BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051B01

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN33816.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    301   7e-99   Glycine soja [wild soybean]
emb|CBI18876.3|  unnamed protein product                                304   2e-97   Vitis vinifera
gb|ACN35033.1|  unknown                                                 301   6e-97   Zea mays [maize]
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    308   7e-97   Cucumis melo [Oriental melon]
ref|NP_001183829.1|  uncharacterized protein LOC100502422               300   1e-96   Zea mays [maize]
ref|XP_006656509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    300   3e-96   Oryza brachyantha
emb|CAN74077.1|  hypothetical protein VITISV_000978                     304   4e-96   Vitis vinifera
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    305   5e-96   Cicer arietinum [garbanzo]
gb|EEC81336.1|  hypothetical protein OsI_24516                          302   1e-95   Oryza sativa Indica Group [Indian rice]
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             304   1e-95   Phaseolus vulgaris [French bean]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    304   2e-95   Vitis vinifera
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    303   3e-95   Setaria italica
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    303   3e-95   Nelumbo nucifera [Indian lotus]
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    303   4e-95   Sesamum indicum [beniseed]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    303   4e-95   Sesamum indicum [beniseed]
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    302   4e-95   Glycine max [soybeans]
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         303   5e-95   Jatropha curcas
dbj|BAJ85305.1|  predicted protein                                      288   5e-95   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002510649.1|  Cell division protease ftsH, putative              302   7e-95   
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    301   9e-95   
ref|NP_001058625.1|  Os06g0725900                                       301   9e-95   
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    302   1e-94   Cucumis sativus [cucumbers]
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          301   1e-94   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    301   1e-94   
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    301   2e-94   Citrus sinensis [apfelsine]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             301   2e-94   Citrus clementina [clementine]
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    299   2e-93   Tarenaya hassleriana [spider flower]
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    298   2e-93   Eucalyptus grandis [rose gum]
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            297   8e-93   Morus notabilis
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    296   2e-92   Populus euphratica
emb|CDP07308.1|  unnamed protein product                                296   2e-92   Coffea canephora [robusta coffee]
ref|XP_002301927.1|  Cell division protein ftsH                         296   2e-92   Populus trichocarpa [western balsam poplar]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    296   2e-92   Populus euphratica
emb|CDX96068.1|  BnaA07g26630D                                          295   2e-92   
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    295   2e-92   Brassica rapa
emb|CDY01840.1|  BnaC06g28800D                                          295   3e-92   
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    295   4e-92   Gossypium arboreum [tree cotton]
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       295   4e-92   
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    295   6e-92   Elaeis guineensis
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             295   6e-92   Arabidopsis lyrata subsp. lyrata
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   7e-92   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    295   9e-92   Camelina sativa [gold-of-pleasure]
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    295   9e-92   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   1e-91   Camelina sativa [gold-of-pleasure]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             294   1e-91   Arabidopsis thaliana [mouse-ear cress]
gb|EMS62975.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    288   1e-91   Triticum urartu
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             294   1e-91   Capsella rubella
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   1e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             294   2e-91   Eutrema salsugineum [saltwater cress]
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          292   5e-91   Amborella trichopoda
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    291   5e-91   Brachypodium distachyon [annual false brome]
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   5e-91   Phoenix dactylifera
ref|XP_002306970.2|  Cell division protein ftsH                         292   6e-91   Populus trichocarpa [western balsam poplar]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             292   6e-91   Prunus persica
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   7e-91   Prunus mume [ume]
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         282   3e-89   Medicago truncatula
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    287   5e-89   Fragaria vesca subsp. vesca
gb|EMT09942.1|  Cell division protease ftsH-like protein, chlorop...    286   6e-89   
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    286   8e-89   Nicotiana sylvestris
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    286   1e-88   Solanum tuberosum [potatoes]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    285   1e-88   Genlisea aurea
emb|CAA68141.1|  chloroplast FtsH protease                              285   2e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    285   3e-88   Nicotiana tomentosiformis
ref|NP_001234196.1|  FtsH-like protein precursor                        285   3e-88   
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    285   4e-88   Pyrus x bretschneideri [bai li]
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    285   4e-88   
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    284   8e-88   Nicotiana tomentosiformis
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    284   8e-88   Nicotiana sylvestris
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    283   3e-87   
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    282   4e-87   Nicotiana tabacum [American tobacco]
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         281   1e-86   Medicago truncatula
gb|KJB14314.1|  hypothetical protein B456_002G118800                    280   1e-86   Gossypium raimondii
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                280   2e-86   Erythranthe guttata [common monkey flower]
gb|KJB14315.1|  hypothetical protein B456_002G118800                    280   2e-86   Gossypium raimondii
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    280   2e-86   Gossypium arboreum [tree cotton]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    274   4e-84   Medicago sativa [alfalfa]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             268   3e-82   
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    267   2e-81   Arabis alpina [alpine rockcress]
dbj|BAH20236.1|  AT5G42270                                              260   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    264   3e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             264   4e-80   Capsella rubella
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             263   4e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    263   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    263   7e-80   Camelina sativa [gold-of-pleasure]
emb|CAA73318.1|  ATPase                                                 261   8e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             262   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             262   1e-79   
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    261   5e-79   Camelina sativa [gold-of-pleasure]
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     259   2e-78   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_001760664.1|  predicted protein                                  247   2e-74   
ref|XP_001753657.1|  predicted protein                                  247   3e-74   
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    242   2e-72   Capsicum annuum
gb|AIS72760.1|  ATP-dependent zinc metalloprotease chloroplastic-...    225   3e-70   Rhizophora apiculata
gb|KJB57987.1|  hypothetical protein B456_009G188700                    214   1e-61   Gossypium raimondii
ref|XP_005650371.1|  membrane AAA-metalloprotease                       200   2e-56   Coccomyxa subellipsoidea C-169
ref|XP_007510744.1|  cell division protein FtsH2                        199   4e-56   Bathycoccus prasinos
gb|KIY93255.1|  cell division protease FtsH                             190   1e-53   Monoraphidium neglectum
gb|KIZ03250.1|  cell division protease FtsH                             192   1e-53   Monoraphidium neglectum
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              192   2e-53   Volvox carteri f. nagariensis
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit           189   9e-53   Leptolyngbya sp. PCC 7375
ref|XP_001690889.1|  membrane AAA-metalloprotease                       189   1e-52   Chlamydomonas reinhardtii
ref|WP_023072541.1|  membrane protease catalytic subunit                188   1e-52   Leptolyngbya sp. Heron Island J
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 186   1e-51   Micromonas commoda
ref|WP_025961749.1|  hypothetical protein                               175   3e-51   
ref|WP_044452063.1|  cell division protein FtsH                         179   9e-51   Mastigocladus laminosus
ref|XP_003057154.1|  predicted protein                                  184   9e-51   Micromonas pusilla CCMP1545
ref|WP_025929131.1|  hypothetical protein                               175   1e-50   
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    183   2e-50   Auxenochlorella protothecoides
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH           181   4e-50   Fischerella thermalis
ref|WP_035992112.1|  cell division protein FtsH                         181   5e-50   Leptolyngbya sp. KIOST-1
dbj|BAH20250.1|  AT5G42270                                              172   7e-50   Arabidopsis thaliana [mouse-ear cress]
ref|WP_017320405.1|  cell division protein FtsH                         180   2e-49   cyanobacterium PCC 7702
gb|ADF81075.1|  FtsH                                                    171   2e-49   Corallina officinalis
ref|WP_044106285.1|  cell division protein FtsH                         179   2e-49   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_017312914.1|  cell division protein FtsH                         179   2e-49   Fischerella sp. PCC 9339
ref|WP_017297226.1|  cell division protein FtsH                         179   2e-49   Nodosilinea nodulosa
ref|WP_016862523.1|  cell division protein FtsH                         179   2e-49   Fischerella muscicola
ref|WP_029963924.1|  cell division protein FtsH                         174   2e-49   
ref|WP_025947145.1|  cell division protein FtsH                         174   3e-49   
ref|WP_026723275.1|  cell division protein FtsH                         179   3e-49   Hapalosiphonaceae
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH                 179   4e-49   Stanieria cyanosphaera
ref|WP_012593655.1|  MULTISPECIES: cell division protein FtsH           179   4e-49   Cyanothece
ref|WP_006911156.1|  cell division protein FtsH                         179   5e-49   Cyanobium sp. PCC 7001
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit           178   5e-49   Cyanobacteria [blue-green bacteria]
ref|WP_016867387.1|  cell division protein FtsH                         178   6e-49   Fischerella muscicola
ref|WP_010871638.1|  cell division protein FtsH                         178   7e-49   Synechocystis
ref|WP_029759589.1|  cell division protein FtsH                         167   1e-48   
gb|KGG30054.1|  cell division protein FtsH2                             174   1e-48   Prochlorococcus sp. MIT 0703
ref|WP_036973151.1|  cell division protein FtsH                         174   1e-48   Prochlorococcus sp. MIT 0703
ref|WP_006453661.1|  cell division protein FtsH                         177   1e-48   Synechococcus sp. PCC 7335
ref|WP_016876546.1|  cell division protein FtsH                         177   2e-48   Chlorogloeopsis fritschii
dbj|GAL91410.1|  cell division protein FtsH                             177   2e-48   Microcystis aeruginosa NIES-44
ref|WP_025970576.1|  cell division protein FtsH                         173   2e-48   
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...    177   2e-48   Microcystis aeruginosa
ref|WP_009556886.1|  ATP-dependent metalloprotease FtsH                 177   2e-48   Oscillatoriales cyanobacterium JSC-12
gb|EAM48267.1|  Peptidase M41                                           166   2e-48   Crocosphaera watsonii WH 8501
ref|WP_002797753.1|  cell division protein FtsH                         177   2e-48   Microcystis aeruginosa
ref|WP_008275101.1|  cell division protein FtsH                         177   2e-48   Cyanothece sp. CCY0110
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH           177   2e-48   Microcystis
ref|WP_017303138.1|  cell division protein FtsH                         176   3e-48   Spirulina subsalsa
ref|WP_042712540.1|  hypothetical protein                               166   3e-48   
ref|WP_026097926.1|  cell division protein FtsH                         176   3e-48   Geitlerinema sp. PCC 7105
ref|WP_006102026.1|  cell division protein FtsH                         176   3e-48   Coleofasciculus chthonoplastes
ref|WP_002771354.1|  cell division protein FtsH                         176   3e-48   Microcystis aeruginosa
ref|WP_039716361.1|  cell division protein FtsH                         176   3e-48   
ref|WP_002793446.1|  cell division protein FtsH                         176   3e-48   Microcystis aeruginosa
ref|WP_002742170.1|  cell division protein FtsH                         176   4e-48   Microcystis
ref|WP_026730933.1|  cell division protein FtsH                         176   4e-48   Fischerella sp. PCC 9605
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3          176   4e-48   Microcystis aeruginosa
ref|WP_002801795.1|  cell division protein FtsH                         176   4e-48   Microcystis aeruginosa
ref|WP_028949001.1|  cell division protein FtsH                         176   4e-48   Synechocystis sp. PCC 6714
ref|WP_025954333.1|  cell division protein FtsH                         173   5e-48   
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit           176   5e-48   Cyanobacteria [blue-green bacteria]
ref|WP_013320241.1|  cell division protein FtsH                         176   5e-48   Cyanothece sp. PCC 7822
ref|WP_027255466.1|  cell division protein FtsH                         176   5e-48   Planktothrix agardhii
ref|WP_012264056.1|  cell division protein FtsH                         176   6e-48   Microcystis aeruginosa
gb|KIE06858.1|  cell division protein FtsH                              176   6e-48   Tolypothrix bouteillei VB521301
