   Pyrus betulifolia
gb|KJB53040.1|  hypothetical protein B456_008G289900                    149   3e-39   Gossypium raimondii
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   3e-39   Cucumis sativus [cucumbers]
gb|KJB53039.1|  hypothetical protein B456_008G289900                    149   3e-39   Gossypium raimondii
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   4e-39   
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   4e-39   Elaeis guineensis
emb|CDM83854.1|  unnamed protein product                                147   5e-39   Triticum aestivum [Canadian hard winter wheat]
dbj|BAH01482.1|  unnamed protein product                                148   5e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79642.1|  hypothetical protein OsI_20868                          148   6e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          148   7e-39   Sorghum bicolor [broomcorn]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    148   7e-39   Oryza brachyantha
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    148   7e-39   
ref|NP_001169597.1|  uncharacterized LOC100383478                       148   8e-39   Zea mays [maize]
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   9e-39   Solanum tuberosum [potatoes]
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   1e-38   Camelina sativa [gold-of-pleasure]
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               147   1e-38   
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               147   1e-38   
emb|CDM83845.1|  unnamed protein product                                147   2e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    147   2e-38   
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               147   2e-38   
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        147   2e-38   Zea mays [maize]
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               147   2e-38   Triticum urartu
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    147   2e-38   Triticum aestivum [Canadian hard winter wheat]
gb|AGO59019.1|  heat responsive transcription factor protein            146   2e-38   Triticum aestivum [Canadian hard winter wheat]
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   147   2e-38   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    146   3e-38   
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   3e-38   
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             146   3e-38   
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   3e-38   
ref|NP_001043957.1|  Os01g0695100                                       146   4e-38   
gb|EEE55232.1|  hypothetical protein OsJ_03109                          146   4e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    145   6e-38   
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   7e-38   Setaria italica
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    145   8e-38   Solanum lycopersicum
ref|NP_001148925.1|  LOC100282545                                       145   1e-37   Zea mays [maize]
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    144   1e-37   Brachypodium distachyon [annual false brome]
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 144   1e-37   Oryza sativa [red rice]
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 144   1e-37   
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    144   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   2e-37   Setaria italica
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   2e-37   Oryza brachyantha
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          143   3e-37   Sorghum bicolor [broomcorn]
dbj|BAJ97525.1|  predicted protein                                      143   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    143   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             143   5e-37   Selaginella moellendorffii
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    142   8e-37   
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         142   9e-37   Jatropha curcas
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             141   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             141   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             141   2e-36   Capsella rubella
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             141   2e-36   Selaginella moellendorffii
ref|XP_010097563.1|  hypothetical protein L484_017373                   140   3e-36   
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...    138   2e-35   Cucumis sativus [cucumbers]
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    138   2e-35   
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    138   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    137   6e-35   
ref|XP_001763293.1|  predicted protein                                  132   2e-33   
emb|CDX93681.1|  BnaA06g03670D                                          132   3e-33   
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    132   3e-33   Brassica rapa
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             130   2e-32   Eutrema salsugineum [saltwater cress]
gb|KJB53038.1|  hypothetical protein B456_008G289900                    129   3e-32   Gossypium raimondii
emb|CDY40594.1|  BnaC06g02100D                                          128   6e-32   Brassica napus [oilseed rape]
gb|AAF79705.1|AC020889_13  T1N15.23                                     127   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             125   6e-31   
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             125   1e-30   Phaseolus vulgaris [French bean]
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 124   1e-30   Gossypium hirsutum [American cotton]
gb|ABK93894.1|  unknown                                                 115   8e-30   Populus trichocarpa [western balsam poplar]
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 122   9e-30   Glycine soja [wild soybean]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    122   1e-29   
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    120   6e-29   
ref|XP_001768934.1|  predicted protein                                  119   1e-28   
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    118   2e-28   Coccomyxa subellipsoidea C-169
gb|KIZ00504.1|  hypothetical protein MNEG_7455                          111   6e-28   Monoraphidium neglectum
gb|AFK34318.1|  unknown                                                 111   4e-27   Lotus japonicus
emb|CAN75113.1|  hypothetical protein VITISV_043577                     112   2e-26   Vitis vinifera
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   3e-26   Crassostrea gigas
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   3e-26   Crassostrea gigas
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   4e-26   Crassostrea gigas
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   1e-25   
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   1e-25   Cicer arietinum [garbanzo]
gb|AFK45429.1|  unknown                                                 109   1e-25   Medicago truncatula
gb|ABK24808.1|  unknown                                                 110   2e-25   Picea sitchensis
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   3e-25   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            109   4e-25   
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 109   4e-25   Medicago truncatula
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   109   5e-25   Citrus sinensis [apfelsine]
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   6e-25   
gb|KJB30123.1|  hypothetical protein B456_005G132000                    108   1e-24   Gossypium raimondii
ref|XP_003619840.1|  Phosphoethanolamine N-methyltransferase            107   1e-24   
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   1e-24   
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   1e-24   Oreochromis niloticus
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   1e-24   Oreochromis niloticus
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   1e-24   
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   1e-24   Oreochromis niloticus
gb|KHN00145.1|  Phosphoethanolamine N-methyltransferase                 108   2e-24   Glycine soja [wild soybean]
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   2e-24   Pundamilia nyererei
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            108   2e-24   Medicago truncatula
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   2e-24   
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   2e-24   Haplochromis burtoni
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   2e-24   Poecilia formosa
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    108   2e-24   Pundamilia nyererei
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   2e-24   Haplochromis burtoni
gb|ACF23047.1|  ST236                                                   100   2e-24   Eutrema halophilum
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   3e-24   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              107   3e-24   Danio rerio [leopard danio]
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   4e-24   Xiphophorus maculatus
emb|CDX72992.1|  BnaC06g34400D                                          102   5e-24   
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    106   5e-24   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    106   6e-24   Zea mays [maize]
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    106   6e-24   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    106   6e-24   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_009012150.1|  hypothetical protein HELRODRAFT_183893             105   1e-23   Helobdella robusta
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        105   1e-23   Albugo laibachii Nc14
gb|EAY75471.1|  hypothetical protein OsI_03371                          105   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...    105   2e-23   
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            105   2e-23   
gb|AAI35513.1|  LOC100124841 protein                                    104   3e-23   Xenopus tropicalis [western clawed frog]
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              104   3e-23   Xenopus tropicalis [western clawed frog]
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    104   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    104   4e-23   Poecilia reticulata
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    104   4e-23   Poecilia reticulata
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    104   6e-23   
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    103   7e-23   Cicer arietinum [garbanzo]
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    103   7e-23   Cicer arietinum [garbanzo]
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    103   8e-23   Stegastes partitus
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    103   9e-23   Stegastes partitus
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          103   1e-22   Salmo salar
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    102   2e-22   Esox lucius
emb|CCI39434.1|  unnamed protein product                                102   3e-22   Albugo candida
ref|XP_008872791.1|  hypothetical protein H310_08714                    102   3e-22   Aphanomyces invadans
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    102   3e-22   
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    102   3e-22   
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2      100   4e-22   
ref|XP_009832411.1|  hypothetical protein H257_08283                    101   6e-22   Aphanomyces astaci
gb|ETK83142.1|  hypothetical protein L915_11580                       94.7    1e-21   Phytophthora parasitica
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              100   1e-21   Xenopus laevis [clawed frog]
gb|ETL89749.1|  hypothetical protein L917_11367                       94.4    2e-21   Phytophthora parasitica
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                99.0    4e-21   Capitella teleta
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...  98.6    6e-21   Aplysia californica
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...  98.2    6e-21   Aplysia californica
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...  99.0    6e-21   
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790           99.0    7e-21   Branchiostoma floridae
gb|ETP40953.1|  hypothetical protein F442_11791                       95.1    1e-20   Phytophthora parasitica P10297
ref|XP_008620240.1|  hypothetical protein SDRG_15834                  95.9    2e-20   Saprolegnia diclina VS20
gb|KDO18852.1|  hypothetical protein SPRG_15851                       95.5    3e-20   Saprolegnia parasitica CBS 223.65
ref|XP_008620239.1|  hypothetical protein SDRG_15833                  95.1    9e-20   Saprolegnia diclina VS20
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g           94.4    2e-19   Phaseolus vulgaris [French bean]
ref|XP_001634828.1|  predicted protein                                91.3    4e-19   Nematostella vectensis
gb|KDO18851.1|  hypothetical protein SPRG_15850                       93.2    5e-19   Saprolegnia parasitica CBS 223.65
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase          92.8    7e-19   Phytophthora infestans T30-4
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                 92.0    1e-18   Daphnia pulex
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756           91.7    1e-18   Lottia gigantea
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...  91.7    2e-18   Phytophthora infestans T30-4
emb|CBY30945.1|  unnamed protein product                              89.4    2e-18   Oikopleura dioica
emb|CBY12280.1|  unnamed protein product                              89.0    2e-18   Oikopleura dioica
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g           90.9    3e-18   Phaseolus vulgaris [French bean]
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...  89.7    7e-18   
ref|WP_015250142.1|  methyltransferase family protein                 85.9    3e-17   
ref|XP_794381.2|  PREDICTED: phosphoethanolamine N-methyltransfer...  87.4    5e-17   
emb|CAG09731.1|  unnamed protein product                              87.0    6e-17   
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase          85.1    3e-16   
emb|CDY07952.1|  BnaC03g35710D                                        82.4    2e-15   
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase               82.4    3e-15   
ref|XP_005843496.1|  hypothetical protein CHLNCDRAFT_141021           78.2    4e-15   
gb|AGH25525.1|  phosphoethanolamine N-methyltransferase               75.9    6e-15   
ref|WP_027370921.1|  hypothetical protein                             77.8    2e-14   
gb|KFM82339.1|  Phosphoethanolamine N-methyltransferase               76.3    5e-14   
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888           77.0    2e-13   
gb|KJB30119.1|  hypothetical protein B456_005G132000                  75.9    4e-13   
ref|XP_001614208.1|  phosphoethanolamine N-methyltransferase          73.9    4e-13   
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg           75.9    4e-13   
pdb|4MWZ|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...  73.9    5e-13   
pdb|4IV0|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...  73.9    5e-13   
emb|CBY30905.1|  unnamed protein product                              73.9    6e-13   
gb|ETM43020.1|  hypothetical protein L914_11418                       70.5    7e-13   
emb|CDJ58552.1|  Sterol 24-C-methyltransferase, related               73.6    8e-13   
ref|XP_004223586.1|  phosphoethanolamine N-methyltransferase          72.8    1e-12   
gb|EYC15765.1|  hypothetical protein Y032_0036g3344                   74.7    2e-12   
emb|CDY35847.1|  BnaC09g37790D                                        73.6    2e-12   
ref|XP_008815737.1|  phosphoethanolamine N-methyltransferase          71.2    5e-12   
emb|CDJ43178.1|  hypothetical protein, conserved                      71.2    5e-12   
emb|CDX74572.1|  BnaA04g08170D                                        72.4    5e-12   
ref|XP_002259925.1|  phosphoethanolamine N-methyltransferase          70.5    7e-12   
pdb|4IV8|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...  70.5    9e-12   
gb|KJB53041.1|  hypothetical protein B456_008G289900                  71.6    1e-11   
emb|CDJ67597.1|  hypothetical protein, conserved                      69.7    2e-11   
gb|KIH55493.1|  methyltransferase domain protein                      70.5    3e-11   
gb|ETN82894.1|  methyltransferase domain protein                      70.5    3e-11   
gb|EYC15763.1|  hypothetical protein Y032_0036g3344                   68.2    2e-10   
emb|CDI77742.1|  hypothetical protein, conserved                      64.7    9e-10   
emb|CDQ99741.1|  unnamed protein product                              63.2    2e-09   
pdb|4KRH|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...  64.7    3e-09   
pdb|4KRI|A  Chain A, Haemonchus Contortus Phospholethanolamine N-...  64.7    3e-09   
emb|CDJ96940.1|  Methyltransferase type 11 domain containing protein  64.7    3e-09   
gb|ETW47365.1|  hypothetical protein PFMALIP_04544                    62.8    3e-09   
pdb|3UJ6|A  Chain A, Semet Phosphoethanolamine Methyltransferase ...  62.8    4e-09   
ref|XP_006584908.1|  PREDICTED: phosphoethanolamine N-methyltrans...  60.5    5e-09   
pdb|4R6W|A  Chain A, Plasmodium Falciparum Phosphoethanolamine Me...  62.4    6e-09   
pdb|3UJC|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...  62.4    6e-09   
ref|XP_001350151.1|  phosphoethanolamine N-methyltransferase          62.4    6e-09   
pdb|3UJD|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...  62.4    6e-09   
gb|ADV61410.1|  Methyltransferase type 11                             62.0    8e-09   
gb|ETW16777.1|  hypothetical protein PFFVO_04306                      61.6    1e-08   
ref|XP_002433524.1|  hypothetical protein IscW_ISCW024094             58.5    1e-08   
gb|ETO71741.1|  hypothetical protein F444_11962                       57.8    2e-08   
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase               61.6    3e-08   
gb|KHN87001.1|  Phosphoethanolamine N-methyltransferase 1             60.5    3e-08   
emb|CDO66214.1|  phosphoethanolamine N-methyltransferase              60.1    4e-08   
emb|CEF62382.1|  Hypothetical protein SRAE_1000065500                 58.5    3e-07   
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg           57.0    1e-06   
gb|ETO16413.1|  hypothetical protein RFI_20925                        56.2    1e-06   
ref|XP_002635479.1|  C. briggsae CBR-PMT-2 protein                    55.5    3e-06   
ref|WP_030008425.1|  hypothetical protein                             53.1    9e-06   
gb|ADI22186.1|  SAM-dependent methyltransferases                      53.1    1e-05   
emb|CBY31441.1|  unnamed protein product                              53.1    2e-05   
gb|EGT43583.1|  CBN-PMT-2 protein                                     52.4    3e-05   
emb|CBY10458.1|  unnamed protein product                              51.2    1e-04   
ref|NP_504248.1|  Protein PMT-2                                       50.4    2e-04   
ref|XP_003115237.1|  CRE-PMT-2 protein                                50.4    2e-04   
pdb|4INE|A  Chain A, Crystal Structure Of N-methyl Transferase (p...  50.4    2e-04   
gb|KJB30121.1|  hypothetical protein B456_005G132000                  49.3    4e-04   
ref|WP_042734046.1|  hypothetical protein                             47.8    9e-04   