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit           176   6e-48   Cyanobacterium aponinum
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH           175   6e-48   Planktothrix
ref|WP_026786321.1|  cell division protein FtsH                         175   6e-48   Planktothrix rubescens
ref|WP_025971093.1|  cell division protein FtsH                         173   8e-48   
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH           175   8e-48   Lyngbya confervoides
ref|WP_042152619.1|  cell division protein FtsH                         175   8e-48   Planktothrix agardhii
ref|WP_027249137.1|  cell division protein FtsH                         175   8e-48   Planktothrix agardhii
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH           175   1e-47   Cyanothece
gb|ABX08179.1|  cell division protein FtsH2                             175   1e-47   Prochlorococcus marinus str. MIT 9211
ref|WP_041391000.1|  cell division protein FtsH                         175   1e-47   Prochlorococcus marinus
emb|CCH67048.1|  Cell division protein FtsH                             172   1e-47   Richelia intracellularis HH01
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3                175   1e-47   Thermosynechococcus sp. NK55a
ref|WP_028953545.1|  cell division protein FtsH                         175   1e-47   Synechococcus sp. CC9616
ref|WP_011055986.1|  cell division protein FtsH                         174   1e-47   Thermosynechococcus
gb|KGF94553.1|  cell division protein FtsH2                             174   1e-47   Prochlorococcus marinus str. MIT 9201
ref|WP_011826974.1|  cell division protein FtsH                         174   1e-47   Prochlorococcus sp. MIT 1306
ref|WP_017293936.1|  cell division protein FtsH                         174   1e-47   Geminocystis herdmanii
ref|WP_032522853.1|  cell division protein FtsH                         174   1e-47   Prochlorococcus marinus
ref|WP_017715041.1|  cell division protein FtsH                         174   1e-47   Oscillatoria sp. PCC 10802
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH           174   1e-47   Prochlorococcus
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH                 174   2e-47   Rubidibacter lacunae
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH                 174   2e-47   Microcoleus sp. PCC 7113
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit           174   2e-47   Crinalium epipsammum
ref|WP_035155002.1|  cell division protein FtsH                         174   2e-47   Calothrix sp. 336/3
ref|WP_017743955.1|  cell division protein FtsH                         174   2e-47   Scytonema hofmannii
ref|WP_025944375.1|  cell division protein FtsH                         174   2e-47   
ref|WP_015109466.1|  ATP-dependent metalloprotease FtsH                 174   2e-47   Cyanobacteria [blue-green bacteria]
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH           174   2e-47   Synechococcus
ref|WP_025922112.1|  cell division protein FtsH                         174   2e-47   
ref|WP_025935637.1|  MULTISPECIES: cell division protein FtsH           174   2e-47   
ref|WP_025958220.1|  cell division protein FtsH                         173   2e-47   
ref|WP_017291153.1|  cell division protein FtsH                         174   2e-47   Leptolyngbya boryana
ref|WP_036531425.1|  cell division protein FtsH                         174   2e-47   Neosynechococcus sphagnicola
ref|WP_015955558.1|  cell division protein FtsH                         174   3e-47   Cyanothece sp. PCC 7424
ref|WP_036901462.1|  cell division protein FtsH                         174   3e-47   Prochlorococcus sp. MIT 0601
ref|WP_025900256.1|  MULTISPECIES: cell division protein FtsH           174   3e-47   
ref|WP_038331075.1|  cell division protein FtsH                         174   3e-47   filamentous cyanobacterium ESFC-1
ref|WP_006623490.1|  cell division protein FtsH                         174   3e-47   
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH           174   3e-47   Arthrospira
ref|WP_006618677.1|  FtsH peptidase                                     174   3e-47   Arthrospira platensis
ref|XP_001419590.1|  predicted protein                                  174   3e-47   Ostreococcus lucimarinus CCE9901
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH                 174   3e-47   Xenococcus sp. PCC 7305
ref|WP_025951376.1|  cell division protein FtsH                         174   3e-47   
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH           173   3e-47   Synechococcus
ref|WP_025969610.1|  cell division protein FtsH                         174   3e-47   
ref|WP_025964562.1|  cell division protein FtsH                         173   3e-47   
ref|WP_025980194.1|  cell division protein FtsH                         173   3e-47   
ref|WP_025890345.1|  MULTISPECIES: cell division protein FtsH           173   3e-47   Prochlorococcus sp. HOT208_60m_808M21
ref|WP_032519670.1|  cell division protein FtsH                         173   3e-47   Prochlorococcus marinus
ref|WP_025959316.1|  cell division protein FtsH                         173   3e-47   
ref|WP_025971671.1|  cell division protein FtsH                         173   4e-47   
ref|WP_025924120.1|  MULTISPECIES: cell division protein FtsH           173   4e-47   Prochlorococcus marinus
ref|WP_032515715.1|  cell division protein FtsH                         173   4e-47   Prochlorococcus marinus
ref|WP_025892538.1|  cell division protein FtsH                         173   4e-47   
gb|KGG03814.1|  Cell division protein FtsH                              173   4e-47   Prochlorococcus marinus str. MIT 9321
ref|WP_025939914.1|  MULTISPECIES: cell division protein FtsH           173   4e-47   
ref|WP_008230065.1|  Cell division protein FtsH                         173   4e-47   Richelia intracellularis
ref|WP_025967396.1|  cell division protein FtsH                         173   4e-47   
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH                 173   4e-47   Synechocystis sp. PCC 7509
ref|WP_011862269.1|  cell division protein FtsH                         173   4e-47   Prochlorococcus marinus
ref|WP_032517345.1|  cell division protein FtsH                         173   4e-47   Prochlorococcus marinus
emb|CDN17247.1|  Cell division protein FtsH                             173   4e-47   Richelia intracellularis
ref|WP_028082599.1|  cell division protein FtsH                         173   4e-47   Dolichospermum circinale
ref|WP_028090468.1|  cell division protein FtsH                         173   4e-47   Dolichospermum circinale
ref|WP_011131165.1|  cell division protein FtsH                         173   5e-47   Prochlorococcus marinus
gb|KGG06312.1|  Cell division protein FtsH                              173   5e-47   Prochlorococcus marinus str. MIT 9322
ref|WP_037224718.1|  cell division protein FtsH                         173   5e-47   
ref|WP_024546675.1|  cell division protein FtsH                         173   5e-47   Synechococcus
ref|WP_006278775.1|  cell division protein FtsH                         172   7e-47   Cylindrospermopsis
ref|WP_035832496.1|  cell division protein FtsH                         172   7e-47   
ref|WP_009341877.1|  cell division protein FtsH                         172   7e-47   Aphanizomenonaceae
ref|WP_025929709.1|  cell division protein FtsH                         172   7e-47   
ref|WP_025922823.1|  cell division protein FtsH                         172   8e-47   
ref|WP_012411183.1|  cell division protein FtsH                         172   9e-47   Nostoc
ref|WP_025937982.1|  cell division protein FtsH                         172   9e-47   
gb|AIQ94296.1|  Cell division protein FtsH                              172   9e-47   Prochlorococcus sp. MIT 0604
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit                172   9e-47   Moorea producens 3L
ref|WP_025956453.1|  MULTISPECIES: cell division protein FtsH           172   9e-47   
ref|WP_025941250.1|  cell division protein FtsH                         172   1e-46   
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH                 172   1e-46   Pleurocapsa minor
ref|WP_002806664.1|  cell division protein FtsH                         172   1e-46   Prochlorococcus marinus
ref|WP_025925903.1|  cell division protein FtsH                         172   1e-46   
ref|WP_025914082.1|  cell division protein FtsH                         172   1e-46   
ref|WP_025933036.1|  cell division protein FtsH                         172   1e-46   
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit           172   1e-46   Oscillatoria nigro-viridis
ref|WP_042849723.1|  cell division protein FtsH                         172   1e-46   Prochlorococcus sp. MIT 0604
ref|WP_011817719.1|  cell division protein FtsH                         172   1e-46   Prochlorococcus marinus
ref|WP_044492620.1|  cell division protein FtsH                         172   1e-46   Moorea producens
ref|WP_010995433.1|  cell division protein FtsH                         172   1e-46   Nostocaceae
ref|WP_025921388.1|  MULTISPECIES: cell division protein FtsH           172   1e-46   
ref|WP_025979191.1|  cell division protein FtsH                         172   1e-46   
ref|WP_012007029.1|  cell division protein FtsH                         172   1e-46   Prochlorococcus marinus
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH                 172   1e-46   Nostoc sp. PCC 7524
ref|WP_025937318.1|  cell division protein FtsH                         172   1e-46   
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit           172   1e-46   
ref|WP_038542994.1|  cell division protein FtsH                         172   1e-46   Synechococcus sp. KORDI-100
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit           172   1e-46   Rivularia sp. PCC 7116
gb|KGF88464.1|  cell division protein FtsH2                             171   1e-46   Prochlorococcus marinus str. GP2
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit           172   1e-46   Halothece sp. PCC 7418
ref|WP_025965256.1|  cell division protein FtsH                         172   1e-46   Prochlorococcus sp. HOT208_60m_805A16
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit           172   1e-46   Leptolyngbya sp. PCC 7376
ref|WP_036001623.1|  cell division protein FtsH                         172   1e-46   [Leptolyngbya] sp. JSC-1
ref|WP_025925013.1|  MULTISPECIES: cell division protein FtsH           172   1e-46   
ref|WP_025971407.1|  cell division protein FtsH                         171   2e-46   
ref|WP_019506377.1|  cell division protein FtsH                         171   2e-46   Pleurocapsa sp. PCC 7319
ref|WP_027841867.1|  cell division protein FtsH                         171   2e-46   Mastigocoleus testarum
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit           171   2e-46   Oscillatoria acuminata
ref|WP_025981174.1|  cell division protein FtsH                         171   2e-46   
ref|WP_032523992.1|  cell division protein FtsH                         171   2e-46   Prochlorococcus marinus
ref|WP_011936606.1|  cell division protein FtsH                         171   2e-46   
ref|WP_011819579.1|  cell division protein FtsH                         171   2e-46   Prochlorococcus marinus
ref|WP_015162315.1|  ATP-dependent metalloprotease FtsH                 171   2e-46   Chamaesiphon minutus
ref|WP_006042287.1|  cell division protein FtsH                         171   2e-46   Synechococcus sp. WH 7805
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit           171   2e-46   Geitlerinema sp. PCC 7407
ref|WP_011932280.1|  cell division protein FtsH                         171   2e-46   Synechococcus sp. WH 7803
ref|WP_011375794.1|  cell division protein FtsH                         171   2e-46   Prochlorococcus marinus
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit           171   2e-46   Synechococcus sp. PCC 6312
ref|WP_007099803.1|  cell division protein FtsH                         171   3e-46   Synechococcus sp. RS9916
ref|WP_032514590.1|  cell division protein FtsH                         171   3e-46   Prochlorococcus marinus
ref|WP_019474071.1|  MULTISPECIES: cell division protein FtsH           171   3e-46   
ref|WP_029633975.1|  cell division protein FtsH [                       171   3e-46   [Scytonema hofmanni] UTEX B 1581
ref|WP_013189950.1|  cell division protein FtsH                         171   3e-46   Trichormus azollae
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)          171   3e-46   
ref|WP_019476442.1|  cell division protein FtsH                         171   3e-46   
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH                 171   4e-46   
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit           171   4e-46   
ref|WP_007100703.1|  cell division protein FtsH                         170   4e-46   
ref|WP_006853632.1|  cell division protein FtsH                         170   4e-46   
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit           170   4e-46   
ref|WP_012162910.1|  cell division protein FtsH                         170   5e-46   
ref|WP_016949229.1|  cell division protein FtsH                         170   5e-46   
ref|WP_040935720.1|  cell division protein FtsH                         170   5e-46   
gb|KGG16707.1|  Cell division protein FtsH                              170   5e-46   
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit           170   5e-46   
ref|WP_043694696.1|  cell division protein FtsH                         170   5e-46   
ref|WP_027401619.1|  cell division protein FtsH                         170   5e-46   
ref|WP_011618327.1|  cell division protein FtsH                         170   5e-46   
ref|WP_019478058.1|  cell division protein FtsH                         170   5e-46   
ref|WP_011131865.1|  cell division protein FtsH                         170   5e-46   
ref|WP_019494535.1|  cell division protein FtsH                         170   5e-46   
ref|WP_036922150.1|  cell division protein FtsH                         170   5e-46   
ref|WP_019477234.1|  cell division protein FtsH                         170   5e-46   
ref|WP_011317448.1|  cell division protein FtsH                         170   6e-46   
ref|WP_040054828.1|  cell division protein FtsH                         170   6e-46   
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH                 170   6e-46   
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH           170   6e-46   
ref|WP_036916506.1|  MULTISPECIES: cell division protein FtsH           170   7e-46   
ref|WP_006633639.1|  cell division protein FtsH                         170   7e-46   
ref|WP_041036156.1|  cell division protein FtsH                         170   7e-46   
ref|WP_036892144.1|  MULTISPECIES: cell division protein FtsH           170   7e-46   
ref|WP_011124410.1|  cell division protein FtsH                         169   8e-46   
ref|WP_026099187.1|  cell division protein FtsH                         169   8e-46   
ref|WP_012627305.1|  cell division protein FtsH                         169   9e-46   
ref|WP_039740989.1|  cell division protein FtsH                         169   9e-46   
ref|WP_036486108.1|  cell division protein FtsH                         169   9e-46   
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3          169   1e-45   
ref|WP_009782358.1|  cell division protein FtsH                         169   1e-45   
ref|WP_006172329.1|  cell division protein FtsH                         169   1e-45   
ref|WP_017315070.1|  cell division protein FtsH                         169   1e-45   
ref|WP_012954347.1|  cell division protein FtsH                         169   2e-45   
ref|WP_032527521.1|  cell division protein FtsH                         168   2e-45   
ref|WP_010311939.1|  cell division protein FtsH                         168   2e-45   
gb|AII47735.1|  cell division protein FtsH                              168   2e-45   
ref|WP_017653544.1|  cell division protein FtsH                         168   2e-45   
ref|WP_038551333.1|  cell division protein FtsH                         168   2e-45   
gb|KIJ85386.1|  cell division protein FtsH                              168   3e-45   
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                      168   3e-45   
ref|WP_011363329.1|  cell division protein FtsH                         168   3e-45   
gb|ADD94882.1|  FtsH peptidase                                          167   4e-45   
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH                 167   4e-45   
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit           167   7e-45   
ref|WP_011127179.1|  cell division protein FtsH                         166   1e-44   
ref|WP_011613138.1|  cell division protein FtsH                         166   1e-44   
ref|WP_015197493.1|  membrane protease FtsH catalytic subunit           166   1e-44   
ref|WP_011360789.1|  cell division protein FtsH                         166   2e-44   
gb|EHJ10086.1|  Cell division protein FtsH                              166   2e-44   
ref|WP_021830407.1|  Cell division protein FtsH                         166   2e-44   
ref|WP_010314566.1|  cell division protein FtsH                         166   2e-44   
ref|WP_021836615.1|  Cell division protein FtsH                         166   2e-44   
ref|WP_006198086.1|  cell division protein FtsH                         165   2e-44   
ref|WP_009788844.1|  cell division protein FtsH                         165   3e-44   
ref|WP_036906170.1|  cell division protein FtsH                         164   5e-44   
ref|WP_011294228.1|  cell division protein FtsH                         163   1e-43   
ref|WP_038651066.1|  cell division protein FtsH                         163   2e-43   
ref|WP_011823081.1|  cell division protein FtsH                         163   2e-43   
ref|YP_002049185.1|  cell division protein ftsH                         161   1e-42   
ref|XP_005713345.1|  cell division protein FtsH                         161   1e-42   
gb|ABH09265.1|  cell division protein                                   160   1e-42   
ref|WP_011141915.1|  cell division protein FtsH                         160   2e-42   
ref|WP_015165890.1|  ATP-dependent metalloprotease FtsH                 158   1e-41   
ref|WP_019500986.1|  cell division protein FtsH                         156   4e-41   
ref|WP_015167033.1|  ATP-dependent metalloprotease FtsH                 156   4e-41   
ref|WP_023174221.1|  ATP-dependent metalloprotease FtsH                 156   5e-41   
ref|XP_005708438.1|  AAA-type ATPase                                    155   2e-40   
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435              154   4e-40   
ref|WP_017324919.1|  hypothetical protein                               152   1e-39   
ref|WP_009628744.1|  membrane protease FtsH catalytic subunit           151   2e-39   
ref|XP_005538209.1|  cell division protein FtsH                         151   7e-39   
ref|WP_011432278.1|  cell division protein FtsH                         146   2e-37   
ref|WP_011431525.1|  cell division protein FtsH                         145   3e-37   
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                145   5e-37   
ref|XP_002287516.1|  metalloprotease                                    144   8e-37   
ref|WP_025953358.1|  hypothetical protein                               134   6e-35   
gb|EJK55379.1|  hypothetical protein THAOC_24887                        139   8e-35   
ref|XP_005708136.1|  AAA-type ATPase                                    140   1e-34   
ref|WP_010468934.1|  cell division protein FtsH                         137   3e-34   
ref|XP_002177215.1|  predicted protein                                  137   3e-34   
ref|XP_002291485.1|  chloroplast ftsH                                   136   6e-34   
ref|WP_007573233.1|  cell division protein FtsH                         134   5e-33   
ref|WP_022658404.1|  ATP-dependent metalloprotease                      134   8e-33   
ref|WP_020990697.1|  ATP-dependent metallopeptidase HflB                134   1e-32   
ref|WP_009302174.1|  ATP-dependent metalloprotease                      134   1e-32   
ref|WP_029966908.1|  cell division protein FtsH                         133   1e-32   
ref|WP_031388311.1|  cell division protein FtsH                         132   2e-32   
ref|WP_022344010.1|  aTP-dependent metallopeptidase HflB subfamil...    132   2e-32   
gb|AFK49239.1|  unknown                                                 127   3e-32   
ref|WP_013167813.1|  cell division protein FtsH                         130   9e-32   
ref|YP_009027610.1|  putative plastid division protein                  130   1e-31   
gb|AHB35104.1|  putative plastid division protein                       130   1e-31   
gb|AHJ28404.1|  Cell division protein FtsH                              129   2e-31   
ref|WP_018867786.1|  MULTISPECIES: ATP-dependent metalloprotease        129   2e-31   
ref|WP_018875886.1|  MULTISPECIES: ATP-dependent metalloprotease        129   3e-31   
ref|WP_006199059.1|  cell division protein FtsH                         129   3e-31   
ref|WP_041424761.1|  cell division protein FtsH                         129   3e-31   
gb|ACZ41968.1|  ATP-dependent metalloprotease FtsH                      129   3e-31   
ref|WP_029353253.1|  cell division protein FtsH                         129   4e-31   
ref|WP_040369583.1|  cell division protein FtsH                         129   4e-31   
gb|EEB33527.1|  ATP-dependent metallopeptidase HflB                     129   4e-31   
ref|WP_028575310.1|  cell division protein FtsH                         129   4e-31   
ref|WP_025813603.1|  cell division protein FtsH                         128   5e-31   
ref|WP_039897212.1|  cell division protein FtsH                         128   5e-31   
ref|WP_010509124.1|  ATP-dependent metalloprotease                      129   5e-31   
gb|EAW34085.1|  ATP-dependent Zn protease                               128   5e-31   
ref|WP_019085078.1|  ATP-dependent metalloprotease                      128   6e-31   
ref|WP_025439397.1|  cell division protein FtsH                         128   6e-31   
ref|WP_028075997.1|  cell division protein FtsH                         128   6e-31   
ref|WP_014105290.1|  ATP-dependent metalloprotease                      128   7e-31   
ref|WP_010515139.1|  ATP-dependent metalloprotease                      128   7e-31   
ref|WP_039736338.1|  cell division protein FtsH                         128   7e-31   
ref|WP_026912872.1|  cell division protein FtsH                         128   8e-31   
ref|WP_018937957.1|  MULTISPECIES: ATP-dependent metalloprotease        128   8e-31   
ref|WP_039253834.1|  cell division protein FtsH                         128   8e-31   
ref|WP_044100239.1|  cell division protein FtsH                         125   9e-31   
ref|WP_018146241.1|  MULTISPECIES: ATP-dependent metalloprotease        128   9e-31   
ref|YP_007947857.1|  cell division protein                              127   1e-30   
ref|WP_019593923.1|  ATP-dependent metalloprotease                      128   1e-30   
ref|WP_015119379.1|  membrane protease FtsH catalytic subunit           127   1e-30   
ref|WP_021202559.1|  ATP-dependent metalloprotease                      125   1e-30   
ref|WP_009539845.1|  Cell division protein FtsH                         127   1e-30   
ref|WP_008600715.1|  Cell division protein FtsH                         127   1e-30   
ref|YP_537009.1|  cell division protein                                 127   1e-30   
gb|AHJ62937.1|  Cell division protein ftsH                              127   1e-30   
ref|WP_025286570.1|  cell division protein FtsH                         127   1e-30   
gb|ABI62008.1|  cell division protein ftsH                              127   2e-30   
gb|EIC91131.1|  cell division protein                                   127   2e-30   
ref|WP_025319020.1|  cell division protein FtsH                         127   2e-30   
gb|AIA21561.1|  putative plastid division protein                       127   2e-30   
ref|WP_040325573.1|  cell division protein FtsH                         127   2e-30   
ref|WP_025320702.1|  cell division protein FtsH                         127   2e-30   
ref|WP_022451567.1|  aTP-dependent metallopeptidase HflB subfamil...    127   2e-30   
gb|AHJ66492.1|  Cell division protein ftsH                              127   2e-30   
gb|ERT06334.1|  ATP-dependent zinc metalloprotease FtsH 2               127   2e-30   
ref|WP_012629618.1|  cell division protein FtsH                         127   2e-30   
ref|WP_044091481.1|  cell division protein FtsH                         125   2e-30   
ref|WP_014953638.1|  ATP-dependent metalloprotease                      127   2e-30   
ref|WP_039280930.1|  cell division protein FtsH                         127   2e-30   
ref|WP_043989340.1|  cell division protein FtsH                         127   2e-30   
ref|WP_040484213.1|  cell division protein FtsH                         127   2e-30   
ref|WP_021956530.1|  aTP-dependent zinc metalloprotease FtsH            125   2e-30   
gb|EDS77193.1|  putative Cell division protease FtsH homolog            127   2e-30   
gb|EWM30233.1|  atp-dependent metalloprotease                           128   2e-30   
ref|WP_018948798.1|  ATP-dependent metalloprotease                      127   2e-30   
ref|WP_020001211.1|  MULTISPECIES: ATP-dependent metalloprotease        127   2e-30   
ref|WP_017322954.1|  cell division protein FtsH                         127   2e-30   
ref|WP_034933766.1|  cell division protein FtsH                         127   2e-30   
ref|WP_007397745.1|  ATP-dependent metalloprotease                      127   2e-30   
ref|WP_024457297.1|  cell division protein FtsH                         125   3e-30   
ref|WP_044083473.1|  cell division protein FtsH                         125   3e-30   
ref|WP_018862431.1|  MULTISPECIES: ATP-dependent metalloprotease        126   3e-30   
ref|WP_009459923.1|  MULTISPECIES: cell division protein FtsH           126   3e-30   
ref|WP_016869882.1|  cell division protein FtsH                         126   4e-30   
ref|WP_044452899.1|  cell division protein FtsH                         124   4e-30   
ref|WP_040355337.1|  ATP-dependent metalloprotease                      126   4e-30   
gb|AIA21355.1|  putative plastid division protein                       126   4e-30   
ref|WP_026821300.1|  cell division protein FtsH                         126   4e-30   
gb|EEV88713.1|  ATP-dependent metallopeptidase HflB                     126   4e-30   
ref|WP_035262311.1|  cell division protein FtsH                         125   4e-30   
dbj|BAP57909.1|  ATP-dependent metalloprotease FtsH                     126   5e-30   
gb|EEC56194.1|  peptidase family M41 [                                  118   5e-30   
ref|WP_031282400.1|  hypothetical protein                               120   5e-30   
ref|WP_003622121.1|  ATP-dependent metalloprotease                      126   5e-30   
ref|WP_015124159.1|  membrane protease FtsH catalytic subunit           125   5e-30   
ref|WP_031741635.1|  cell division protein FtsH                         124   6e-30   
ref|WP_038051416.1|  ATP-dependent metalloprotease                      125   6e-30   
ref|WP_031579943.1|  ATP-dependent metalloprotease                      125   6e-30   
ref|WP_030002712.1|  cell division protein FtsH                         121   6e-30   
ref|WP_018141827.1|  MULTISPECIES: ATP-dependent metalloprotease        125   6e-30   
gb|EUB17058.1|  ATP-dependent metallopeptidase HflB                     125   7e-30   
ref|WP_008868524.1|  ATP-dependent metalloprotease                      125   7e-30   
ref|WP_041230214.1|  cell division protein FtsH                         125   7e-30   
ref|WP_022927575.1|  cell division protein FtsH                         125   8e-30   
ref|WP_021911811.1|  aTP-dependent zinc metalloprotease FtsH            125   8e-30   
ref|WP_006906849.1|  cell division protein FtsH                         125   9e-30   
ref|WP_027005838.1|  cell division protein FtsH                         125   9e-30   
gb|KBT05612.1|  ATP-dependent zinc metalloprotease FtsH                 124   9e-30   
ref|WP_044431154.1|  cell division protein FtsH                         125   9e-30   
ref|WP_026732891.1|  cell division protein FtsH                         125   9e-30   
gb|ADD68068.1|  ATP-dependent metalloprotease FtsH                      125   9e-30   
ref|WP_039925254.1|  cell division protein FtsH                         124   1e-29   
ref|YP_063571.1|  cell division protein                                 125   1e-29   
gb|AJH65894.1|  ATP-dependent zinc metalloprotease FtsH                 125   1e-29   
gb|EGG83421.1|  hypothetical protein HMPREF0992_01693                   124   1e-29   
ref|WP_027134335.1|  cell division protein FtsH                         125   1e-29   
ref|WP_016858941.1|  cell division protein FtsH                         125   1e-29   
ref|WP_037456026.1|  cell division protein FtsH                         125   1e-29   
ref|WP_039738012.1|  cell division protein FtsH                         124   1e-29   
ref|WP_020880561.1|  peptidase M41 FtsH domain protein                  125   1e-29   
ref|WP_026719681.1|  cell division protein FtsH                         124   1e-29   
ref|WP_035150451.1|  cell division protein FtsH                         124   1e-29   
ref|WP_037387595.1|  cell division protein FtsH                         124   1e-29   
gb|AFC39995.1|  cell division protein                                   124   1e-29   
gb|EKD09990.1|  ATP-dependent metalloprotease FtsH                      124   2e-29   
ref|WP_013191839.1|  cell division protein FtsH                         124   2e-29   
ref|WP_042084163.1|  cell division protein FtsH                         124   2e-29   
ref|WP_015153530.1|  membrane protease FtsH catalytic subunit           124   2e-29   
ref|WP_041436910.1|  cell division protein FtsH                         124   2e-29   
ref|WP_011939584.1|  ATP-dependent metalloprotease                      124   2e-29   
gb|AIF20054.1|  metalloprotease (ftsH, hflB)                            122   2e-29   
ref|WP_006668016.1|  MULTISPECIES: cell division protein FtsH           124   2e-29   
gb|ETJ19462.1|  ATP-dependent zinc metalloprotease FtsH                 118   2e-29   
ref|WP_020169145.1|  ATP-dependent metalloprotease                      124   2e-29   
ref|WP_014744429.1|  ATP-dependent metalloprotease                      124   2e-29   
ref|WP_016951384.1|  cell division protein FtsH                         124   2e-29   
gb|ABD01006.1|  metalloprotease, ATP-dependent, FtsH family             124   2e-29   
ref|WP_031750328.1|  cell division protein FtsH                         124   2e-29   
ref|WP_008946288.1|  ATP-dependent metalloprotease                      124   2e-29   
ref|WP_027080478.1|  ATP-dependent metalloprotease                      124   2e-29   
ref|WP_015170903.1|  membrane protease FtsH catalytic subunit           124   2e-29   
ref|WP_011056581.1|  cell division protein FtsH                         124   2e-29   
ref|WP_015216796.1|  membrane protease FtsH catalytic subunit           124   2e-29   
ref|WP_038041290.1|  cell division protein FtsH                         124   2e-29   
ref|WP_012408087.1|  cell division protein FtsH                         124   2e-29   
ref|WP_038061211.1|  cell division protein FtsH                         123   2e-29   