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF+KVL+KEL+AVEKEKEA
Sbjct  393  PSTEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVIAEDRTDQFIKVLEKELNAVEKEKEA  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFSEEDY+DIVGGWK KL R+SSGEQRWGL
Sbjct  453  FIQDFSEEDYSDIVGGWKAKLVRSSSGEQRWGL  485



>gb|AGM38074.1| putative phosphoethanolamine N-methyltransferase, partial [Stenocereus 
gummosus]
Length=111

 Score =   155 bits (391),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EFA YIKQRGYDLHD +EYGQMLRDAGF++VIAEDRTDQF++VL++ELD+VEKEK+AF
Sbjct  14   SPEFAQYIKQRGYDLHDVQEYGQMLRDAGFDEVIAEDRTDQFIRVLQRELDSVEKEKDAF  73

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFS EDYNDIV GWK KL R+++GEQRWGL
Sbjct  74   ISDFSMEDYNDIVDGWKAKLVRSTAGEQRWGL  105



>gb|AAG52075.1|AC012679_13 putative S-adenosyl-methionine-sterol-C-methyltransferase, 5' 
partial; 1-1344 [Arabidopsis thaliana]
Length=295

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  197  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  256

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  257  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  289



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF +VIAEDRT+QF+KVL+KELDAVEK+KE 
Sbjct  393  PSAEFAGYIKQRGYDLHDVDTYGQMLRDAGFAEVIAEDRTEQFIKVLEKELDAVEKDKET  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  453  FIRDFSEEDYNDIVGGWKAKLVRSSSGEQRWGL  485



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF +VIAEDRT+QF+KVL+KELDAVEK+KE 
Sbjct  396  PSAEFAGYIKQRGYDLHDVDTYGQMLRDAGFAEVIAEDRTEQFIKVLEKELDAVEKDKET  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  456  FIRDFSEEDYNDIVGGWKAKLVRSSSGEQRWGL  488



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML DAGF DV+AEDRTDQF++VL++EL+AVEK+KEA
Sbjct  402  PSAEFAEYIKQRGYDLHDVKAYGQMLTDAGFVDVVAEDRTDQFIRVLQRELNAVEKDKEA  461

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDYNDIVGGWK KL RT+SGEQ+WGL
Sbjct  462  FIKDFSEEDYNDIVGGWKAKLVRTNSGEQKWGL  494



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VLK+ELD +EKEK+ 
Sbjct  394  PSSEFAEYIKQRGYDLHDVKAYGQMLKDAGFDDVIAEDRTDQFNQVLKRELDVIEKEKDE  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  454  FIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  486



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  406  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  465

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  498



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  392  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  452  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  484



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  406  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  465

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  498



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VIAEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  457  PSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKEE  516

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  517  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  549



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQMLRDAGFE+V AEDRTDQFMKVLK+ELDAVEKEKE 
Sbjct  392  PSSDFANYIKQRGYDLHDVQAYGQMLRDAGFEEVTAEDRTDQFMKVLKRELDAVEKEKEE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  452  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  484



>ref|XP_006376720.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|ERP54517.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=355

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF +VL +EL A+EKEK+ 
Sbjct  257  PSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVIAEDRTDQFNQVLLRELKAIEKEKDE  316

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  317  FIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  349



>ref|XP_002317876.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|EEE96096.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=356

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF +VL +EL A+EKEK+ 
Sbjct  258  PSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVIAEDRTDQFNQVLLRELKAIEKEKDE  317

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  318  FIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  350



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQMLRDAGF +VIAEDRTDQF+KVL+KEL+AVEK+K+ 
Sbjct  393  PSPEFAAYIKQRGYDLHDVKAYGQMLRDAGFAEVIAEDRTDQFIKVLEKELNAVEKDKDT  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+SS EQ WGL
Sbjct  453  FISDFSEEDYNDIVGGWKAKLMRSSSSEQCWGL  485



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SE+FAAYIKQRGYDLHD E YGQMLRDAGF +VIA+DRT+QFM+VL+KELD VE E+E F
Sbjct  397  SEDFAAYIKQRGYDLHDVEAYGQMLRDAGFNEVIADDRTEQFMQVLQKELDTVENERELF  456

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSE+DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  457  IQEFSEQDYNDIVGGWKAKLVRSSSGEQRWGL  488



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD E YGQMLRDAGF++VIAEDRTDQF +VL +EL+A+EKEK+ 
Sbjct  392  PSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFDEVIAEDRTDQFNQVLLRELNAIEKEKDE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  452  FILDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  484



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF D+IAEDRT+QF++VL++ELDA+EK+K+A
Sbjct  391  PSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDKDA  450

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDYNDIVGGWK KL RTS+GEQRWGL
Sbjct  451  FIKDFSEEDYNDIVGGWKAKLIRTSAGEQRWGL  483



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF D+IAEDRT+QF++VL++ELDA+EK+K+A
Sbjct  394  PSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDKDA  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDYNDIVGGWK KL RTS+GEQRWGL
Sbjct  454  FIKDFSEEDYNDIVGGWKAKLIRTSAGEQRWGL  486



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA+YIKQRGYDLHD +EYGQML+DAGF DVIAEDRTDQF++VL+KEL+ VEKEK+ 
Sbjct  396  PSPEFASYIKQRGYDLHDVKEYGQMLKDAGFIDVIAEDRTDQFIRVLQKELETVEKEKDE  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  456  FISDFSEEDYNDIVGGWNAKLQRTAKGEQRWGL  488



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  394  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKDE  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  454  FISDFSQEDYEDIVGGWNSKLLRSSSGEQKWGL  486



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+KVL+KELD VEKE+E+F
Sbjct  399  SEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFIKVLQKELDTVEKERESF  458

Query  289  IQDFSEEDYNDIVGGWKLKLTR-TSSGEQRWGL  194
            IQ+FSE+DYNDIVGGWK KL R TSSGEQRWGL
Sbjct  459  IQEFSEQDYNDIVGGWKAKLIRSTSSGEQRWGL  491



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  406  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKDE  465

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  466  FISDFSQEDYEDIVGGWNSKLLRSSSGEQKWGL  498



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+ VL+KELD VEKE+E+F
Sbjct  394  SEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFIGVLQKELDTVEKERESF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  454  IHDFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+KVL+KELD VEKE+E+F
Sbjct  399  SEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFIKVLQKELDTVEKERESF  458

Query  289  IQDFSEEDYNDIVGGWKLKLTR-TSSGEQRWGL  194
            IQ+FSE+DYNDIVGGWK KL R TSSGEQRWGL
Sbjct  459  IQEFSEKDYNDIVGGWKAKLIRSTSSGEQRWGL  491



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  405  PSSDFANYIKQRGYDLHDVQAYGQMLKDAGFEEVIAEDRTDQFMKVLKRELDAVEKEKDE  464

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  465  FISDFSKEDYEDIVGGWSSKLLRSSSGEQKWGL  497



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+AEDRT+QF++VL+KEL+ VEKEK+ 
Sbjct  396  PSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVLAEDRTEQFIRVLRKELETVEKEKDV  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  456  FISDFSEEDYNDIVGGWNDKLRRTAKGEQRWGL  488



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YI+QRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++ELD VEKEKE 
Sbjct  393  PSPDFAEYIEQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVRVLRRELDKVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  453  FISDFSEEDYNDIVGGWTAKLERTASGEQKWGL  485



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+AEDRT+QF++VL+KEL+ VEKEK+ 
Sbjct  396  PSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVLAEDRTEQFIRVLRKELETVEKEKDV  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  456  FISDFSEEDYNDIVGGWNDKLRRTAKGEQRWGL  488



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + Y QML DAGF++VIAEDRTDQF+KVL+KELDAVEK+KE 
Sbjct  393  PSAEFAEYIKQRGYDLHDVKAYSQMLGDAGFDEVIAEDRTDQFIKVLEKELDAVEKDKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  453  FIRDFSEEDYNEIVGGWKAKLVRSSSGEQRWGL  485



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SE+FA YIKQRGYDLHD E YGQMLRDAGF +VIAEDRT+QFMKVL+KELD VE E+E+F
Sbjct  397  SEDFAVYIKQRGYDLHDVEAYGQMLRDAGFNEVIAEDRTEQFMKVLQKELDIVENERESF  456

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSE+DY DIVGGWK KL R+SSGEQRWGL
Sbjct  457  IQEFSEQDYYDIVGGWKAKLVRSSSGEQRWGL  488



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGF +VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  407  PSADFANYIKQRGYDLHDVQAYGQMLKDAGFNEVIAEDRTDQFMKVLKRELDAVEKEKDD  466

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  467  FISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  499



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD E YGQMLRDAGF DV AEDRTDQF+KVL+KELDAVEK+K++
Sbjct  391  PSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFHDVTAEDRTDQFLKVLQKELDAVEKDKDS  450

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDY DIV GWK KL R+S GEQRWGL
Sbjct  451  FIGDFSEEDYFDIVNGWKAKLKRSSGGEQRWGL  483



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SEEFA YIKQRGYDLHD  EYGQMLRDAGF++VIAEDRT+QF+ VL+KEL+ VEKE+++F
Sbjct  402  SEEFAGYIKQRGYDLHDVAEYGQMLRDAGFDEVIAEDRTEQFINVLQKELNTVEKERDSF  461