>gb|KHN33816.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Glycine 
soja]
Length=325

 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  172  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  231

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT IITTHID
Sbjct  232  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIITTHID  291

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  292  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  325



>emb|CBI18876.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  385  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  444

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHID
Sbjct  445  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHID  504

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  505  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  538



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  310  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  369

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHID
Sbjct  370  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHID  429

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  430  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  463



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   308 bits (788),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  562  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  621

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHID
Sbjct  622  SKKIGQIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQIITTHID  681

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  682  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|NP_001183829.1| uncharacterized protein LOC100502422 [Zea mays]
 gb|ACR38427.1| unknown [Zea mays]
Length=475

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  322  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  381

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHID
Sbjct  382  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHID  441

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  442  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  475



>ref|XP_006656509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Oryza brachyantha]
Length=475

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  322  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  381

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHID
Sbjct  382  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHID  441

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  442  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  475



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  510  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  569

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHID
Sbjct  570  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHID  629

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  630  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  663



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  560  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  619

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQM+TQKDYSMATADVVDAEVRELVE+AYSRATQII THID
Sbjct  620  SKKIGQVAIGGPGGNPFLGQQMATQKDYSMATADVVDAEVRELVEKAYSRATQIINTHID  679

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  680  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  477  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  536

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHID
Sbjct  537  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHID  596

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  597  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  630



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  556  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  615

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAT IITTHID
Sbjct  616  SKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATNIITTHID  675

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  676  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  709



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  553  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  612

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHID
Sbjct  613  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHID  672

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  673  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  706



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  532  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  591

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHID
Sbjct  592  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQIITTHID  651

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  652  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  685



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  567  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGF  626

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SK+IGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQIITTHID
Sbjct  627  SKRIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARATQIITTHID  686

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  687  ILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  720



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  550  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  609

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQIITTHID
Sbjct  610  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYTRATQIITTHID  669

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  670  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  703



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  550  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  609

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAY+RA QIITTHID
Sbjct  610  SKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYTRAKQIITTHID  669

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  670  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  703



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  543  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  602

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT IITTHID
Sbjct  603  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIITTHID  662

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  663  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  696



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  562  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  621

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA  IITTHID
Sbjct  622  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKHIITTHID  681

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  682  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  715



>dbj|BAJ85305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   288 bits (738),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  96   ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGF  155

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THID
Sbjct  156  SKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHID  215

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  216  ILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  249



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  539  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMVERFGF  598

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHID
Sbjct  599  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQIITTHID  658

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  659  ILHKLAQLLVEKETVDGEEFMSLFIDGKAELYVS  692



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  535  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  594

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHID
Sbjct  595  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHID  654

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  655  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  688



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  533  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  592

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHID
Sbjct  593  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHID  652

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  653  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  562  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  621

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRA QIITTH D
Sbjct  622  SKKIGQIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRAKQIITTHND  681

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  682  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  533  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  592

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHID
Sbjct  593  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHID  652

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  653  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  541  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  600

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT II+THID
Sbjct  601  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIISTHID  660

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  661  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  694



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  570  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGF  629

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHID
Sbjct  630  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHID  689

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  690  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  570  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGF  629

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHID
Sbjct  630  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHID  689

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  690  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQM+VALGGR+AEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  562  ERLESGLYSRSYLENQMSVALGGRIAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  621

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA QIITTHID
Sbjct  622  SKKIGQVAIGGSGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKQIITTHID  681

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV+
Sbjct  682  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVS  715



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  560  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGF  619

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAYSRA QI+TTH+D
Sbjct  620  SKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYSRAKQIMTTHVD  679

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  680  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  713



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  557  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  616

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA QI+TTHID
Sbjct  617  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKQILTTHID  676

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLA LLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  677  ILHKLALLLIEKETVDGEEFMSLFIDGKAELYVS  710



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  552  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGF  611

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA QI+TTHID
Sbjct  612  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHID  671

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  672  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  553  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGF  612

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA QI+TTHID
Sbjct  613  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRAKQIMTTHID  672

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEF+SLFIDGKAEL+VA
Sbjct  673  ILHKLAQLLIEKETVDGEEFLSLFIDGKAELYVA  706



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  551  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  610

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHID
Sbjct  611  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHID  670

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  671  ILHKLAQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  551  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  610

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHID
Sbjct  611  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHID  670

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  671  ILHKLAQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  522  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGF  581

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHID
Sbjct  582  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHID  641

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  642  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  675



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  550  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGF  609

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHID
Sbjct  610  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHID  669

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  670  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  703



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  549  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGF  608

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHID
Sbjct  609  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHID  668

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  669  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  702



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   295 bits (754),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYL+NQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  546  ERLESGLYSRSYLQNQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGF  605

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AYSRA QIITTHID
Sbjct  606  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYSRAKQIITTHID  665

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  666  ILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   295 bits (754),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  549  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGF  608

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE AY+RA QIITTHID
Sbjct  609  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVETAYTRAKQIITTHID  668

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGK EL+V+
Sbjct  669  ILHKLAQLLIEKETVDGEEFMSLFIDGKTELYVS  702



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  570  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGNDNVTTGASNDFMQVSRVARQMVERFGF  629

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QI+T +ID
Sbjct  630  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQIMTDNID  689

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  690  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  723



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  567  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  626

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  627  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  686

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  687  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  720



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   294 bits (753),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  553  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  612

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRA QIITTH D
Sbjct  613  SKKIGQVAIGGSGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAKQIITTHSD  672

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDG+EFMSLFIDGKAEL+VA
Sbjct  673  ILHKLAQLLIEKETVDGDEFMSLFIDGKAELYVA  706



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   295 bits (754),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  569  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  628

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  629  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  688

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  689  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  722



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   295 bits (754),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  570  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  629

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  630  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  689

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  690  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  723



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  571  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  630

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  631  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  690

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  691  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  724



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  563  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  622

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  623  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  682

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  683  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  716



>gb|EMS62975.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Triticum 
urartu]
Length=494

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  341  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGF  400

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THID
Sbjct  401  SKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHID  460

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  461  ILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  494



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  565  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  624

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  625  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  684

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  685  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  718



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGE+ VTTGASNDFMQVSRVARQMVER GF
Sbjct  562  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEEKVTTGASNDFMQVSRVARQMVERLGF  621

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SK+IGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVERAY+RA QIITTHID
Sbjct  622  SKRIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVERAYARAKQIITTHID  681

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  682  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  569  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMIERFGF  628

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  629  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  688

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  689  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  722



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  560  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGKENVTTGASNDFMQVSRVARQMVERFGF  619

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELV+ AYSRA  IITT ID
Sbjct  620  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVDEAYSRAKHIITTQID  679

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  680  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  528  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGF  587

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE++YSRATQII THID
Sbjct  588  SKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKSYSRATQIINTHID  647

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  648  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  681



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  571  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGF  630

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA QI++ +ID
Sbjct  631  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRALQIMSDNID  690

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  691  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  724



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  552  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGF  611

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA QI+TTHID
Sbjct  612  SKKIGQVAIGGSGGNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHID  671

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  672  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  566  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGF  625

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHID
Sbjct  626  SKKIGQVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHID  685

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  686  ILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  566  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGF  625

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHID
Sbjct  626  SKKIGQVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHID  685

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  686  ILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  346  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  405

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQII THID
Sbjct  406  SKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQIINTHID  465

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  466  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  499



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+ NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  558  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQANVTTGASNDFMQVSRVARQMVERFGF  617

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+G  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  618  SKKIGQVAVGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  677

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLA LLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  678  ILHKLANLLIEKESVDGEEFMSLFIDGKAELYVS  711



>gb|EMT09942.1| Cell division protease ftsH-like protein, chloroplastic [Aegilops 
tauschii]
Length=665

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  511  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGF  570

Query  390  SKKIGQIAIGGPGG-NPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHI  214
            SKKIGQ+AIG  GG NPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THI
Sbjct  571  SKKIGQVAIGSSGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHI  630

Query  213  DILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            DILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  631  DILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  665



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GF
Sbjct  554  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGF  613

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RATQIITTHID
Sbjct  614  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATQIITTHID  673

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  674  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GF
Sbjct  555  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGF  614

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQIITTHID
Sbjct  615  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQIITTHID  674

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELF++
Sbjct  675  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFIS  708



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEE IFG D VTTGASNDFMQVSRVARQMVERFGF
Sbjct  544  ERLESGLYSRSYLENQMAVALGGRVAEEAIFGVDKVTTGASNDFMQVSRVARQMVERFGF  603

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATAD+VDAEVRELV+RAY+RA QIITT+ID
Sbjct  604  SKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDRAYARAKQIITTNID  663

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            ILH+LAQLLIEKETVDGEEFMSLFIDGKA++
Sbjct  664  ILHRLAQLLIEKETVDGEEFMSLFIDGKAQM  694



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  563  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  622

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  623  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  682

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDG  130
            ILHKLAQLLIEKETVDGEEFMSLFIDG
Sbjct  683  ILHKLAQLLIEKETVDGEEFMSLFIDG  709



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GF
Sbjct  554  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGF  613

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+IITTHID
Sbjct  614  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATEIITTHID  673

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  674  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GF
Sbjct  555  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGF  614

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQIITTHID
Sbjct  615  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQIITTHID  674

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  675  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  708



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  568  ERLESGLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGF  627

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQIA+G  GGNPFLGQQMS+QKDYSMATAD+VD EVRELVE AYSRATQIITTHID
Sbjct  628  SKKIGQIAVGASGGNPFLGQQMSSQKDYSMATADIVDGEVRELVETAYSRATQIITTHID  687

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  688  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYV  720



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  565  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGF  624

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA  I+TTHID
Sbjct  625  SKKIGQVAIGASGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKDIVTTHID  684

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILH LAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  685  ILHTLAQLLMEKETVDGEEFMSLFIDGKAELYVA  718



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GF
Sbjct  562  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGF  621

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQIITTHID
Sbjct  622  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQIITTHID  681

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  682  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  715



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GF
Sbjct  557  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGF  616

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQIITTHID
Sbjct  617  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQIITTHID  676

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  677  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  710



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  568  ERLESGLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGF  627

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQIA+G  GGNPFLGQ MS+QKDYSMATAD+VD EVRELVE AYSRATQIITTHID
Sbjct  628  SKKIGQIAVGASGGNPFLGQMMSSQKDYSMATADIVDGEVRELVETAYSRATQIITTHID  687

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  688  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYV  720



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALG RVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GF
Sbjct  554  ERLESGLYSRSYLENQMAVALGERVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGF  613

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+IITTHID
Sbjct  614  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATEIITTHID  673

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  674  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  553  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGF  612

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQII THID
Sbjct  613  SKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQIINTHID  672

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  673  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  529  ERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGF  588

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHID
Sbjct  589  SKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHID  648

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  649  ILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  682



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGF
Sbjct  552  ERLESGLYSRSYLENQMAVALGGRIAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGF  611

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GG+PFLGQQMS+QKDYSMATADVVDAEVRELV+ AYSRA QIITTH+D
Sbjct  612  SKKIGQVAIGGGGGDPFLGQQMSSQKDYSMATADVVDAEVRELVDTAYSRAKQIITTHVD  671

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  672  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  705



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  546  ERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGF  605

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHID
Sbjct  606  SKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHID  665

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  666  ILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  546  ERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGF  605

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHID
Sbjct  606  SKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHID  665

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  666  ILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 1/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEV FG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  554  ERLESGLYSRSYLENQMAVALGGRVAEEV-FGQDNVTTGASNDFMQVSRVARQMVERFGF  612

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQII THID
Sbjct  613  SKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQIINTHID  672

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  673  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEEVIFG +NVTTGASNDF QVSRVARQMVERFGF
Sbjct  475  ERLESGLYSRSYLENQMAVALGGRIAEEVIFGPENVTTGASNDFQQVSRVARQMVERFGF  534

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIGQ+A+GG GGNPFLGQQ+S Q DYSMATADVVDAEVRELVE AY+RA  +ITTH++
Sbjct  535  SNKIGQVALGGSGGNPFLGQQLSQQSDYSMATADVVDAEVRELVESAYARAKHLITTHVE  594

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHKLA LLIEKETVDGEEF+SLF+DG AEL++
Sbjct  595  ILHKLANLLIEKETVDGEEFLSLFVDGNAELYL  627



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  552  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGF  611

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY+RATQIITT ID
Sbjct  612  SKKIGQVAVGGAGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYARATQIITTQID  671

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  672  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  705



>dbj|BAH20236.1| AT5G42270 [Arabidopsis thaliana]
Length=510

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  357  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGF  416

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT ID
Sbjct  417  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQID  476

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  477  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  510



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  552  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  611

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQIAIGG GGNPFLGQQM++ KDYSMATADVVD EVRELVE AY RAT+I+ THID
Sbjct  612  SKKIGQIAIGGGGGNPFLGQQMASSKDYSMATADVVDGEVRELVETAYKRATEIVNTHID  671

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  672  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  705



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  556  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGF  615

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+IITT ID
Sbjct  616  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIITTQID  675

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  676  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  709



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  553  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGF  612

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY+RA +I+TT ID
Sbjct  613  SKKIGQVAVGGAGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYARAKEIVTTQID  672

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  673  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  706



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   263 bits (672),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  555  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGF  614

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT ID
Sbjct  615  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQID  674

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  675  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  708



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  554  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGF  613

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT ID
Sbjct  614  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQID  673

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  674  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  707



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMA +LGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGF
Sbjct  495  ERLESGLYSRSYLENQMACSLGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGF  554

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHID
Sbjct  555  SKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHID  614

Query  210  ILHKLAQLLIEKETVDGEE  154
            ILHKLAQLLIEKETV GE+
Sbjct  615  ILHKLAQLLIEKETVAGED  633



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  551  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGF  610

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT ID
Sbjct  611  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQID  670

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  671  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  704



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  548  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGF  607

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT ID
Sbjct  608  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQID  667

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  668  ILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  701



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  557  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGF  616

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR+LVE+AY+RAT+I+TT ID
Sbjct  617  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRKLVEKAYARATEIVTTQID  676

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  677  ILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  710



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGF
Sbjct  545  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGF  604

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQ MS+QKDYSMATAD+VDAEVRELVERAY RAT IITT ID
Sbjct  605  SKKIGQVAIGGGGGNPFLGQSMSSQKDYSMATADIVDAEVRELVERAYERATTIITTQID  664

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  665  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  698



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  481  ERLESGLYSRSYLENQMAVALGGRIAEELIYGAENVTTGASNDFMQVSRVARQMVERFGF  540

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  I+ THID
Sbjct  541  SKKIGQLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHID  600

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHKLA LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  601  ILHKLAALLLEKETVDGEEFLNLFIDGQAELYV  633



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  494  ERLESGLYSRSYLENQMAVALGGRIAEELIYGTENVTTGASNDFMQVSRVARQMVERFGF  553

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  I+ THID
Sbjct  554  SKKIGQLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHID  613

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHKLA LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  614  ILHKLAALLLEKETVDGEEFLNLFIDGQAELYV  646



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVER GF
Sbjct  531  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERLGF  590

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVD+EVRELVE+AY RA QIITTHID
Sbjct  591  SKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDSEVRELVEKAYERAKQIITTHID  650

Query  210  ILHKLAQLLIEK  175
            ILHKLAQLLIEK
Sbjct  651  ILHKLAQLLIEK  662



>gb|AIS72760.1| ATP-dependent zinc metalloprotease chloroplastic-like protein, 
partial [Rhizophora apiculata]
Length=236

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  121  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGF  180

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIIT  223
            SKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AY+RA QI+T
Sbjct  181  SKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYTRAKQIVT  236



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVAL GR+AEEVIFGE+NVTTGASNDFMQVSRVAR MVERFGF
Sbjct  576  ERLESGLYSRSYLENQMAVALSGRIAEEVIFGEENVTTGASNDFMQVSRVARHMVERFGF  635

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  229
            SKKIG++AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AYSRA QI
Sbjct  636  SKKIGRVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYSRAKQI  689



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGR+AEE+IFGEDNVTTGASNDFMQV+R A+ MV + GF
Sbjct  567  ERLESGLYSRSYLENQMAVALGGRIAEEIIFGEDNVTTGASNDFMQVARTAKMMVTQMGF  626

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKK+GQ+A  G GG  FLGQ M    D S  T+D +DAEV++LV+RAY RA  ++ ++I 
Sbjct  627  SKKLGQVAWSGGGGPSFLGQSMGQPADCSGQTSDEIDAEVKQLVDRAYRRAKDLMQSNIT  686

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            +LHK A++L+E+E +DG+EF+ L ++ +AE ++
Sbjct  687  VLHKTAEVLLEREQIDGDEFLRLILESQAENYL  719



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVA+GGRVAEE+IFG ++VTTGAS DF QVS+ ARQM+E  GF
Sbjct  554  ERLESGLYSRSYLENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQVSQTARQMIETMGF  613

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKKIGQIA+   GG  FLG +M    DY  ATAD+VD+EV+ELV +AY RA  +++ +ID
Sbjct  614  SKKIGQIALKTGGGQSFLGGEMGRSADYGPATADLVDSEVKELVTKAYRRAKDLVSINID  673

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            +LHK+A +L+EKE +DG+EF  +  + K+EL++
Sbjct  674  VLHKVADVLMEKENIDGDEFEKIMFNAKSELYL  706



>gb|KIY93255.1| cell division protease FtsH [Monoraphidium neglectum]
Length=548

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR MV + GF
Sbjct  382  ERLESGLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGF  441

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SK +GQ+A    GGN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  +I ++ID
Sbjct  442  SKVLGQVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKALVERAYRRAKDLIQSNID  501

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHK A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  502  ILHKTAAVLLEKENIDGDEFQQIVLESQAQQYL  534



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR MV + GF
Sbjct  568  ERLESGLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGF  627

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SK +GQ+A    GGN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  +I ++ID
Sbjct  628  SKALGQVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKSLVERAYRRAKDLIQSNID  687

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHK A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  688  ILHKTAAVLLEKENIDGDEFQQIVLESQAQQYL  720



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR MV + G 
Sbjct  556  ERLESGLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGL  615

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKK+GQ+A    GG  FLG   +   D+S ATAD +D EV+ELVERAY RA  ++ ++ID
Sbjct  616  SKKLGQVAWSSSGGAQFLGASAAQPADFSQATADEIDNEVKELVERAYRRAKDLVVSNID  675

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHK+A +LIEKE +DG+EF  + +  +A+ ++
Sbjct  676  ILHKVAAVLIEKENIDGDEFQQIVLASQAQQYL  708



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  ERLESGLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  
Sbjct  520  SEKLGPVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRSLVDVAYSRAKQVLVENRK  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L +LA +L++KETVD +E   L ID    +
Sbjct  580  VLDQLADMLVDKETVDSDELQRLLIDNNVSM  610



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR MV + G 
Sbjct  561  ERLESGLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGL  620

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SKK+GQ+A    GG  FLG   +   D+S +TAD +D+EV+ELVERAY RA  ++  +ID
Sbjct  621  SKKLGQVAWSNQGGASFLGASAAQPADFSQSTADEIDSEVKELVERAYRRAKDLVEQNID  680

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            ILHK+A +LIEKE +DG+EF  + +  +A+ + 
Sbjct  681  ILHKVAAVLIEKENIDGDEFQQIVLASQAQQYT  713



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQM+ RFG 
Sbjct  460  ERLESGLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQMITRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  
Sbjct  520  SEKLGPVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRGLVDVAYSRAKQVLVENRK  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L +LA++L++KETVD +E   L ID    +
Sbjct  580  VLDQLAEMLVDKETVDSDELQRLLIDNNVSM  610



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+YLENQMAVA+GGRVAEE+IFG +NVTTGAS DF QVSR AR M+E+ GF
Sbjct  552  ERLESGLYSRTYLENQMAVAMGGRVAEELIFGAENVTTGASGDFQQVSRTARMMIEQMGF  611

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIGQIA+   GG  FLG       DYS ATAD+VD+EV+ LVE AY RA  ++  +I 
Sbjct  612  SEKIGQIALKTGGGQTFLGNDAGRGADYSQATADIVDSEVQALVEVAYRRAKDLVQENIQ  671

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
             LH +A++L++KE +DG+EF  + +  KA+L++
Sbjct  672  CLHDVAEVLLDKENIDGDEFEQIMLKAKAKLYL  704



>ref|WP_025961749.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_521C8]
Length=213

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  59   ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  118

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIG +A+G   G  FLG+ MST +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  119  SEKIGPVALGQSQGGMFLGRDMSTTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  178

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  179  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  210



>ref|WP_044452063.1| cell division protein FtsH, partial [Mastigocladus laminosus]
 gb|KIY10627.1| cell division protein FtsH, partial [Mastigocladus laminosus 
UU774]
Length=405

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  251  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  310

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  
Sbjct  311  SEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRH  370

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA++L+EKETVD EE   L 
Sbjct  371  VLDQLAEMLVEKETVDAEELQDLL  394



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+YLENQMAVA+GGR+AEE+IFG +NVTTGAS DF QVS  AR MVE+ GF
Sbjct  563  ERLESGLYSRTYLENQMAVAMGGRIAEELIFGAENVTTGASGDFQQVSNTARMMVEQMGF  622

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIGQIA+   GG  FLG       DYS  TA++VD EV+ LVE AY RA  ++  +ID
Sbjct  623  SEKIGQIALKTGGGQSFLGNDAGRAADYSQTTANIVDDEVKILVETAYRRAKDLVQENID  682

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
             LH +A++L+EKE +DG+EF  + +  +A+L++
Sbjct  683  CLHAVAEVLLEKENIDGDEFEEIMLKARAKLYL  715



>ref|WP_025929131.1| hypothetical protein, partial [Prochlorococcus sp. scB243_496A2]
Length=242

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  88   ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  147

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  148  SEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  207

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  208  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  239



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQM+VALGGRVAEE+I G DNVTTGAS DF QV+RVAR MVE+ GF
Sbjct  556  ERLENGLYSRSYLENQMSVALGGRVAEELILGPDNVTTGASGDFQQVTRVARMMVEQMGF  615