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  462  IQEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  493



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SEEFA YIKQRGYDLHD  EYGQMLRDAGF++VIAEDRT+QF+ VL+KEL+ VEKE+++F
Sbjct  402  SEEFAGYIKQRGYDLHDVAEYGQMLRDAGFDEVIAEDRTEQFINVLQKELNTVEKERDSF  461

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  462  IQEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  493



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  408  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFMKVLKRELDAVEKEKDE  467

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  468  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF KVL++EL+A+EK+K+ 
Sbjct  387  PSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKVLQRELNAIEKDKDE  446

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  447  FIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  479



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S +F  YIKQRGYDLHD E YGQMLRDAGF+DVIAEDRT+QFM VL+KEL+AVEK+KE F
Sbjct  394  SADFTEYIKQRGYDLHDVEAYGQMLRDAGFDDVIAEDRTNQFMTVLEKELNAVEKDKETF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I+DFS+EDY+DIVGGWK KL RTSSGEQRWGL
Sbjct  454  IRDFSQEDYDDIVGGWKSKLVRTSSGEQRWGL  485



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF +VL++ELDAVEK+K+A
Sbjct  387  PSAEFAEYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFKEVLQRELDAVEKDKDA  446

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  447  FIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  479



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  408  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFMKVLKRELDAVEKEKDD  467

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  468  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAEDRTDQF+KVLK+ELDAVEKEK+ 
Sbjct  392  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDRTDQFVKVLKRELDAVEKEKDE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  452  FIRDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  484



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  408  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFMKVLKRELDAVEKEKDD  467

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  468  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQFMKVLK+ELDAVEKEK+ 
Sbjct  406  PSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFMKVLKRELDAVEKEKKE  465

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY +IVGGW  KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEEIVGGWNSKLLRSSSGEQKWGL  498



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF KVL++EL+A+EK+K+ 
Sbjct  418  PSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKVLQRELNAIEKDKDE  477

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  478  FIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  510



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF +VL++ELDAVEK+K+A
Sbjct  393  PSAEFAEYIKQRGYDLHDVQAYGQMLKDAGFDEVIAEDRTDQFKEVLQRELDAVEKDKDA  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  453  FIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  485



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD E YGQMLRDAGF++VIAED TDQF +VL +EL+A+EKEK+ 
Sbjct  392  PSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFDEVIAEDLTDQFNQVLLRELNAIEKEKDE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  452  FILDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  484



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE+FAAYIKQRGYDLHD ++YGQMLRDAGF +VIAEDRT+QF++VL+KELDAVEK+KEA
Sbjct  399  PSEDFAAYIKQRGYDLHDVDDYGQMLRDAGFHEVIAEDRTNQFLEVLQKELDAVEKDKEA  458

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY++IV GWK KL R+ +GEQRWGL
Sbjct  459  FIHDFSQEDYDEIVSGWKAKLKRSWTGEQRWGL  491



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   156 bits (394),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS++F  YIKQRGYDLHD E YGQML+DAGF++VIAEDRT QF+ VL+KEL+ VEK++EA
Sbjct  393  PSDDFVKYIKQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTHQFINVLQKELELVEKDREA  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  453  FISDFSEEDYNDIVGGWKAKLLRSSSGEQRWGL  485



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAED TDQFMKVLK+ELDAVEKEK+ 
Sbjct  392  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDSTDQFMKVLKRELDAVEKEKDE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  452  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  484



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQFM+VL++ELD VE EKE 
Sbjct  393  PSLEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFMQVLQRELDKVEMEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDY+DIVGGWK KL R++SGEQ+WGL
Sbjct  453  FIRDFSEEDYDDIVGGWKAKLERSASGEQKWGL  485



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+AEDRT+QF++VL+KEL+ VEKEK+ 
Sbjct  396  PSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVLAEDRTEQFIRVLRKELETVEKEKDV  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYN+IVGGW  KL RT+ GEQRWGL
Sbjct  456  FISDFSEEDYNEIVGGWNDKLRRTAKGEQRWGL  488



>gb|KJB30118.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=363

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ VEKEK+A
Sbjct  264  PSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQVEKEKDA  323

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  324  FISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  356



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGFE+VIAED TDQFMKVLK+ELDAVEKEK+ 
Sbjct  406  PSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVIAEDSTDQFMKVLKRELDAVEKEKDE  465

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  466  FISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  498



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF K+L++EL+A+EK+K+ 
Sbjct  408  PSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKLLQRELNAIEKDKDE  467

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  468  FIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  500



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+AEDRTDQF K+L++EL+A+EK+K+ 
Sbjct  392  PSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKLLQRELNAIEKDKDE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  452  FIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  484



>ref|XP_010677350.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=449

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EFA YIKQRGYDLHD + YGQMLRDAGF++VIAEDRTDQF KVL++EL+AVEKEKE F
Sbjct  349  SPEFAEYIKQRGYDLHDVQAYGQMLRDAGFDEVIAEDRTDQFSKVLERELNAVEKEKERF  408

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFSEEDY+ IVGGWK KL R SSGEQRWGL
Sbjct  409  ITDFSEEDYDAIVGGWKSKLVRVSSGEQRWGL  440



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SEEFA YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+ VL+KELD VEKE+++F
Sbjct  394  SEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEVVAEDRTEQFVGVLQKELDTVEKERKSF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  454  IHEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLH+ + YGQML+DAGF++VIAEDRTDQF +VL++ELDAVEK+K+A
Sbjct  393  PSAEFAEYIKQRGYDLHNVQAYGQMLKDAGFDEVIAEDRTDQFKEVLQRELDAVEKDKDA  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  453  FIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  485



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S+EF  YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF+KVL+KELD VEKE+E+F
Sbjct  394  SKEFEGYIKQRGYDLHDVEAYGQMLRDAGFHEVVAEDRTEQFIKVLQKELDTVEKERESF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  454  IHEFSEQDYNEIVGGWKSKLIRSSSGEQRWGL  485



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS+EFA YI+QRGY LHD E YGQML+DAGF++VIAEDRT+QF++VL++ELDAVEK +EA
Sbjct  392  PSKEFAQYIEQRGYGLHDVEAYGQMLKDAGFKEVIAEDRTNQFIEVLQRELDAVEKAREA  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDY++IVGGWK KL R+SSGEQRWGL
Sbjct  452  FIHDFSEEDYDEIVGGWKAKLVRSSSGEQRWGL  484



>ref|NP_001056231.2| Os05g0548900 [Oryza sativa Japonica Group]
 dbj|BAF18145.2| Os05g0548900, partial [Oryza sativa Japonica Group]
Length=208

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF  VIAEDRTDQF++VL++EL  VEK KEA
Sbjct  111  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVIAEDRTDQFLRVLQRELAEVEKNKEA  170

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  171  FMADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  203



>ref|XP_010655490.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
 ref|XP_010655528.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
Length=468

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF AYI QRGYDLHD E YGQML+DAGF++VIAEDRTDQF++VL+KE+D++EKEK+ 
Sbjct  368  PSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTDQFIEVLQKEMDSIEKEKDK  427

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDY DIVGGWK KL R+S GEQRWGL
Sbjct  428  FISDFSEEDYKDIVGGWKSKLVRSSMGEQRWGL  460



>emb|CBI26877.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF AYI QRGYDLHD E YGQML+DAGF++VIAEDRTDQF++VL+KE+D++EKEK+ 
Sbjct  384  PSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTDQFIEVLQKEMDSIEKEKDK  443

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDY DIVGGWK KL R+S GEQRWGL
Sbjct  444  FISDFSEEDYKDIVGGWKSKLVRSSMGEQRWGL  476



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ VEKEK+A
Sbjct  366  PSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQVEKEKDA  425

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  426  FISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  458



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VL++EL+ VEKEKE 
Sbjct  383  PSPEFSEYIKQRGYDLHDVQAYGQMLKDAGFNDVIAEDRTDQFMQVLRRELERVEKEKEE  442

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  443  FISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  475



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF  YI+QRGYDLHD + YGQML+DAGF +VIAEDRT+QF+KVL++E+DAVEK K+ 
Sbjct  377  PSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVIAEDRTEQFIKVLQREMDAVEKNKDE  436

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  437  FIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  469



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ VEKEK+A
Sbjct  392  PSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQVEKEKDA  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  452  FISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  484



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS  FA YIKQRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEK+ 
Sbjct  377  PSPIFAEYIKQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVQVLRRELERVEKEKDE  436

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYN+IVGGWK KL R++SGEQ+WGL
Sbjct  437  FINDFSEEDYNEIVGGWKAKLERSTSGEQKWGL  469



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YG+ML++AGFEDVIAEDRTDQF++VL++EL+ VE+EKE 
Sbjct  394  PSPEFAEYIKQRGYDLHDVQAYGKMLKEAGFEDVIAEDRTDQFVQVLRRELEKVEREKEE  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  454  FISDFSQEDYNDIVGGWTAKLERTASGEQKWGL  486



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS+EFA YI+QRGYDLHD E YGQMLRDAGF++V AEDRTDQF+KVL++ELDAVEK +  
Sbjct  392  PSKEFAEYIEQRGYDLHDVEAYGQMLRDAGFKEVNAEDRTDQFIKVLQRELDAVEKARGT  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYN+IVGGWK KL R+S GEQRWGL
Sbjct  452  FIYDFSEEDYNEIVGGWKAKLVRSSMGEQRWGL  484



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ VEKEK+A
Sbjct  395  PSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQVEKEKDA  454

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  455  FISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  487



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS  FA YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  394  PSPIFAEYIKQRGYDLHDVQAYGQMLKDAGFVDVIAEDRTDQFVQVLRRELERVEKEKEE  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R++SGEQ+WGL
Sbjct  454  FISDFSEEDYNDIVGGWKSKLERSTSGEQKWGL  486



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YI+QRGYDLHD + YGQML+DAGF++V AEDRTDQFM+VLK+ELDAVEKEKE 
Sbjct  403  PSPDFAEYIEQRGYDLHDIQAYGQMLKDAGFDEVTAEDRTDQFMQVLKRELDAVEKEKEE  462

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY +IVGGWK KL R+SSGEQRWGL
Sbjct  463  FILDFSKEDYEEIVGGWKAKLMRSSSGEQRWGL  495



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            P+EEF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQF++VL++EL  +EKEKE 
Sbjct  395  PTEEFSEYIKQRGYDLHDVKAYGQMLQDAGFHDVIAEDRTDQFIRVLERELSTIEKEKEE  454

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  455  FIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  487



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YI+QRGYDLHD + YGQML+DAGF++V AEDRTDQFM+VLK+ELDAVEKEKE 
Sbjct  392  PSPDFAEYIEQRGYDLHDIQAYGQMLKDAGFDEVTAEDRTDQFMQVLKRELDAVEKEKEE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY +IVGGWK KL R+SSGEQRWGL
Sbjct  452  FILDFSKEDYEEIVGGWKAKLMRSSSGEQRWGL  484



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S+EF  YIKQRGYDLHD E YGQMLRDAGF +V+AEDRT+QF++VL+KELD VEKE+E+F
Sbjct  394  SKEFEGYIKQRGYDLHDVEAYGQMLRDAGFHEVVAEDRTEQFIEVLQKELDTVEKERESF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  454  IHEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            P+EEF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQF++VL++EL  +EKEKE 
Sbjct  429  PTEEFSEYIKQRGYDLHDVKAYGQMLQDAGFHDVIAEDRTDQFIRVLERELSTIEKEKEE  488

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  489  FIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  521



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF  YI+QRGYDLHD + YGQML+DAGF +VIAEDRT+QF+KVL++E+DAVEK K+ 
Sbjct  396  PSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVIAEDRTEQFIKVLQREMDAVEKNKDE  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  456  FIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  488