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S  +GQ+A    GG  FLG QM+   + S  T D++D EV+ LV+RAY RA  +I  +I 
Sbjct  616  SDSLGQVAWSQSGGGSFLGAQMAQPANCSGETQDIIDKEVKSLVDRAYRRAKDLIQNNIS  675

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            +LH+ A++L+EKE +DGEE  +L ++ ++E ++
Sbjct  676  VLHRTAEILLEKEQMDGEELQALLLEAQSEQYL  708



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA Q++T +  
Sbjct  520  SDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKQVLTDNRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LAQ+L+EKETVD EE   L 
Sbjct  580  VLDQLAQMLVEKETVDAEELQELL  603



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +RL  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  459  DRLESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   GN FLG+ ++ ++D+S  TA  +DAEVR LV++AY+RA Q++T +  
Sbjct  519  SDKLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDAEVRGLVDQAYARAKQVLTNNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA++L++KETVD EE   L 
Sbjct  579  VLDQLAKMLVDKETVDSEELQHLL  602



>dbj|BAH20250.1| AT5G42270 [Arabidopsis thaliana]
Length=215

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGF
Sbjct  115  ERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGF  174

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVR  268
            SKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR
Sbjct  175  SKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVR  215



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV R+G 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRYGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   GN FLG+ +  ++D+S  TA  +D EVR+LV+ AY RA Q++T +  
Sbjct  520  SEKLGPVALGRQQGNMFLGRDIMAERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTENRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQLL+EKETVD EE   L 
Sbjct  580  ILDQLAQLLMEKETVDAEELQELL  603



>gb|ADF81075.1| FtsH [Corallina officinalis]
Length=221

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR +LE Q+AVALGGR+AEE+IFG++N+TTGASND  +V++VARQMV RFG 
Sbjct  63   QRVDSGLYSRQFLEGQLAVALGGRIAEEIIFGDENITTGASNDLQRVTQVARQMVTRFGM  122

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADV-VDAEVRELVERAYSRATQIITTHI  214
            SKK+GQI     GGNPFLG+QM++Q     +T  + +D EVR LV+ AY+RA  ++TT+ 
Sbjct  123  SKKVGQIVHSSDGGNPFLGRQMASQSPQIGSTTKMAIDDEVRRLVDIAYNRAKTLLTTNR  182

Query  213  DILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
             +L  LA++LIEKETV  +EF  L    K E+ +
Sbjct  183  SLLDDLAKMLIEKETVSADEFQRLLATSKVEMMM  216



>ref|WP_044106285.1| cell division protein FtsH [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17558.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=616

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA V+D EVR+LV  AY RA  ++  +  
Sbjct  522  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAVIDEEVRQLVNNAYIRAKDVLVNNRH  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA++L+EKETVD EE  S+ 
Sbjct  582  ILDKLAEMLVEKETVDAEELQSIL  605



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  
Sbjct  520  SEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA++L+EKETVD EE   L 
Sbjct  580  VLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +RL  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  459  DRLESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   GN FLG+ ++ ++D+S  TA  +D+EVR LV++AY+RA Q++T +  
Sbjct  519  SDKLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDSEVRGLVDQAYTRAKQVLTNNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA +L++KETVD EE   L 
Sbjct  579  VLDQLANMLVDKETVDSEELQQLL  602



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  
Sbjct  520  SEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA++L+EKETVD EE   L 
Sbjct  580  VLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_029963924.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_526K3]
Length=337

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  183  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  242

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  243  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  302

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  303  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  334



>ref|WP_025947145.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_528N8]
Length=347

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  193  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  252

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  253  SDKIGPVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  312

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  313  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  344



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA +++T +  
Sbjct  520  SEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKKVLTDNRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA++L+EKETVD EE   L 
Sbjct  580  VLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LV++AY RA +++  +  
Sbjct  522  SDRLGPVALGRQSGNVFLGRDIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVGNRH  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL KLA +L+EKETVD EEF  L  +   ++
Sbjct  582  ILDKLADMLVEKETVDSEEFQDLLANNDVKM  612



>ref|WP_012593655.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACK64378.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 gb|ACU99241.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Length=616

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV++AY RA  ++  +  
Sbjct  522  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRQLVDQAYKRAKDVLVNNRH  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL KLAQ+L+EKETVD +E   +    + ++
Sbjct  582  ILDKLAQMLVEKETVDADELQEILTSNEVKM  612



>ref|WP_006911156.1| cell division protein FtsH [Cyanobium sp. PCC 7001]
 gb|EDY39239.1| ATP-dependent metalloprotease FtsH [Cyanobium sp. PCC 7001]
Length=614

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+I+G+D VTTGASND  QV+RVARQMV RFG 
Sbjct  460  ERMESGLYSRAYLQNQMAVALGGRVAEEIIYGDDEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LVE AY RAT+++T +  
Sbjct  520  SEKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSQLVEEAYRRATEVLTNNRA  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA LL+EKETVD EE   L I
Sbjct  580  VLDQLADLLVEKETVDAEELQELLI  604



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  458  DRMETGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVRELVE AY RA +++ ++  
Sbjct  518  SDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAAIDDEVRELVEVAYRRAKEVLVSNRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+LI+KETVD EE   L 
Sbjct  578  ILDQLAQMLIDKETVDAEELQELL  601



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   GN FLG+ + +++D+S  TA  +D EV +LV+ AY+RA Q++T +  
Sbjct  520  SDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVHQLVDSAYARAKQVLTDNRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LA++L+EKETVD EE   L 
Sbjct  580  ILDQLAEMLVEKETVDAEELQELL  603



>ref|WP_010871638.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 ref|NP_440330.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 sp|P72991.1|FTSH3_SYNY3 RecName: Full=ATP-dependent zinc metalloprotease FtsH 3 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA17010.1| cell division protein; FtsH [Synechocystis sp. PCC 6803]
 dbj|BAK49182.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 dbj|BAL28181.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31351.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34520.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50723.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 gb|AGF50699.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
Length=616

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++AY RA Q++  +  
Sbjct  522  SDRLGPVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKQVLVENRG  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LA++L+EKETVD EE  +L  +  A+L
Sbjct  582  ILDQLAEILVEKETVDSEELQTLLANNNAKL  612



>ref|WP_029759589.1| cell division protein FtsH, partial [Fusobacterium nucleatum]
Length=156

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV+  ARQM+ RFG 
Sbjct  2    ERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVASTARQMITRFGM  61

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S  +G +A+G   G  FLG+ ++ ++D+S  TA  +D EV ELV+ AY RAT+++  +  
Sbjct  62   SDVLGPVALGRAQGGMFLGRDIAAERDFSEETAATIDQEVSELVDVAYKRATKVLVDNRA  121

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA +LIE+ETVD EE   L I
Sbjct  122  VLDELAGMLIEQETVDAEELQELLI  146



>gb|KGG30054.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0703]
Length=397

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  243  ERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGM  302

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  
Sbjct  303  SDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRS  362

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA LL+EKETVD ++   L I
Sbjct  363  VLDELADLLVEKETVDAQDLQELLI  387



>ref|WP_036973151.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=402

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  248  ERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGM  307

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  
Sbjct  308  SDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRS  367

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA LL+EKETVD ++   L I
Sbjct  368  VLDELADLLVEKETVDAQDLQELLI  392



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+  ARQMV RFG 
Sbjct  459  ERLESGLYSRSYLQNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVANTARQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S  +G +A+G   GNPFLG+ +++++D+S  TA  +DAEVR LV++AY+R  Q++  +  
Sbjct  519  SDILGPVALGRQQGNPFLGRDIASERDFSEKTAASIDAEVRALVDQAYARCKQVLVENRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LA +L++KETVD EE  +L  +  A++
Sbjct  579  ILDQLADMLVDKETVDSEELQTLLANSNAKM  609



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+ +G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q++T +  
Sbjct  520  SETLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTDNRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA++L+EKETVD EE   L 
Sbjct  580  VLDQLAEMLVEKETVDAEELQELL  603



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  583  ILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_025970576.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521M10]
Length=396

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  242  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  301

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  302  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  361

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  362  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  393



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRA  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  583  ILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_009556886.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68121.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
Length=624

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  470  DRMDSGLYSRSYLQNQMAVALGGRIAEELVFGEEEVTTGASNDLQQVARVARQMVTRFGM  529

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR LV++AY RA  ++T +  
Sbjct  530  SDRLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVRNLVDQAYRRAKAVLTQNRA  589

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L KLAQ+L+EKETVD EE   L 
Sbjct  590  VLDKLAQMLVEKETVDAEELQDLL  613



>gb|EAM48267.1| Peptidase M41 [Crocosphaera watsonii WH 8501]
Length=168

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GL SRSYL+NQMAVALGGRVAEE+IFGE+ VTTGA++D  QV+RVARQM+ RFG 
Sbjct  14   DRMESGLMSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGAASDLQQVARVARQMITRFGM  73

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LV+ AY+RA  ++ ++  
Sbjct  74   SDRLGPVALGRQNGNVFLGRDIASDRDFSNETASAIDEEVRGLVDTAYARAKDVLESNRQ  133

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL  LA +L+EKETVD +E   + 
Sbjct  134  ILDTLADMLVEKETVDSDELQQIL  157



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRA  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  583  ILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_008275101.1| cell division protein FtsH [Cyanothece sp. CCY0110]
 gb|EAZ91781.1| cell division protein; FtsH [Cyanothece sp. CCY0110]
Length=617

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AYSRA  ++ ++  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSNETASTIDNEVRQLVDTAYSRAKDVLESNRH  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LA +L+EKETVD +E   + 
Sbjct  583  ILDRLADMLVEKETVDSDELQEIL  606



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRA  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  583  ILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMDSGLYSRSYLQNQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR+LV++AYSRA  +++++  
Sbjct  522  SDRLGPVALGRQQGNVFLGREIASDRDFSDETAAAIDEEVRKLVDQAYSRAKDVLSSNRH  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL  LA +L+EKETVD EE  ++ 
Sbjct  582  ILDALADMLVEKETVDAEELQNIL  605



>ref|WP_042712540.1| hypothetical protein [Crocosphaera watsonii]
Length=176

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GL SRSYL+NQMAVALGGRVAEE+IFGE+ VTTGA++D  QV+RVARQM+ RFG 
Sbjct  22   DRMESGLMSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGAASDLQQVARVARQMITRFGM  81

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LV+ AY+RA  ++ ++  
Sbjct  82   SDRLGPVALGRQNGNVFLGRDIASDRDFSNETASAIDEEVRGLVDTAYARAKDVLESNRQ  141

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL  LA +L+EKETVD +E   + 
Sbjct  142  ILDTLADMLVEKETVDSDELQQIL  165



>ref|WP_026097926.1| cell division protein FtsH [Geitlerinema sp. PCC 7105]
Length=614

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  ERMDSGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+++G +A+G   GN FLG+ ++ ++D+S  TA  +D EV +LV+ AY+RA Q+++ +  
Sbjct  520  SERLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDEEVSKLVDEAYTRAKQVLSENRS  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L +L+++L+EKETVD EE   L  +   ++
Sbjct  580  VLDRLSEMLVEKETVDAEELQDLLANSDVKM  610



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  458  DRMDSGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY+RA  ++  +  
Sbjct  518  SDRLGPVALGRQNGNMFLGRDIASDRDFSNTTAATIDEEVRKLVDEAYNRAKDVLVGNKH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL KL+ +LIEKETVD EE   L  +   ++
Sbjct  578  ILDKLSAMLIEKETVDAEELQELLAENDVKM  608



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRA  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+L+EKETVD EE  ++ 
Sbjct  583  ILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  458  DRMDTGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  ++T +  
Sbjct  518  SDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTNNRA  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+L+EKETVD +E   L 
Sbjct  578  ILDRLAQMLVEKETVDADELQELL  601



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRA  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+L+EKETVD EE  ++ 
Sbjct  583  ILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRA  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+L+EKETVD EE  ++ 
Sbjct  583  ILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  459  DRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA  ++T +  
Sbjct  519  SDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYARAKTVLTDNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LA +L+EKETVD EE   L 
Sbjct  579  VLDQLADMLVEKETVDAEELQELL  602



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRA  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+L+EKETVD EE  ++ 
Sbjct  583  ILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRV  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  583  ILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_028949001.1| cell division protein FtsH [Synechocystis sp. PCC 6714]
 gb|AIE73467.1| Cell division protein FtsH [Synechocystis sp. PCC 6714]
Length=616

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++AY RA +++  +  
Sbjct  522  SDRLGPVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKRVLVENRG  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LA++L+EKETVD EE  +L     A+L
Sbjct  582  ILDQLAEMLVEKETVDSEELQTLLASNNAKL  612



>ref|WP_025954333.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=445

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  291  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  350

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  351  SEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  410

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  411  VLDEMAQMLIERETIDTEDIQELL--NRSEVKVA  442



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  458  DRMDTGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  ++T +  
Sbjct  518  SDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTDNRA  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+L+EKETVD +E   L 
Sbjct  578  ILDRLAQMLVEKETVDADELQELL  601



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLYSRSYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +++  +  
Sbjct  522  SDRLGPVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVNNRH  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA +LIEKETVD EE   + 
Sbjct  582  ILDKLADMLIEKETVDAEELQDVL  605



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G 
Sbjct  458  ERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  
Sbjct  518  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L++LA +LI+KETVD +E   L  + + ++
Sbjct  578  VLNQLANILIDKETVDADELQELLANNEVKM  608



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRV  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LAQ+L+EKETVD EE  ++ 
Sbjct  583  ILDQLAQMLVEKETVDAEELQNIL  606



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDTGLYSRAYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LVE AY RA +++  +  
Sbjct  520  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVETAYRRAKEVLENNRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA++L+EKETVD EE   + 
Sbjct  580  ILDKLAEMLVEKETVDAEELQDVL  603



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGRVAEE++FGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  461  DRMESGLYSRSYLQNQMAVALGGRVAEEIVFGEEEVTTGASNDLQQVARVARQMITRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+++G +A+G   GN FLG+ +++ +D+S +TA ++D EV++LV+ AY RA  ++  + +
Sbjct  521  SERLGPVALGRQNGNVFLGRDIASDRDFSDSTAAMIDEEVKKLVDVAYQRAKDVLQNNRE  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L  LAQ+L+EKETVD EE   L  +   +L
Sbjct  581  VLDTLAQMLVEKETVDSEELQELLNNNDVKL  611



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G 
Sbjct  458  ERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  
Sbjct  518  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L++LA +LI+KETVD +E   L  + + ++
Sbjct  578  VLNQLANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G 
Sbjct  458  ERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  
Sbjct  518  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L++LA +LI+KETVD +E   L  + + ++
Sbjct  578  VLNQLANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_025971093.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521N5]
Length=471

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  317  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  376

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  377  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  436

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  437  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  468



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+YL+NQMAVALGGR+AEE+++G + VTTGASND  QV+RVARQM+ RFG 
Sbjct  459  ERLESGLYSRAYLQNQMAVALGGRIAEEIVYGNEEVTTGASNDLQQVARVARQMITRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ ++ ++D+S  TA ++DAEVR LV++AY RA Q++  +  
Sbjct  519  SGELGPVALGRQQGNMFLGRDITAERDFSEETAAIIDAEVRSLVDQAYDRAKQVLVENRA  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA +L+EKETVD EE   L 
Sbjct  579  ILDKLAGMLVEKETVDSEELQELL  602



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G 
Sbjct  458  ERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  
Sbjct  518  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L++LA +LI+KETVD +E   L  + + ++
Sbjct  578  VLNQLADVLIDKETVDADELQELLANNEVKM  608



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G 
Sbjct  458  ERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  
Sbjct  518  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L++LA +LI+KETVD +E   L  + + ++
Sbjct  578  VLNQLADVLIDKETVDADELQELLANNEVKM  608



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  463  DRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY RA  ++ ++  
Sbjct  523  SDRLGPVALGRQNGNVFLGRDIASDRDFSNETASTIDEEVRQLVDTAYKRAKDVLESNRH  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LA +L+EKETVD +E   + 
Sbjct  583  ILDRLADMLVEKETVDSDELQEIL  606



>gb|ABX08179.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9211]
Length=602

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  448  ERMESGLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGM  507

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++T +  
Sbjct  508  SDKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQ  567

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L +LA++L+EKETV+ E+   L I  + E+
Sbjct  568  VLDQLAEMLVEKETVNSEDLQDLLIQSQVEV  598



>ref|WP_041391000.1| cell division protein FtsH [Prochlorococcus marinus]
Length=615

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  461  ERMESGLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++T +  
Sbjct  521  SDKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQ  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L +LA++L+EKETV+ E+   L I  + E+
Sbjct  581  VLDQLAEMLVEKETVNSEDLQDLLIQSQVEV  611



>emb|CCH67048.1| Cell division protein FtsH [Richelia intracellularis HH01]
Length=465

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG 
Sbjct  311  DRMDSGLYSRSYLENQMAVALGGRLAEEIIFGDEEVTTGASNDLQQVARVARQMVTRFGM  370

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q++  +  
Sbjct  371  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAATIDEEVRQLVDAAYIRAKQVLEENRH  430

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL++LA +L+EKETVD EE   + 
Sbjct  431  ILNQLADILVEKETVDAEELQDIL  454



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +++  GLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQMV RFG 
Sbjct  458  DQMDSGLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  518  SDRLGPVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L ++AQ+LIEKET+D EE  S+ 
Sbjct  578  VLDQIAQVLIEKETIDAEELQSIL  601



>ref|WP_028953545.1| cell division protein FtsH [Synechococcus sp. CC9616]
Length=615

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+I+GED VTTGASND  QV++VARQM+ RFG 
Sbjct  461  ERMESGLYSRAYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLQQVAQVARQMITRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RATQ++  +  
Sbjct  521  SDKLGPVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVYDLVDVAYKRATQVLVDNRS  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA LL+EKETVD EE   L I
Sbjct  581  VLDELADLLVEKETVDAEELQELLI  605



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +++  GLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQMV RFG 
Sbjct  458  DQMDSGLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +++  +  
Sbjct  518  SDRLGPVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L ++AQ+LIEKET+D EE  S+ 
Sbjct  578  VLDQIAQVLIEKETIDAEELQSIL  601



>gb|KGF94553.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9201]
Length=580

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  426  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  485

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T + +
Sbjct  486  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRN  545

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  546  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  577



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  461  ERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  
Sbjct  521  SDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRS  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA LL+EKETVD ++   L I
Sbjct  581  VLDELADLLVEKETVDAQDLQDLLI  605



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  461  DRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN F+G+ +++ +D+S +TA  +D EV++LV++AY RA Q++  +  
Sbjct  521  SDRLGPVALGRQNGNVFMGRDIASDRDFSDSTASAIDDEVKKLVDQAYQRAKQVLVENRA  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L KLA +L+EKETVD +E   + 
Sbjct  581  VLDKLANMLVEKETVDADELQDIL  604



>ref|WP_032522853.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T + +
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRN  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  459  DRMDSGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVMRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+++G +A+G   GN FLG+ +  ++D+S  TA V+D EV  LVE+AY RA +++ ++  
Sbjct  519  SERLGPVALGRQQGNMFLGRDIMAERDFSEETASVIDEEVSTLVEQAYRRAKEVLVSNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L  LA +L+EKETVD EE   L  +   ++
Sbjct  579  VLDTLADMLVEKETVDSEELQDLLANSDVKM  609



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  461  ERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  
Sbjct  521  SDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRS  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA LL+EKETVD ++   L I
Sbjct  581  VLDELADLLVEKETVDAQDLQELLI  605



>ref|WP_022606782.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae]
 gb|ERN41527.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae KORDI 
51-2]
Length=616

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +RL  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV R G 
Sbjct  462  DRLDSGLYSRSYLQNQMAVALGGRIAEEIVFGEEEVTTGASNDLQQVARVARQMVTRLGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LV+RAY R   ++ ++  
Sbjct  522  SDRLGPVALGRSNGNVFLGRDIASDRDFSDETAAAIDEEVRSLVDRAYQRCKDVLVSNRH  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL KLA  L+EKETVD +E   L  + + ++
Sbjct  582  ILDKLAAALVEKETVDADELQQLLTENEVKM  612



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  458  DRMDTGLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV+ AY RA  ++  +  
Sbjct  518  SDRLGPVALGRQNGNMFLGREIASDRDFSDTTAATIDEEVRRLVDEAYERAKNVLLGNKH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL KLA +LIEKETVD +E   L  +   ++
Sbjct  578  ILDKLAGMLIEKETVDSDELQELLANNDVKI  608



>ref|WP_015204207.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 gb|AFZ14101.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=613

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +RL  GLYSRSYL+NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG 
Sbjct  459  DRLDSGLYSRSYLQNQMAVALGGRIAEEIIFGDEEVTTGASNDLQQVARVARQMVMRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EV  LVE+AY RA +++  +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDINAERDFSDETAATIDDEVHNLVEQAYKRAKEVLVNNKH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L KLA +LIEKETVD EE   L  +   ++
Sbjct  579  VLDKLAVMLIEKETVDSEELQELLANNDVKM  609



>ref|WP_035155002.1| cell division protein FtsH [Calothrix sp. 336/3]
 gb|KFB84628.1| cell division protein FtsH [Calothrix sp. 336/3]
Length=613

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVA+QMV RFG 
Sbjct  459  DRMDSGLYSRAYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVAKQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LV+ AY+RA  ++T +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDIMAERDFSEETAAAIDEEVRHLVDAAYNRAKHVLTENRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA +L+EKETVD EE   L 
Sbjct  579  ILDKLAGMLVEKETVDAEELQDLL  602



>ref|WP_017743955.1| cell division protein FtsH [Scytonema hofmanni]
Length=614

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR++EE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDTGLYSRAYLENQMAVALGGRISEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LVE AY R+ +++  +  
Sbjct  520  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVEAAYRRSKEVLENNRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA++L+EKETVD EE   L 
Sbjct  580  ILDKLAEMLVEKETVDAEELQELL  603



>ref|WP_025944375.1| cell division protein FtsH [Prochlorococcus sp. scB241_529C4]
Length=617

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_015109466.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile]
 gb|AFY29018.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile PCC 6307]
Length=614

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG 
Sbjct  460  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV  AY RAT+++  +  
Sbjct  520  SDRLGPVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSQLVADAYRRATEVLLANRA  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA+LL+EKETVD EE   L I
Sbjct  580  VLDELAELLVEKETVDAEELQELLI  604



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+ VARQM+ RFG 
Sbjct  462  DRMDSGLYSRAYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVANVARQMITRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE AY RA  ++  +  
Sbjct  522  SDRLGPVALGRQNGNVFMGRDIASDRDFSDETAAVIDEEVRGLVEEAYKRAKDVLVGNRS  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L KLA +L+EKETVD EE  +L ++   ++
Sbjct  582  VLDKLAAMLVEKETVDAEELQTLLMESDVQM  612



>ref|WP_025922112.1| cell division protein FtsH [Prochlorococcus sp. scB241_529D18]
Length=617

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025935637.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025958220.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L15]
Length=538

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  384  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  443

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  444  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  503

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  504  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  535



>ref|WP_017291153.1| cell division protein FtsH [Leptolyngbya boryana]
Length=613

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVA+QMV RFG 
Sbjct  459  DRMDSGLYSRSYLQNQMAVALGGRIAEEIVFGEEEVTTGASNDLQQVARVAKQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR LVE+AY RA  ++  +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVRNLVEQAYRRAKAVLVQNRP  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L KLA++L++KETVD EE   L 
Sbjct  579  VLDKLAEMLVDKETVDAEELQELL  602



>ref|WP_036531425.1| cell division protein FtsH [Neosynechococcus sphagnicola]
 gb|KGF73398.1| cell division protein FtsH [Neosynechococcus sphagnicola sy1]
Length=613

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GL+SRSYL+NQMAVALGGR++EE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  459  DRMDAGLFSRSYLQNQMAVALGGRISEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EV ELV++AY RA  ++  +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVHELVDQAYHRAKAVLINNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L +LAQLLIEKETVD EE   L 
Sbjct  579  VLDRLAQLLIEKETVDAEELQELL  602



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GL+SRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLFSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +++  +  
Sbjct  522  SDRLGPVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLMNNRP  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL +LA +LIEKETVD EE   +  +   ++
Sbjct  582  ILDQLASMLIEKETVDAEELQDILANNDVKM  612



>ref|WP_036901462.1| cell division protein FtsH [Prochlorococcus sp. MIT 0601]
 gb|KGG13140.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0601]
Length=615

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  461  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLTQVAQVARQMVTRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++  +  
Sbjct  521  SEKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDFAYKRATKVLIDNRK  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L +LA++L+EKETVD E+  +L I  K+E+ +A
Sbjct  581  VLDELAEMLVEKETVDSEQLQNLLI--KSEVKIA  612



>ref|WP_025900256.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQELL--NRSEVKVA  614