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEK  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  485



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF  YI+QRGYDLHD + YGQML+DAGF +VIAEDRT+QF+KVL++E+DAVEK K+ 
Sbjct  392  PSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVIAEDRTEQFIKVLQREMDAVEKNKDE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  452  FIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  484



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEK  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  485



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIAEDRTDQFM+VLK+ELD VEKEKE 
Sbjct  400  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEK  459

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  460  FISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  492



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF  YIKQR YDLHD E YGQMLR AGFEDV+AEDRTDQF++VL++ELD VEK+K+ 
Sbjct  421  PSVEFVKYIKQREYDLHDVEAYGQMLRAAGFEDVVAEDRTDQFIQVLQRELDVVEKDKDE  480

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYN+IVGGWK KL R++SGEQRWGL
Sbjct  481  FIADFSEEDYNEIVGGWKAKLIRSTSGEQRWGL  513



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL++ELDAVEK+K++
Sbjct  394  PSENFAEYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLERELDAVEKDKDS  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFS+EDY+DI+GGWK KL R  SGEQ+WGL
Sbjct  454  FVQDFSQEDYDDIIGGWKAKLIRVDSGEQKWGL  486



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE+FA YIKQRGYDLHD E YG+ML+DAGF +VIAEDRT QF++VL++EL+ VEKEKE 
Sbjct  395  PSEDFAEYIKQRGYDLHDVETYGKMLKDAGFGEVIAEDRTKQFIEVLQRELERVEKEKEE  454

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDF+E DYNDIVGGWK KL RT SGEQRWGL
Sbjct  455  FIQDFTEGDYNDIVGGWKAKLVRTGSGEQRWGL  487



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL++ELDAVEK+K++
Sbjct  394  PSENFAEYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLERELDAVEKDKDS  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFS+EDY+DI+GGWK KL R  SGEQ+WGL
Sbjct  454  FVQDFSQEDYDDIIGGWKAKLIRVDSGEQKWGL  486



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS +FA YIKQRGYDLHD + YGQML+DAGF +VIAEDRT+QFM+VLK+ELDAVEKEKE 
Sbjct  358  PSPDFAEYIKQRGYDLHDIQTYGQMLKDAGFNEVIAEDRTNQFMQVLKRELDAVEKEKEE  417

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFS+E+Y ++VGGW+ KL R+S GEQRWGL
Sbjct  418  FIQDFSKEEYEEMVGGWRAKLQRSSRGEQRWGL  450



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD E Y QML+DAGF +V+AEDRTDQF++VL++ELD VEK+K+A
Sbjct  384  PSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVVAEDRTDQFLEVLQRELDVVEKDKDA  443

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  444  FIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  476



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD E Y QML+DAGF +V+AEDRTDQF++VL++ELD VEK+K+A
Sbjct  394  PSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVVAEDRTDQFLEVLQRELDVVEKDKDA  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  454  FIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  486



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD E Y QML+DAGF +V+AEDRTDQF++VL++ELD VEK+K+A
Sbjct  396  PSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVVAEDRTDQFLEVLQRELDVVEKDKDA  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  456  FIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  488



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML++AGF DVIAEDRTDQFM+VL++EL+ VEKEKE 
Sbjct  394  PSPEFSEYIKQRGYDLHDVQAYGQMLKEAGFNDVIAEDRTDQFMQVLRRELERVEKEKEE  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  454  FISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  486



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLH  + YGQMLRDAGF+DVIAEDRTDQF +VL++ELDA EK K+ 
Sbjct  393  PSEEFAEYIKQRGYDLHCVKAYGQMLRDAGFDDVIAEDRTDQFNQVLQQELDATEKIKDE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE+DYNDI+ GWK KL R+SSGEQRWGL
Sbjct  453  FITDFSEKDYNDIIDGWKAKLIRSSSGEQRWGL  485



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + Y +ML +AGF +V+AEDRTDQFM VL+KEL+ VEKEKEA
Sbjct  400  PSPEFAEYIKQRGYDLHDIKSYAKMLEEAGFSNVVAEDRTDQFMSVLQKELNIVEKEKEA  459

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R   GEQ+WGL
Sbjct  460  FIHDFSEEDYNDIVGGWKAKLNRCWCGEQKWGL  492



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YGQML+DAGF DVIAEDRT+QF+ VL++EL  VEK KEA
Sbjct  413  PSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHDVIAEDRTEQFLNVLRRELGEVEKNKEA  472

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  473  FLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  505



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ VEKEK+A
Sbjct  386  PSREFAEYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLRRELNQVEKEKDA  445

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  446  FISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  478



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD E YGQML+DAGF DVIA+D+TDQF++VL+KELD++EKEK+ 
Sbjct  396  PSAEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVIAQDKTDQFIQVLQKELDSLEKEKDK  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  456  FIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD E YGQML+DAGF DVIA+D+TDQF++VL+KELD++EKEK+ 
Sbjct  396  PSAEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVIAQDKTDQFIQVLQKELDSLEKEKDK  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  456  FIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD E YGQML+DAGF DVIAEDRTDQF+ VL+KEL   EK K+ 
Sbjct  402  PSEEFAAYIKQRGYDLHDVEAYGQMLKDAGFHDVIAEDRTDQFLCVLEKELAKFEKNKDD  461

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DFS+EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  462  FLSDFSQEDYDDIVNGWKAKLQRSSAGEQRWGL  494



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD E YGQML+DAGF DVIA+D+TDQF++VL+KELD++EKEK+ 
Sbjct  396  PSPEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVIAKDKTDQFIQVLQKELDSLEKEKDK  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  456  FIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF DVIA DRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFNDVIAADRTDQFVQVLRRELERVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL RT+SGEQ+WGL
Sbjct  453  FIADFSKEDYDDIVGGWKAKLERTASGEQKWGL  485



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQML+DAGF +VIAEDRTDQF+KVL++ELDA+E EK+ 
Sbjct  405  PSSEFAAYIKQRGYDLHDVKAYGQMLKDAGFIEVIAEDRTDQFIKVLQRELDALETEKDE  464

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE+DYNDIV GWK KL RT   EQRWGL
Sbjct  465  FIADFSEQDYNDIVDGWKAKLVRTKGDEQRWGL  497



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML++AGF DVIA+DRTDQFM+VL++EL+ VEKEKE 
Sbjct  366  PSPEFSEYIKQRGYDLHDVQAYGQMLKEAGFNDVIADDRTDQFMQVLRRELERVEKEKEE  425

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  426  FISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  458



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQML+DAGF +VIAEDRTDQF+KVL++EL A+E EK+ 
Sbjct  396  PSSEFAAYIKQRGYDLHDVKAYGQMLKDAGFIEVIAEDRTDQFIKVLQRELYALEMEKDE  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE+DYNDIV GWK KL RT  GEQRWGL
Sbjct  456  FIADFSEQDYNDIVDGWKAKLVRTKGGEQRWGL  488



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQFM+VL++EL+ VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFMQVLRRELERVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FIADFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            P+EEF+ YIKQRGYDLHD + YGQML+D GF DVIAEDRTDQF++VL++EL   EKEKE 
Sbjct  395  PTEEFSEYIKQRGYDLHDVKAYGQMLQDVGFHDVIAEDRTDQFIRVLERELSTTEKEKEE  454

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  455  FIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  487



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD E YG+MLRDAGF +VIAEDRTDQF++VL++EL+AVE  K  
Sbjct  393  PSSEFSEYIKQRGYDLHDVEAYGEMLRDAGFIEVIAEDRTDQFLQVLQRELNAVETNKNE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFSE+DYN+IV GWK KL R+SSGEQRWGL
Sbjct  453  FVQDFSEDDYNEIVDGWKAKLMRSSSGEQRWGL  485



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+ AGF DVIA+DRTDQFM+VL++EL+ VEKEKE 
Sbjct  393  PSPEFSEYIKQRGYDLHDVQAYGQMLKXAGFNDVIADDRTDQFMQVLRRELERVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  453  FISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  485



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SEE A YIKQRGYDLHD   YGQMLRDAGF++VIAEDRT QF+ VL+KEL+ VEKE+++F
Sbjct  402  SEELAGYIKQRGYDLHDVAAYGQMLRDAGFDEVIAEDRTAQFINVLQKELNTVEKERDSF  461

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSE+DYN+IVG WK KL R+SSGEQRWGL
Sbjct  462  IQEFSEQDYNEIVGSWKAKLIRSSSGEQRWGL  493



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+RGYDLHD E YGQMLRDAGF++V AEDRT+QF+ VLKKE+DAVEK+KE 
Sbjct  389  PSAEFAGYIKERGYDLHDVEAYGQMLRDAGFDEVTAEDRTEQFVNVLKKEVDAVEKDKER  448

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI +FS+EDY++IVGGWK KL+R+  GEQRWGL
Sbjct  449  FIDNFSKEDYDEIVGGWKSKLSRSCGGEQRWGL  481



>gb|AFW78991.1| hypothetical protein ZEAMMB73_932976 [Zea mays]
Length=356

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YGQML+DAGF +VIAEDRT+QF+ VL++E+  VEK K+A
Sbjct  259  PSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHNVIAEDRTEQFLNVLQREIGEVEKNKDA  318

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  319  FLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  351



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLH+ E YG+MLRDAGF +VIAEDRTDQF++VL +EL+AVE  K  
Sbjct  392  PSSEFSEYIKQRGYDLHBVEAYGEMLRDAGFIEVIAEDRTDQFLQVLXRELNAVETNKNE  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFSE+DYN+IV GWK KL R+SSGEQRWGL
Sbjct  452  FVQDFSEDDYNEIVDGWKAKLMRSSSGEQRWGL  484



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYI+QRGYDLHD + YG+ML+DAGF +VIAE+RTDQF++VL+KELDA+E+EK+ 
Sbjct  396  PSAEFAAYIRQRGYDLHDVKAYGKMLKDAGFVEVIAENRTDQFIQVLQKELDALEQEKDD  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIV GWK KL RT+ GEQ+WGL
Sbjct  456  FIDDFSEEDYNDIVDGWKAKLVRTTEGEQQWGL  488



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLHD E YGQML+DAGF +V AEDRT QF++VL++ELDAVEK+++A
Sbjct  377  PSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVTAEDRTTQFLEVLQRELDAVEKDRDA  436

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  437  FIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  469



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  396  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  456  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  488



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLHD E YGQML+DAGF +V AEDRT QF++VL++ELDAVEK+++A
Sbjct  396  PSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVTAEDRTTQFLEVLQRELDAVEKDRDA  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  456  FIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  488



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD + YGQML+DAGF +VIAEDRTDQF  VL++ELDA+EK+K++
Sbjct  394  PSENFAEYIKQRGYDLHDVKAYGQMLKDAGFYEVIAEDRTDQFKAVLERELDAIEKDKDS  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFS+ DY+DIVGGWK KL R  SGEQ+WGL
Sbjct  454  FVQDFSQGDYDDIVGGWKAKLIRVESGEQKWGL  486



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EFA YIKQRGYDLHD + YGQML DAGF+ VIAEDRTDQF++VL++ELD VEK+K+ F
Sbjct  392  SPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQVIAEDRTDQFIQVLQRELDKVEKDKDTF  451

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  452  ITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  483



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  393  PSVEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YI+QRGYDLHD + Y +ML +AGF +V+AEDRTDQFM VL++ELD VEKEKEA
Sbjct  400  PSSEFAEYIEQRGYDLHDIKSYAKMLEEAGFNNVVAEDRTDQFMSVLQRELDIVEKEKEA  459

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+  GEQ+WGL
Sbjct  460  FILDFSEEDYNDIVGGWKAKLKRSWCGEQKWGL  492



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EFA YIKQRGYDLHD + YGQML DAGF+ VIAEDRTDQF++VL++ELD VEK+K+ F
Sbjct  391  SPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQVIAEDRTDQFIQVLQRELDKVEKDKDTF  450

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  451  ITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  482



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLHD E YGQML+DAGF +V AEDRT QF++VL++ELDAVEK+++A
Sbjct  434  PSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVTAEDRTTQFLEVLQRELDAVEKDRDA  493

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  494  FIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  526



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD E YGQML+DAGF + +AEDRTDQF++VL++ELDAVEK+K+A
Sbjct  396  PSEAFAEYIKQRGYDLHDVEAYGQMLKDAGFYEAVAEDRTDQFLEVLQRELDAVEKDKDA  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+Q+FS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  456  FVQEFSKEDYDEIVSGWKAKLKRSSFGEQRWGL  488



>emb|CDM83854.1| unnamed protein product [Triticum aestivum]
Length=396

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD E YGQML++AGF DVIAE+RTDQF+KVL++EL  VEK K+ 
Sbjct  299  PSEEFAAYIKQRGYDLHDVEAYGQMLQNAGFHDVIAEERTDQFLKVLQRELAEVEKNKDE  358

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  359  FLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  391



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF  VIAEDRTDQF++VL++EL  VEK KEA
Sbjct  398  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVIAEDRTDQFLRVLQRELAEVEKNKEA  457

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  458  FMADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  490



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF  VIAEDRTDQF++VL++EL  VEK KEA
Sbjct  407  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVIAEDRTDQFLRVLQRELAEVEKNKEA  466

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  467  FLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  499



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD E YGQML+ AGF DVIAEDRTDQF+ VL+KEL   EK K+ 
Sbjct  404  PSEEFAAYIKQRGYDLHDVEAYGQMLKSAGFRDVIAEDRTDQFLGVLEKELAKFEKNKDD  463

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  464  FLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  496



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML +AGF DV+AEDRTDQF+ VL++EL  VEK K  
Sbjct  402  PSEEFAAYIKQRGYDLHDVKAYGKMLENAGFHDVVAEDRTDQFLNVLQRELAEVEKNKNE  461

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DFS+EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  462  FVSDFSQEDYDDIVNGWKAKLQRSSAGEQRWGL  494



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL++EL  VEK+K++
Sbjct  394  PSENFADYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLERELAXVEKDKDS  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFS+EDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  454  FVQDFSQEDYDDIVGGWKAKLIRVDSGEQKWGL  486



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YGQML+DAGF +VIAEDRT+QF+ VL++E+  VEK K+A
Sbjct  404  PSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHNVIAEDRTEQFLNVLQREIGEVEKNKDA  463

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  464  FLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  496



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  396  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK +L R +S EQ+WGL
Sbjct  456  FISDFSKEDYDDIVGGWKAELERCASDEQKWGL  488



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S+EF+ YIKQRGYDLHD   YGQML+DA F++VIAEDRT+QF+ VL+KEL+ VEKE+++F
Sbjct  403  SDEFSEYIKQRGYDLHDVATYGQMLKDASFDEVIAEDRTEQFINVLQKELNTVEKERDSF  462

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  463  IQEFSEQDYNEIVGGWKAKLLRSSSGEQRWGL  494



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE FA YIKQRGYDLHD + YGQML DAGF +VIAEDRTDQF  VL++ELDA+EK+K++
Sbjct  394  PSENFAEYIKQRGYDLHDVKAYGQMLEDAGFYEVIAEDRTDQFKAVLERELDAIEKDKDS  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFS+ DY+DIVGGWK KL R  SGEQ+WGL
Sbjct  454  FVQDFSQGDYDDIVGGWKAKLIRVDSGEQKWGL  486



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            P E FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQF  VL +EL AVEK+K++
Sbjct  394  PLENFADYIKQRGYDLHDVKAYGQMLKDAGFDEVIAEDRTDQFKAVLARELAAVEKDKDS  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+QDFS+EDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  454  FVQDFSQEDYDDIVGGWKAKLIRVDSGEQKWGL  486



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF +VL++EL++VEKEKE 
Sbjct  393  PSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFTQVLRRELESVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK +L R +S EQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAELERCASDEQKWGL  485



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLH+ E YGQML++AGF DVIAEDRTDQF+KVL++EL  VEK K+ 
Sbjct  406  PSEEFAAYIKQRGYDLHNVEAYGQMLQNAGFHDVIAEDRTDQFLKVLQRELAEVEKNKDE  465

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  466  FLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  498



>gb|EMT23241.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=553

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++EL   EK KEA
Sbjct  456  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELGETEKNKEA  515

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  516  FLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  548



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD E YGQML++AGF DVIAE+RTDQF+KVL++EL  VEK K+ 
Sbjct  407  PSEEFAAYIKQRGYDLHDVEAYGQMLQNAGFHDVIAEERTDQFLKVLQRELAEVEKNKDE  466

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  467  FLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  499



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS++FAAYIKQRGYDLHD + YGQML++AGF  VIAEDRT+QF++VL++ELDAVE  KE 
Sbjct  399  PSDDFAAYIKQRGYDLHDVDAYGQMLKNAGFNKVIAEDRTNQFLEVLQRELDAVEMGKEG  458

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  459  FIRDFSQEDYDEIVNGWKAKLKRSSVGEQRWGL  491



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YI+QRGYDLHD E YGQ+L DAGF++VIAEDRT+QF++VL++EL+ VEK+K+A
Sbjct  395  PSSEFAEYIEQRGYDLHDVEAYGQILSDAGFDEVIAEDRTEQFLQVLQRELNEVEKDKDA  454

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+  FS+EDY+DI+GGWK KL R+SSGEQRWGL
Sbjct  455  FVSSFSQEDYDDILGGWKAKLIRSSSGEQRWGL  487



>gb|EMT23240.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=497

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++ELD  EK KEA
Sbjct  400  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELDGTEKSKEA  459

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++ED +DIV GW  KL R+S+GEQ+WGL
Sbjct  460  FLADFTQEDSDDIVNGWSAKLKRSSAGEQKWGL  492



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLHD E YGQML+DAGF +VIAEDRT+QF+ VL++E+  VEK K+A
Sbjct  398  PSEEFATYIKQRGYDLHDVEAYGQMLKDAGFHNVIAEDRTEQFLNVLQREIGEVEKNKDA  457

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S GEQRWGL
Sbjct  458  FLADFTQEDYDDIVNGWNAKLKRSSGGEQRWGL  490



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLH+ E YGQML++AGF DV+AEDRTDQF+KVL++EL  VEK K+ 
Sbjct  407  PSEEFAAYIKQRGYDLHNVETYGQMLQNAGFHDVVAEDRTDQFLKVLQRELAEVEKNKDE  466

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  467  FLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  499



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLH+ E YGQML++AGF DV+AEDRTDQF+KVL++EL  VEK K+ 
Sbjct  408  PSEEFAAYIKQRGYDLHNVETYGQMLQNAGFHDVVAEDRTDQFLKVLQRELAEVEKNKDE  467

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  468  FLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  500



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++EL   EK KEA
Sbjct  367  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELGETEKNKEA  426

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  427  FLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  459



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV+AEDRTDQF++VL++EL   EK KEA
Sbjct  401  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDVVAEDRTDQFLRVLERELGETEKNKEA  460

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  461  FLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  493



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLHD E YGQML++AGF  VIAEDRTDQF+ VL+KELD  EK K+ 
Sbjct  401  PSEEFATYIKQRGYDLHDVEAYGQMLKNAGFSHVIAEDRTDQFLSVLQKELDKFEKNKDD  460

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  461  FLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  493



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLHD E YGQML++AGF  VIAEDRTDQF+ VL+KELD  EK K+ 
Sbjct  404  PSEEFATYIKQRGYDLHDVEAYGQMLKNAGFSHVIAEDRTDQFLSVLQKELDKFEKNKDD  463

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  464  FLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  496



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 2/95 (2%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFM--KVLKKELDAVEKEK  299
            PS EFA YIKQRGYDLH+ + YGQML+DAGF++VIAEDRTDQ     +L++ELDAVEK+K
Sbjct  393  PSAEFAEYIKQRGYDLHNVQAYGQMLKDAGFDEVIAEDRTDQVCIRLLLQRELDAVEKDK  452

Query  298  EAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  453  DAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  487



>ref|XP_010314226.1| PREDICTED: phosphoethanolamine N-methyltransferase isoform X2 
[Solanum lycopersicum]
Length=388

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S++F+ YIKQRGYDLHD   YGQML+DAGF++VIAEDRT+QF+ VL+KEL+ VEKE+++F
Sbjct  291  SDKFSEYIKQRGYDLHDVATYGQMLKDAGFDEVIAEDRTEQFINVLQKELNTVEKERDSF  350

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I +FSE+DYN+IVGGW  KL R+SSGEQRWGL
Sbjct  351  IHEFSEQDYNEIVGGWTAKLLRSSSGEQRWGL  382



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD   YGQML +AGF DVIAEDRTDQF+ VL++EL  VEK K  
Sbjct  402  PSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNKNE  461

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  462  FVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  494



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD   YGQML +AGF DVIAEDRTDQF+ VL++EL  VEK K  
Sbjct  412  PSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNKNE  471

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  472  FVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  504



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YI+QRGYDLHD + Y +ML +AGF +V+AEDRTDQFM VL++ELD VEKEK+ 
Sbjct  400  PSSEFAEYIEQRGYDLHDIKSYAKMLEEAGFNNVVAEDRTDQFMSVLQRELDIVEKEKKX  459

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R+  GEQ+WGL
Sbjct  460  FILDFSEEDYNDIVGGWKAKLKRSWCGEQKWGL  492



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML  AGF DVIAEDRT+QF+ VL++EL  VEK K+A
Sbjct  401  PSEEFAAYIKQRGYDLHDVKAYGKMLEGAGFHDVIAEDRTEQFLSVLRRELAEVEKNKDA  460

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  461  FVADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  493



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S++F+ YIKQRGYDLHD   YGQML+DAGF++VIAEDRT+QF+ VL+KEL+ VEKE+++F
Sbjct  403  SDKFSEYIKQRGYDLHDVATYGQMLKDAGFDEVIAEDRTEQFINVLQKELNTVEKERDSF  462

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I +FSE+DYN+IVGGW  KL R+SSGEQRWGL
Sbjct  463  IHEFSEQDYNEIVGGWTAKLLRSSSGEQRWGL  494



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLH  E YGQML+ AGF DVIAEDRTDQF+ VL KEL   EK K+ 
Sbjct  405  PSEEFAAYIKQRGYDLHAVEAYGQMLKSAGFRDVIAEDRTDQFLGVLDKELAEFEKNKDD  464

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  465  FLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  497



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE+FAAYIKQRGYDLHD + YG+ML +AGF DVIAEDRTDQF++VL++EL   EK KEA
Sbjct  375  PSEDFAAYIKQRGYDLHDVKTYGKMLENAGFHDVIAEDRTDQFLRVLERELAETEKNKEA  434

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  435  FLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  467



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD   YGQML +AGF DVIAEDRTDQF+ VL++EL  VEK    
Sbjct  402  PSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNNNE  461

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  462  FVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  494



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLH  E YGQML+ AGF DVIAEDRTDQF+ VL KEL   EK K+ 
Sbjct  405  PSEEFAAYIKQRGYDLHAVEAYGQMLKSAGFRDVIAEDRTDQFLGVLDKELAEFEKNKDD  464

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  465  FLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  497



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSE+FAAYIKQRGYDLHD + YG+ML +AGF DVIAEDRTDQF++VL++EL   EK KEA
Sbjct  404  PSEDFAAYIKQRGYDLHDVKTYGKMLENAGFHDVIAEDRTDQFLRVLERELAETEKNKEA  463

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  464  FLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  496



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YGQML++AGF  VIAEDRTDQF+ +L+KELD  EK K  
Sbjct  402  PSEEFAAYIKQRGYDLHDVDAYGQMLKNAGFSHVIAEDRTDQFLGILQKELDKFEKSKAD  461

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DFS+ DY+DIV GWK K+ R+S+GEQRWGL
Sbjct  462  FLSDFSQGDYDDIVNGWKAKVQRSSAGEQRWGL  494



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD + YG+ML DAGF  V AEDRTDQF++VL++EL  VEK K+A
Sbjct  398  PSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHHVTAEDRTDQFLRVLQRELAEVEKNKDA  457

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  458  FLADFTQEDYDDIVNGWNAKLKRSSAGEQKWGL  490



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD E YGQML++AGF  VIAEDRTDQF+ VL+KELD  EK K+ 
Sbjct  402  PSEEFAAYIKQRGYDLHDVEAYGQMLKNAGFSHVIAEDRTDQFLSVLQKELDKFEKNKDD  461

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ +F++ DY+DIV GWK KL RTS+ EQRWGL
Sbjct  462  FLSEFAQGDYDDIVNGWKAKLQRTSAREQRWGL  494



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA+YIKQRGYDLHD E YGQML +AGF DVIAED +DQF+KVL++EL  VEK K+ 
Sbjct  411  PSEEFASYIKQRGYDLHDVETYGQMLENAGFHDVIAEDHSDQFLKVLQRELAEVEKNKDD  470

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  471  FLADFGQEDYDDIVTGWNAKLHRSSAGEQRWGL  503



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYI+QRGYDLHD + YGQML++AGF DVIA+DRTDQF+ VL++EL  VEK K+ 
Sbjct  405  PSEEFAAYIEQRGYDLHDVQAYGQMLKNAGFHDVIADDRTDQFLTVLQRELGEVEKNKDD  464

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DF +EDY+DIV GW  KL R S+GEQRWGL
Sbjct  465  FLADFGQEDYDDIVNGWNAKLERCSAGEQRWGL  497



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EF  YIK+RGYDLHD + YGQMLRDAGF DV+AEDRTDQF+++L KELDAVE+ K++F
Sbjct  397  SAEFLEYIKKRGYDLHDVDHYGQMLRDAGFVDVVAEDRTDQFVRILTKELDAVERNKKSF  456

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +QDFSEEDY DIV GWK KL R   G Q+WGL
Sbjct  457  LQDFSEEDYEDIVHGWKSKLVRCGQGHQKWGL  488



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQ-MLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  296
            PS EFA YI+QRGYDLHD E YGQ +L DAGF++VIAEDRT+QF++VL++EL+ VEK+K+
Sbjct  395  PSSEFAEYIEQRGYDLHDVEAYGQQILSDAGFDEVIAEDRTEQFLQVLQRELNEVEKDKD  454

Query  295  AFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            AF+  FS+EDY+DI+GGWK KL R+SSGEQRWGL
Sbjct  455  AFVSSFSQEDYDDILGGWKAKLIRSSSGEQRWGL  488



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGY LH+ + Y QML DAGF+DVIAEDRTDQF +VLK+ELDAVEKEK+ 
Sbjct  412  PSEEFAEYIKQRGYYLHEVKPYVQMLTDAGFDDVIAEDRTDQFNRVLKRELDAVEKEKDE  471

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSE+D+NDIV GWK KL R+S+GEQ W L
Sbjct  472  FIHDFSEKDFNDIVDGWKAKLIRSSAGEQLWIL  504



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  377  PSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEE  436

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  437  FISDFSEEDYNDIVGGWSAKLERTASGEQKWGL  469



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  453  FISDFSEEDYNDIVGGWSAKLERTASGEQKWGL  485



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YG+ML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSPEFAEYIKQRGYDLHDVQAYGKMLKDAGFEDVIAEDRTDQFVEVLRRELEKVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  453  FINDFSEEDYNDIVGGWSAKLERTASGEQKWGL  485



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EF  YIK+RGYDLHD + YGQMLRDAGF DV+AEDRTDQF+++L KELD VE+ K++F
Sbjct  397  SAEFLEYIKKRGYDLHDVDHYGQMLRDAGFVDVVAEDRTDQFVRILTKELDTVERNKKSF  456

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +QDFSEEDY DIV GWK KL R   G Q+WGL
Sbjct  457  LQDFSEEDYEDIVQGWKSKLVRCGQGHQKWGL  488



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD E YGQMLRDAGFE+VIAEDRT QF++VL++EL  +EKEK  
Sbjct  398  PSPEFAKYIKQRGYDLHDVEAYGQMLRDAGFEEVIAEDRTGQFIEVLQRELSVIEKEKNE  457

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDY DIVGGWK KL RT+S   R  +
Sbjct  458  FISDFSEEDYYDIVGGWKAKLIRTTSVAARLSV  490



>ref|XP_004137342.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EFA YIKQRGYDLHD + YGQM+ DAGF +V++EDRT+QF++VL++EL+AVE++K+ F
Sbjct  370  SPEFAEYIKQRGYDLHDVKAYGQMIEDAGFGEVVSEDRTNQFIQVLQQELEAVEEQKDRF  429

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFSEE YNDIV GWK KL R+ SGEQRWGL
Sbjct  430  ILDFSEEGYNDIVCGWKAKLNRSLSGEQRWGL  461



>ref|XP_004166030.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase 
1-like [Cucumis sativus]
Length=468

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EFA YIKQRGYDLHD + YGQM+ DAGF +V++EDRT+QF++VL++EL+AVE++K+ F
Sbjct  370  SPEFAEYIKQRGYDLHDVKAYGQMIEDAGFGEVVSEDRTNQFIQVLQQELEAVEEQKDRF  429

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFSEE YNDIV GWK KL R+ SGEQRWGL
Sbjct  430  ILDFSEEGYNDIVCGWKAKLNRSLSGEQRWGL  461



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YG+ML++AGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  394  PSPEFAEYIKQRGYDLHDVQAYGKMLKEAGFEDVIAEDRTDQFVQVLRRELEKVEKEKEE  453

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  454  FISDFSQEDYNDIVGGWTAKLERTASGEQKWGL  486



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEF  YIKQRGYDL+D E Y QML+ AGF +V AEDRT QF++VL++ELDAVEK+++A
Sbjct  344  PSEEFTEYIKQRGYDLYDVEAYVQMLQGAGFYEVTAEDRTTQFLEVLQRELDAVEKDRDA  403

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI++FS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  404  FIKEFSKEDYDEIVSGWKAKLKRSSVGEQRWGL  436



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYI+QRGYDLH  ++YG+ML DAGF +V+AEDRTDQF++VL++EL   E  ++ 
Sbjct  392  PSAEFAAYIQQRGYDLHSVQKYGEMLEDAGFVEVVAEDRTDQFIEVLQRELATTEAGRDQ  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYN IV GWK KL R S+ EQ+WGL
Sbjct  452  FINDFSEEDYNYIVSGWKSKLKRCSNDEQKWGL  484



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 2/93 (2%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS  FA YIKQRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  377  PSPTFAEYIKQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVQVLRRELEKVEKEKEE  436

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  437  FISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  467



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 2/93 (2%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS  FA YIKQRGYDLHD + YGQML+DAGFEDVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  393  PSPTFAEYIKQRGYDLHDVQAYGQMLKDAGFEDVIAEDRTDQFVQVLRRELEKVEKEKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  453  FISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  483



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+D GF DVIAEDRTDQFM+VL++EL+ VE+EKE 
Sbjct  393  PSPEFSEYIKQRGYDLHDVQAYGQMLKDVGFSDVIAEDRTDQFMQVLRRELERVEREKEE  452

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS+EDY+DIVGGWK KL R +SGEQ+WGL
Sbjct  453  FISDFSKEDYDDIVGGWKAKLERVASGEQKWGL  485



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 73/92 (79%), Gaps = 9/92 (10%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EFA YIKQRGYDLHD + YGQ         VIAEDRTDQF++VL++ELD VEK+K+ F
Sbjct  392  SPEFAEYIKQRGYDLHDVKAYGQ---------VIAEDRTDQFIQVLQRELDKVEKDKDTF  442

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  443  ITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  474



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 2/93 (2%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS  FA YIKQRGYDLHD + YGQML+DAGFE VIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  377  PSPVFAEYIKQRGYDLHDVQAYGQMLKDAGFEYVIAEDRTDQFIQVLRRELEKVEKEKEE  436

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  437  FISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  467



>gb|AAF79705.1|AC020889_13 T1N15.23 [Arabidopsis thaliana]
Length=374

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 83/122 (68%), Gaps = 29/122 (24%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF++VL++EL+ VEKEKE 
Sbjct  247  PSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEE  306

Query  292  FIQDFSE-----------------------------EDYNDIVGGWKLKLTRTSSGEQRW  200
            FI DFSE                             EDYNDIVGGW  KL RT+SGEQ+W
Sbjct  307  FISDFSEVKTFLTTNSFEQNTCLLCSHIDHKILLLQEDYNDIVGGWSAKLERTASGEQKW  366

Query  199  GL  194
            GL
Sbjct  367  GL  368



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF  Y+ +R YDLH  + YG+ML++AGFEDVIA+DRTDQF++VL++EL  VEKEKE 
Sbjct  374  PSLEFQEYMVRRRYDLHGVQAYGKMLKEAGFEDVIADDRTDQFVQVLRRELAKVEKEKEE  433

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +I DFSEEDYN IV  W  KL +T SGEQ+WGL
Sbjct  434  YINDFSEEDYNGIVRVWTAKLRKTLSGEQKWGL  466



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY LHD + Y +ML DAGF+D+IAEDRTDQF+K L+KELDA+E +K+ 
Sbjct  398  PSSEFAEYIKKGGYYLHDMKAYEKMLEDAGFDDLIAEDRTDQFVKTLQKELDALENKKDD  457

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI+DFSEEDYN+IV  WK K +R +S EQ WGL
Sbjct  458  FIRDFSEEDYNEIVERWKAKQSRGASKEQMWGL  490



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ VEKEK+A
Sbjct  395  PSREFAEYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLRRELNQVEKEKDA  454

Query  292  FIQDFSEEDYNDIVGGWKLK  233
            FI DFS+EDY++IVGGW+ K
Sbjct  455  FISDFSKEDYDEIVGGWEGK  474



>gb|ABK93894.1| unknown [Populus trichocarpa]
Length=75

 Score =   115 bits (287),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -2

Query  400  MLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRT  221
            MLRDAGF++VIAEDRTDQF +VL +EL A+EKEK+ FI DFSEEDYNDIVGGWK KL R+
Sbjct  1    MLRDAGFDEVIAEDRTDQFNQVLLRELKAIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRS  60

Query  220  SSGEQRWGL  194
            SSGEQRWGL
Sbjct  61   SSGEQRWGL  69



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY LHD + Y QML DAGF+DVIAEDRTDQF+  L++EL+A+E +K+ 
Sbjct  368  PSLEFAEYIKKGGYYLHDIKAYRQMLEDAGFDDVIAEDRTDQFVNTLQQELNALENKKDD  427

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYN+IV  WK K TR +S EQ WGL
Sbjct  428  FIGDFSEEDYNEIVERWKAKQTRGASREQMWGL  460



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY LHD + Y QML DAGF+DVIAEDRTDQF+  L++EL+A+E +K+ 
Sbjct  390  PSLEFAEYIKKGGYYLHDIKAYRQMLEDAGFDDVIAEDRTDQFVNTLQQELNALENKKDD  449

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFSEEDYN+IV  WK K TR +S EQ WGL
Sbjct  450  FIGDFSEEDYNEIVERWKAKQTRGASREQMWGL  482



>ref|XP_010481025.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=427

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS E AAY+++R YDLH  + YG ML++AGFEDVIAEDRTDQF +VL++EL+ V+ EKE 
Sbjct  329  PSLEVAAYMERRRYDLHGVQAYGNMLKEAGFEDVIAEDRTDQFAQVLRRELEKVKNEKEE  388

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +I DFSE DYNDIV  W  KL + +S E +WGL
Sbjct  389  YISDFSEGDYNDIVRVWTAKLRKAASDELKWGL  421



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -2

Query  463  EFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQ  284
            +FA+YIKQR YDLH  + YGQML+ +GF  V AED TDQF++VLK+EL A E+E++ FI+
Sbjct  335  QFASYIKQRNYDLHSVQTYGQMLQRSGFIKVHAEDGTDQFVEVLKRELSATEQERDKFIE  394

Query  283  DFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +FSE+DYN IV GWK KL R ++ EQ+WGL
Sbjct  395  EFSEDDYNYIVNGWKSKLERCANDEQKWGL  424



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS++FAAYI QRGYDLH  ++YG+ML  AGF DV AEDRT QF   LKKE++A E  +E 
Sbjct  399  PSDKFAAYIAQRGYDLHSVDDYGRMLTKAGFVDVKAEDRTWQFEACLKKEVEAAEAGREE  458

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F++DFS  D++ IV GW+ KL R   GEQRWGL
Sbjct  459  FVRDFSAADHDAIVSGWRDKLVRVGEGEQRWGL  491



>gb|KIZ00504.1| hypothetical protein MNEG_7455 [Monoraphidium neglectum]
Length=127

 Score =   111 bits (278),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            P+  FAAYI QRGYDL   + YG++L +AGF DV+AEDRT+QF+  L  EL  VE +K A
Sbjct  27   PTPAFAAYIAQRGYDLRPIKAYGRLLEEAGFVDVVAEDRTEQFIDCLDSELSRVEADKAA  86

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F++ F E  Y+ +V GW  KL R  +GEQRWGL
Sbjct  87   FVERFGEPGYSAVVDGWNDKLARARAGEQRWGL  119



>gb|AFK34318.1| unknown [Lotus japonicus]
Length=192

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY +HD + Y QML +AGF+D+IAE+RTD F+K LK+EL+A+E +K+ 
Sbjct  94   PSLEFAEYIKKGGYYIHDMKAYEQMLENAGFDDIIAENRTDLFVKTLKQELEALENKKDD  153

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI +F EEDYN+IV  WK K  R  S EQ WGL
Sbjct  154  FICEFGEEDYNEIVERWKAKQIRGESLEQMWGL  186



>emb|CAN75113.1| hypothetical protein VITISV_043577 [Vitis vinifera]
Length=431

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 65/93 (70%), Gaps = 7/93 (8%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF AYI QRGYDLHD E YGQML+DAGF++VIAEDRTDQ    +   +D        
Sbjct  338  PSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTDQPXSEVLFNIDIX------  391

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
             I   S+EDY DIVGGWK KL R+S GEQRWGL
Sbjct  392  -ILIPSQEDYKDIVGGWKSKLVRSSMGEQRWGL  423



>ref|XP_011453571.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Crassostrea gigas]
 ref|XP_011453572.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Crassostrea gigas]
Length=489

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SE+F AY+KQRGY+L   E+YG++L  AGF +V A+DRTD F++ L+KEL   E  K+ F
Sbjct  390  SEQFKAYVKQRGYNLLSPEQYGKVLEKAGFVNVKADDRTDLFVESLEKELVRTETIKDDF  449

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FS++DY+DIVGGWK KL RT++G+QRWG+
Sbjct  450  IKEFSQKDYDDIVGGWKDKLVRTATGDQRWGV  481



>ref|XP_011453570.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Crassostrea gigas]
Length=499

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SE+F AY+KQRGY+L   E+YG++L  AGF +V A+DRTD F++ L+KEL   E  K+ F
Sbjct  400  SEQFKAYVKQRGYNLLSPEQYGKVLEKAGFVNVKADDRTDLFVESLEKELVRTETIKDDF  459

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FS++DY+DIVGGWK KL RT++G+QRWG+
Sbjct  460  IKEFSQKDYDDIVGGWKDKLVRTATGDQRWGV  491



>ref|XP_011453569.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Crassostrea gigas]
 gb|EKC31484.1| Putative phosphoethanolamine N-methyltransferase 3 [Crassostrea 
gigas]
Length=506

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            SE+F AY+KQRGY+L   E+YG++L  AGF +V A+DRTD F++ L+KEL   E  K+ F
Sbjct  407  SEQFKAYVKQRGYNLLSPEQYGKVLEKAGFVNVKADDRTDLFVESLEKELVRTETIKDDF  466

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FS++DY+DIVGGWK KL RT++G+QRWG+
Sbjct  467  IKEFSQKDYDDIVGGWKDKLVRTATGDQRWGV  498



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS  +A YIK+ GY +HD + Y QML +AGF+DV+AEDRT+ FMK L++EL+A+E +K+ 
Sbjct  392  PSLGYAEYIKKGGYHIHDMKTYCQMLENAGFDDVVAEDRTNLFMKTLQQELNALESKKDD  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI +FSEEDYN I   WK K  R + GEQ WGL
Sbjct  452  FIDEFSEEDYNGITERWKAKQMRGADGEQIWGL  484



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY +HD +EY QML +AGF+ V+ EDRTDQF+K L++EL A+E +K+ 
Sbjct  392  PSSEFAKYIKEGGYHIHDMKEYEQMLENAGFDVVVVEDRTDQFVKTLEQELIALESKKDD  451

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI + S++DYN+IV  WK K  R   GEQ+WGL
Sbjct  452  FICELSDDDYNEIVERWKGKQIRGECGEQKWGL  484



>gb|AFK45429.1| unknown [Medicago truncatula]
Length=341

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY +HD +EY QML +AGF DVI EDRTDQF+K L++EL  +E +K+ 
Sbjct  244  PSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVIVEDRTDQFVKTLQQELITLESQKDD  302

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS +DY++IV  WK K  R   GEQ+WGL
Sbjct  303  FISDFSNDDYDEIVERWKAKQIRGERGEQKWGL  335



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 3/77 (4%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S EF AYIKQRGYDLHD + YGQMLRDAGF+DV+AEDRTDQF+K+L+KEL + EK+K+AF
Sbjct  392  SLEFHAYIKQRGYDLHDVDAYGQMLRDAGFDDVVAEDRTDQFIKILQKELSSAEKDKDAF  451

Query  289  IQDFSEEDYN---DIVG  248
            I+DFSE   N    IVG
Sbjct  452  IRDFSEVSLNSNLSIVG  468



>ref|XP_010774827.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Notothenia 
coriiceps]
Length=438

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY LH   +YGQ +++AGF +V +EDRT QF++V+K EL   E  ++ F
Sbjct  341  TPAFQAYVKQRGYVLHTPSQYGQFIQEAGFCNVRSEDRTAQFIQVIKTELQRAELIRDEF  400

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSEEDY  IV GW+ KL R++SG+QRWGL
Sbjct  401  IQEFSEEDYLAIVKGWREKLERSNSGDQRWGL  432



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY +HD +EY QML +AGF DVI EDRTDQF+K L++EL  +E +K+ 
Sbjct  391  PSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVIVEDRTDQFVKTLQQELITLESQKDD  449

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS +DY++IV  WK K  R   GEQ+WGL
Sbjct  450  FISDFSNDDYDEIVERWKAKQIRGERGEQKWGL  482



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY +HD +EY QML +AGF DVI EDRTDQF+K L++EL  +E +K+ 
Sbjct  397  PSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVIVEDRTDQFVKTLQQELITLESQKDD  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS +DY++IV  WK K  R   GEQ+WGL
Sbjct  456  FISDFSNDDYDEIVERWKAKQIRGERGEQKWGL  488



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EF+ YIKQRGYDLHD + YGQML+DAGF D+IAEDRT+QF++VL++ELDA+EK+K+A
Sbjct  394  PSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDKDA  453

Query  292  FIQDFSE  272
            FI+DFSE
Sbjct  454  FIKDFSE  460



>ref|XP_004073222.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Oryzias 
latipes]
Length=485

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S+ F +Y+KQRGY L+   +YG+ +++AGF +V AEDRT QF++V+K EL   E  KE F
Sbjct  388  SQAFESYVKQRGYILYTPAQYGKFIQEAGFCEVRAEDRTSQFIQVIKDELKKAEAIKEEF  447

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSEEDY  +V GWK KL R+++G+QRWGL
Sbjct  448  IQEFSEEDYLAVVNGWKEKLERSNTGDQRWGL  479



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFAAYIKQRGYDLHD + YGQML DAGF+ ++AEDRTDQF++VL++EL+ VEKEK+A
Sbjct  395  PSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVILAEDRTDQFLQVLQRELNQVEKEKDA  454

Query  292  FIQDFSE  272
            FI DFS+
Sbjct  455  FISDFSK  461



>ref|XP_003619840.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=419

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S E+A YIK+RGY +HD + Y QML +AGF+DVIA D+T+ F+K L+ EL+A+E +K  F
Sbjct  322  SVEYAEYIKKRGYYIHDMKAYFQMLENAGFDDVIAVDQTNLFLKTLQMELNALENKKVDF  381

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  382  IDDFSEDDYNEIVERWKAKQMRGVAGEQIWGL  413



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  394  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEVIKDEF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY +IV GWK KL R++SG+QRWGL
Sbjct  454  IKEFSEEDYFEIVNGWKEKLERSNSGDQRWGL  485



>ref|XP_003444639.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Oreochromis niloticus]
Length=493

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  396  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  455

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  456  IKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  487



>ref|XP_005467629.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X4 [Oreochromis niloticus]
Length=485

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  388  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  447

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  448  IKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  479



>ref|XP_004545581.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Maylandia zebra]
Length=492

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  395  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEVIKDEF  454

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY +IV GWK KL R++SG+QRWGL
Sbjct  455  IKEFSEEDYFEIVNGWKEKLERSNSGDQRWGL  486



>ref|XP_005467627.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005467628.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Oreochromis niloticus]
Length=492

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  395  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  454

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  455  IKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  486



>gb|KHN00145.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=524

 Score =   108 bits (270),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQ----FMKVLKKELDAVEK  305
            PS EF  YIK+ GY  HD + Y QML DAGF+DVIAEDRTD+        L++ELDA+E 
Sbjct  21   PSLEFDEYIKKGGYYPHDIKAYRQMLEDAGFDDVIAEDRTDRVCLSLKHTLQQELDALEN  80

Query  304  EKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +K  FI+DFSEEDYN+IV  WK K TR +S EQ W L
Sbjct  81   KKGDFIRDFSEEDYNEIVERWKAKQTRGASREQMWDL  117



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  388  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  447

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  448  IKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  479



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S E+A YIK+RGY +HD + Y QML +AGF+DVIA D+T+ F+K L+ EL+A+E +K  F
Sbjct  400  SVEYAEYIKKRGYYIHDMKAYFQMLENAGFDDVIAVDQTNLFLKTLQMELNALENKKVDF  459

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I DFSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  460  IDDFSEDDYNEIVERWKAKQMRGVAGEQIWGL  491



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  394  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  454  IKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  485



>ref|XP_005913451.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Haplochromis burtoni]
Length=485

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  388  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  447

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  448  IKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  479



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -2

Query  460  FAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQD  281
            F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  KE FIQ+
Sbjct  398  FEAYVKQRGYILYTPSEYGKFIQEAGFCNVRVEDRTAQFIQVIQTELQRAEDIKEEFIQE  457

Query  280  FSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FSEEDY+ IV GW+ KL R+ SG+QRWGL
Sbjct  458  FSEEDYSAIVNGWREKLDRSKSGDQRWGL  486



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  395  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  454

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  455  IKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486



>ref|XP_005913450.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Haplochromis burtoni]
Length=492

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  395  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  454

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  455  IKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486



>gb|ACF23047.1| ST236, partial [Eutrema halophilum]
Length=68

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  EDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRW  200
            EDVIAEDRTDQF++VL++EL+ VEKEK+ FI DFSEEDYN+IVGGWK KL R++SGEQ+W
Sbjct  1    EDVIAEDRTDQFVQVLRRELERVEKEKDEFINDFSEEDYNEIVGGWKAKLERSTSGEQKW  60

Query  199  GL  194
            GL
Sbjct  61   GL  62



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   EYG+ +++AGF  V AEDRT QF++V+K EL   E  K+ F
Sbjct  395  TPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEF  454

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  455  VKEFSEEDYFAIVNGWKEKLGRSNSGDQRWGL  486



>ref|NP_001070105.1| phosphoethanolamine methyltransferase [Danio rerio]
 gb|AAI24222.1| Zgc:153034 [Danio rerio]
Length=489

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S  F  Y+KQRGY L+  + YGQ LR+ GF +V AEDRT+QF++V+K EL   E+ K+ F
Sbjct  392  SPAFQDYVKQRGYILYTPQRYGQFLREVGFSNVRAEDRTEQFIQVIKSELQRAEEMKDEF  451

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FS+ED++ IV GW  KL R  +G+QRWGL
Sbjct  452  IQEFSKEDFDAIVSGWTEKLQRCETGDQRWGL  483



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -2

Query  460  FAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQD  281
            F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  KE FIQ+
Sbjct  398  FEAYVKQRGYILYTPSEYGKFIQEAGFCNVRVEDRTAQFIQVIQTELQRAEDIKEEFIQE  457

Query  280  FSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FSEEDY+ IV GW+ KL R+ SG+QRWGL
Sbjct  458  FSEEDYSAIVDGWREKLDRSKSGDQRWGL  486



>emb|CDX72992.1| BnaC06g34400D [Brassica napus]
Length=161

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  460  FAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQD  281
            FA YIKQRGYDLHD + YGQML+DAGF++VIAEDRTDQFMKVLK ELDAVEKEK+ FI  
Sbjct  96   FANYIKQRGYDLHDVQTYGQMLKDAGFDEVIAEDRTDQFMKVLKGELDAVEKEKDEFISL  155

Query  280  F  278
            F
Sbjct  156  F  156



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            + EF AY+K+RGY L+   +YG+++ +AGF +V A DRT+QF++VLK EL   +  K  F
Sbjct  391  NPEFEAYVKKRGYILYTPSQYGKVIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKTQF  450

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSEEDY  IV GW  KL R++SG QRWGL
Sbjct  451  IQEFSEEDYFAIVNGWSDKLKRSNSGAQRWGL  482



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 18/93 (19%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFA YIKQRGYDLHD E YGQ                  F+ VL+KELD  EK K+ 
Sbjct  404  PSEEFATYIKQRGYDLHDVEAYGQ------------------FLSVLQKELDKFEKNKDD  445

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  446  FLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  478



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            + EF AY+K+RGY L+   +YG+++ +AGF +V A DRT+QF++VLK EL   +  K  F
Sbjct  394  NPEFEAYVKKRGYILYTPSQYGKVIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKTQF  453

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSEEDY  IV GW  KL R++SG QRWGL
Sbjct  454  IQEFSEEDYFAIVNGWSDKLKRSNSGAQRWGL  485



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            + EF AY+K+RGY L+   +YG+++ +AGF +V A DRT+QF++VLK EL   +  K  F
Sbjct  398  NPEFEAYVKKRGYILYTPSQYGKVIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKTQF  457

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            IQ+FSEEDY  IV GW  KL R++SG QRWGL
Sbjct  458  IQEFSEEDYFAIVNGWSDKLKRSNSGAQRWGL  489



>ref|XP_009012150.1| hypothetical protein HELRODRAFT_183893 [Helobdella robusta]
 gb|ESO09748.1| hypothetical protein HELRODRAFT_183893 [Helobdella robusta]
Length=406

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S++F AY+KQRGY L   E YG++L + GFE V A+DRTDQF+ +L+KE++ V   ++AF
Sbjct  309  SDDFEAYVKQRGYILLSVERYGKLLEEVGFERVQAQDRTDQFVDILRKEIERVVASRDAF  368

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            ++DF+E DY  +V GW  KL R   G+Q+WGL
Sbjct  369  LKDFTESDYRALVDGWMSKLKRCDKGDQKWGL  400



>emb|CCA16454.1| phosphoethanolamine Nmethyltransferase putative [Albugo laibachii 
Nc14]
Length=494

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            P+  FA Y++ RGY L   E YG +L +AGF +VIAEDRT QFM +L++ELD     K+ 
Sbjct  396  PTNRFADYVQGRGYHLLTVEAYGALLTEAGFRNVIAEDRTRQFMNILREELDRTVSSKDE  455

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FIQ+ S +D+N IV GW+ KL R   G+QRWG 
Sbjct  456  FIQETSNDDFNAIVKGWEAKLIRCDEGDQRWGF  488



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 61/93 (66%), Gaps = 18/93 (19%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PSEEFAAYIKQRGYDLHD   YGQ                  F+ VL++EL  VEK K  
Sbjct  377  PSEEFAAYIKQRGYDLHDVRAYGQ------------------FLDVLERELAKVEKNKNE  418

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  419  FVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  451



>ref|XP_003970259.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Takifugu 
rubripes]
Length=484

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -2

Query  460  FAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQD  281
            F  Y+KQRGY L+   +YG+ L +AGF +V+AEDRT QF++V++ EL+  E  ++ FI++
Sbjct  390  FETYVKQRGYILYTPPQYGKFLTEAGFCNVLAEDRTAQFIQVIETELERAEAIRKEFIEE  449

Query  280  FSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FS+EDY  IV GWK KL R+ SG+QRWGL
Sbjct  450  FSDEDYLAIVNGWKEKLARSKSGDQRWGL  478



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS EFA YIK+ GY +HD +EY QML +AGF DVI EDRTDQF+K L++EL  +E +K+ 
Sbjct  397  PSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVIVEDRTDQFVKTLQQELITLESQKDD  455

Query  292  FIQDFSE-EDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FI DFS  +DY++IV  WK K  R   GEQ+WGL
Sbjct  456  FISDFSNVDDYDEIVERWKAKQIRGERGEQKWGL  489



>gb|AAI35513.1| LOC100124841 protein [Xenopus (Silurana) tropicalis]
Length=486

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S  F  Y+KQRGY L+  +EYGQ L  AGF +V A+DRT+QF+ VL KEL   +  K+ F
Sbjct  384  SPVFQEYVKQRGYILYTPQEYGQFLEKAGFVNVQAQDRTEQFVNVLNKELGRTQDIKKEF  443

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I+ FSEEDYN I+ GWK K  R S G+QRWGL
Sbjct  444  IESFSEEDYNYIIDGWKEKQHRCSLGDQRWGL  475



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S  F  Y+KQRGY L+  +EYGQ L  AGF +V A+DRT+QF+ VL KEL   +  K+ F
Sbjct  392  SPVFQEYVKQRGYILYTPQEYGQFLEKAGFVNVQAQDRTEQFVNVLNKELGRTQDIKKEF  451

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I+ FSEEDYN I+ GWK K  R S G+QRWGL
Sbjct  452  IESFSEEDYNYIIDGWKEKQHRCSLGDQRWGL  483



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -2

Query  472  PSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEA  293
            PS E   Y+++R YDLH  + YG ML++AGFEDVIAEDRTDQF++VL +EL+ V+KEKE 
Sbjct  376  PSLEVVEYMERRRYDLHGVQAYGNMLKEAGFEDVIAEDRTDQFIQVLSRELEKVKKEKEE  435

Query  292  FIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            +I DFSE DYNDIV  W  KL + +S E +WGL
Sbjct  436  YISDFSEGDYNDIVRVWTAKLRKAASNELKWGL  468



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -2

Query  460  FAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQD  281
            F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  K+ FIQ+
Sbjct  398  FEAYVKQRGYILYTPSEYGKFVQEAGFCNVRVEDRTAQFIEVIQTELQRAEDIKDEFIQE  457

Query  280  FSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FSEEDY  IV GW+ KL R+ SG+QRWGL
Sbjct  458  FSEEDYLAIVNGWREKLDRSKSGDQRWGL  486



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -2

Query  460  FAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQD  281
            F AY+KQRGY L+   EYG+ +++AGF +V  EDRT QF++V++ EL   E  K+ FIQ+
Sbjct  397  FEAYVKQRGYILYTPSEYGKFVQEAGFCNVRVEDRTAQFIEVIQTELQRAEDIKDEFIQE  456

Query  280  FSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FSEEDY  IV GW+ KL R+ SG+QRWGL
Sbjct  457  FSEEDYLAIVNGWREKLDRSKSGDQRWGL  485



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -2

Query  460  FAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQD  281
            +A YIK+ GY +HD + Y +ML +AGF+DV+AEDRT+ FMK L++EL+A+  +K+ FI D
Sbjct  438  YAEYIKKGGYYIHDMKTYCRMLENAGFDDVVAEDRTNLFMKTLQQELNALHSKKDDFIDD  497

Query  280  FSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            FSEEDYN+I   WK K  R + GEQ W L
Sbjct  498  FSEEDYNEITERWKAKQMRGADGEQIWSL  526



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S E+A YIK+RGY +HD   Y QML +AGF+ VI +D+T+ F+K L+KEL+++E +K  F
Sbjct  399  SIEYAEYIKKRGYYIHDMNAYCQMLENAGFDYVIDQDQTNLFLKTLQKELNSLENKKVDF  458

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I +FSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  459  INEFSEDDYNEIVERWKAKKMRGEAGEQIWGL  490



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            S E+A YIK+RGY +HD   Y QML +AGF+ VI +D+T+ F+K L+KEL+++E +K  F
Sbjct  400  SIEYAEYIKKRGYYIHDMNAYCQMLENAGFDYVIDQDQTNLFLKTLQKELNSLENKKVDF  459

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I +FSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  460  INEFSEDDYNEIVERWKAKKMRGEAGEQIWGL  491



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   +YG+ +++AGF +V A+DRT  F++V+K EL   E  K+ +
Sbjct  395  TPAFEAYVKQRGYVLYTPTQYGKFIQEAGFSNVRADDRTGHFIQVIKTELQRAEAIKDDY  454

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  455  IKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            +  F AY+KQRGY L+   +YG+ +++AGF +V A+DRT  F++V+K EL   E  K+ +
Sbjct  413  TPAFEAYVKQRGYVLYTPTQYGKFIQEAGFSNVRADDRTGHFIQVIKTELQRAEAIKDDY  472

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  473  IKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  504



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            + +F  Y+KQRGY L+   +YG+ L+ AGF +V AEDRT QFM+V++ EL+     K+ F
Sbjct  398  TPQFQEYVKQRGYILYTPPQYGKFLQQAGFSNVRAEDRTAQFMQVIQTELERAAAMKDEF  457

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  IV GW  KL R  +G+QRWGL
Sbjct  458  IKEFSEEDYLAIVNGWSDKLKRCKTGDQRWGL  489



>ref|XP_010864863.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Esox 
lucius]
Length=495

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  469  SEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAF  290
            + +F  Y+KQRGY L+   +YG+ L  AGF DV AEDRT QFM+V++ EL      K+ F
Sbjct  398  TPQFQEYVKQRGYILYTPPQYGKFLEQAGFSDVRAEDRTAQFMQVIEMELARAVPIKDEF  457

Query  289  IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  194
            I++FSEEDY  I+ GW  KL R ++G+QRWGL
Sbjct  458  IKEFSEEDYLAIINGWSEKLQRCTTGDQRWGL  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180