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  464  ERMDSGLYSRAYLQNQMAVALGGRVAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  523

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN F+G+ +++ +D+S  TA  +D EVR+LV++AY R  +++  +  
Sbjct  524  SDRLGPVALGRQNGNMFMGRDIASDRDFSDETASAIDEEVRKLVDQAYERTVEVLKGNRQ  583

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            IL KLA++L+E ETVD EE  +L  +   ++
Sbjct  584  ILDKLAEMLVEAETVDSEELQNLLAESDVKM  614



>ref|WP_006623490.1| cell division protein FtsH [Arthrospira sp. PCC 8005]
 emb|CCE19163.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
 gb|EKD09489.1| ATP-dependent metalloprotease FtsH [Arthrospira platensis C1]
 emb|CDM97762.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
Length=600

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  446  DRMDSGLYSRSYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVTRVARQMITRFGM  505

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR LV+ AY RA Q++  +  
Sbjct  506  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASAIDEEVRALVDEAYKRARQVLEENRP  565

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L  LA++LIEKETVD EE   L 
Sbjct  566  VLDSLAEMLIEKETVDSEELQELL  589



>ref|WP_006669335.1| MULTISPECIES: cell division protein FtsH [Arthrospira]
 gb|EDZ94639.1| ATP-dependent metalloprotease FtsH [Arthrospira maxima CS-328]
Length=612

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  458  DRMDSGLYSRSYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVTRVARQMITRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR LV+ AY RA Q++  +  
Sbjct  518  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASAIDEEVRALVDEAYKRARQVLEENRP  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L  LA++LIEKETVD EE   L 
Sbjct  578  VLDSLAEMLIEKETVDSEELQELL  601



>ref|WP_006618677.1| FtsH peptidase [Arthrospira platensis]
 dbj|BAI92105.1| cell division protein FtsH [Arthrospira platensis NIES-39]
 gb|KDR55786.1| cell division protein FtsH [Arthrospira platensis str. Paraca]
Length=612

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  458  DRMDSGLYSRSYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVTRVARQMITRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR LV+ AY RA Q++  +  
Sbjct  518  SDRLGPVALGRQQGNVFLGRDIMSERDFSEETASAIDEEVRALVDEAYKRARQVLEENRP  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L  LA++LIEKETVD EE   L 
Sbjct  578  VLDSLAEMLIEKETVDSEELQELL  601



>ref|XP_001419590.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=651

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ERL  GLYSR+YLENQMAVA+GGRVAEE+IFG ++VTTGAS DF QV+R AR M+E+ GF
Sbjct  486  ERLESGLYSRTYLENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQVTRTARMMIEQMGF  545

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            SK+IGQIAI   GGN FLG  M    DYS ATA +VD EV+ LV  AY RA  ++  ++D
Sbjct  546  SKRIGQIAIKSGGGNSFLGNDMGRAADYSAATAAIVDEEVKILVTAAYRRAKDLVQLNMD  605

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  112
            +LH +A +L+EKE +DG+EF  + +  K+EL++
Sbjct  606  VLHAVADVLMEKENIDGDEFERIMLGAKSELYL  638



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  462  DRMESGLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ +++ +D+S  TA  +D E+R LV++AY RA +++  +  
Sbjct  522  SDRLGPVALGRQNGNVFLGRDIASDRDFSDETASAIDEEIRNLVDQAYRRAKEVLVENRS  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LA++L++KETVD +E   L 
Sbjct  582  ILDRLAEMLVDKETVDSDELQDLL  605



>ref|WP_025951376.1| cell division protein FtsH [Prochlorococcus sp. scB243_495N4]
Length=617

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_011243527.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 dbj|BAD79405.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56329.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD56622.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=613

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  459  ERMESGLYSRTYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR+LV+ AY RA +++  +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDDEVRQLVDVAYDRAKKVLIENRS  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LA++L+EKETVD EE   L 
Sbjct  579  ILDQLAKMLVEKETVDAEELQDLL  602



>ref|WP_025969610.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520E22]
Length=617

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025964562.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P15]
Length=617

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025980194.1| cell division protein FtsH [Prochlorococcus sp. scB243_498F21]
Length=617

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025890345.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032519670.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG08326.1| Cell division protein FtsH [Prochlorococcus marinus str. SB]
Length=617

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025959316.1| cell division protein FtsH [Prochlorococcus sp. scB241_527I9]
Length=617

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025971671.1| cell division protein FtsH [Prochlorococcus sp. scB241_527L22]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025924120.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032515715.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG01911.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9314]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025892538.1| cell division protein FtsH [Prochlorococcus sp. scB241_527N11]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGG03814.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG10073.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9401]
Length=580

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  426  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  485

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  486  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRS  545

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  546  VLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  577



>ref|WP_025939914.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_008230065.1| Cell division protein FtsH [Richelia intracellularis]
 emb|CCH65784.1| Cell division protein FtsH [Richelia intracellularis HM01]
Length=614

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRLAEEIIFGDEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q++  +  
Sbjct  520  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAATIDEEVRQLVDAAYVRAKQVLEENRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL++LA +L+EKETVD EE   + 
Sbjct  580  ILNQLADILVEKETVDAEELQDIL  603



>ref|WP_025967396.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P3]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGLFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_009630197.1| ATP-dependent metalloprotease FtsH [Synechocystis sp. PCC 7509]
Length=612

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+ EE+IFGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  458  DRMDTGLYSRSYLENQMAVALGGRITEELIFGEEEVTTGASNDLQQVARVARQMVTRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++GQ+A+G   GN FLG+ +  ++D+S  TA  +D EVR+LV+ AY RA +++ ++  
Sbjct  518  SDRLGQVALGRQQGNMFLGRDIVAERDFSEETAAAIDDEVRKLVDVAYRRAKEVLVSNRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL  LA +LIEKETVD +E   L 
Sbjct  578  ILDTLANMLIEKETVDADELQELL  601



>ref|WP_011862269.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABO16871.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9301]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032517345.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRS  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  614



>emb|CDN17247.1| Cell division protein FtsH [Richelia intracellularis]
Length=596

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG 
Sbjct  442  DRMDSGLYSRSYLENQMAVALGGRLAEEIIFGDEEVTTGASNDLQQVARVARQMVTRFGM  501

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA Q++  +  
Sbjct  502  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDLAYARAKQVLEENRH  561

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LA +LI+KETVD EE   + 
Sbjct  562  ILDQLADMLIDKETVDAEELQDIL  585



>ref|WP_028082599.1| cell division protein FtsH [Dolichospermum circinale]
Length=614

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVA+QM+ RFG 
Sbjct  460  DRMDTGLYSRAYLENQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVAKQMITRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AYSRA +++  +  
Sbjct  520  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDTAYSRAKEVLLDNRK  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L ++AQ+LIEKETVD EE  ++ 
Sbjct  580  VLDEIAQMLIEKETVDAEELQAIL  603



>ref|WP_028090468.1| cell division protein FtsH [Dolichospermum circinale]
Length=614

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVA+QM+ RFG 
Sbjct  460  DRMDTGLYSRAYLENQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVAKQMITRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AYSRA +++  +  
Sbjct  520  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDTAYSRAKEVLLDNRK  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            +L ++AQ+LIEKETVD EE  ++ 
Sbjct  580  VLDEIAQMLIEKETVDAEELQAIL  603



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG 
Sbjct  461  ERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGM  520

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  
Sbjct  521  SDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRS  580

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA LL+EKET+D ++   L I
Sbjct  581  VLDELADLLVEKETLDAQDLQELLI  605



>gb|KGG06312.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9322]
Length=600

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  446  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  505

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  506  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRS  565

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  566  VLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  597



>ref|WP_037224718.1| cell division protein FtsH [Richelia intracellularis]
Length=614

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYLENQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG 
Sbjct  460  DRMDSGLYSRSYLENQMAVALGGRLAEEIIFGDEEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA Q++  +  
Sbjct  520  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDLAYARAKQVLEENRH  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL +LA +LI+KETVD EE   + 
Sbjct  580  ILDQLADMLIDKETVDAEELQDIL  603



>ref|WP_024546675.1| cell division protein FtsH [Synechococcus sp. NKBG15041c]
Length=620

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+ VARQM+ RFG 
Sbjct  462  DRMDSGLYSRAYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVANVARQMITRFGM  521

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE AY RA  ++  +  
Sbjct  522  SDRLGPVALGRQNGNVFMGRDIASDRDFSDETAAVIDEEVRGLVEEAYKRAKDVLVNNRA  581

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L KLA +L+EKETVD EE  ++ ++   ++
Sbjct  582  VLDKLAAMLVEKETVDAEELQTVLMENDVKM  612



>ref|WP_006278775.1| cell division protein FtsH [Cylindrospermopsis raciborskii]
 gb|EFA68434.1| Peptidase M41, FtsH [Cylindrospermopsis raciborskii CS-505]
Length=613

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  459  DRMDTGLYSRAYLENQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AYSRA +++  +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDTAYSRAKEVLLNNRQ  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL ++AQ+LI+KETVD +E   + 
Sbjct  579  ILDQIAQMLIDKETVDADELQDIL  602



>ref|WP_035832496.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
 gb|KEF41405.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
Length=614

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG 
Sbjct  460  ERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGM  519

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV  AY RAT ++  +  
Sbjct  520  SDRLGPVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSALVAEAYRRATDVLVANRS  579

Query  210  ILHKLAQLLIEKETVDGEEFMSLFI  136
            +L +LA+LL+EKETVD EE   L I
Sbjct  580  VLDELAELLVEKETVDAEELQELLI  604



>ref|WP_009341877.1| cell division protein FtsH [Raphidiopsis brookii]
 gb|EFA73959.1| Peptidase M41, FtsH [Raphidiopsis brookii D9]
Length=613

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  459  DRMDTGLYSRAYLENQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AYSRA +++  +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDMAYSRAKEVLLNNRQ  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL ++AQ+LI+KETVD +E   + 
Sbjct  579  ILDQIAQMLIDKETVDADELQDIL  602



>ref|WP_025929709.1| cell division protein FtsH [Prochlorococcus sp. scB241_528O2]
Length=617

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDEEVSELVDMAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            IL ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  ILDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025922823.1| cell division protein FtsH [Prochlorococcus sp. scB243_495D8]
Length=617

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRI  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_012411183.1| cell division protein FtsH [Nostoc punctiforme]
 gb|ACC83227.1| ATP-dependent metalloprotease FtsH [Nostoc punctiforme PCC 73102]
Length=613

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  459  DRMDTGLYSRAYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMITRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA +++  +  
Sbjct  519  SDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDVAYTRAKEVLVGNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL ++AQ+L+EKETVD EE   + 
Sbjct  579  ILDQIAQMLVEKETVDAEELQEIL  602



>ref|WP_025937982.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519A13]
Length=617

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQELL--NRSEVTVA  614



>gb|AIQ94296.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=603

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  449  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  508

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  509  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  568

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  600



>gb|EGJ33321.1| membrane protease FtsH catalytic subunit [Moorea producens 3L]
Length=597

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  G++SRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV R+G 
Sbjct  442  DRMDSGMFSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVTRVARQMVMRYGM  501

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   G+ FLG+ +++ +D+S ATA  +D EVR+LV+ AY RA  +I  +  
Sbjct  502  SDRLGPVALGRQNGSMFLGRDIASDRDFSDATASTIDEEVRKLVDEAYERAKNVILGNKH  561

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA++LI+KETVD EE   + 
Sbjct  562  ILDKLAEMLIDKETVDAEELQEIL  585



>ref|WP_025956453.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQM+VALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMSVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025941250.1| cell division protein FtsH [Prochlorococcus sp. scB245a_518O7]
Length=617

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSQLVDVAYKRATKVLTDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_015143924.1| ATP-dependent metalloprotease FtsH [Pleurocapsa minor]
 gb|AFY77621.1| ATP-dependent metalloprotease FtsH [Pleurocapsa sp. PCC 7327]
Length=618

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSR+YL+NQMAVALGGR+AEE++FGE+ VTTGA+ND  QV+RVARQM+ RFG 
Sbjct  464  ERMEAGLYSRAYLQNQMAVALGGRIAEEIVFGEEEVTTGAANDLQQVARVARQMITRFGM  523

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   G  FLG+ +++ +D+S  TA  +D EVR LVE+AY RA  ++  +  
Sbjct  524  SDRLGPVALGRQNGGVFLGRDIASDRDFSDETAATIDEEVRLLVEQAYRRAKDVLVNNRH  583

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L +LAQ+L+EKETVD EE  +L  +   ++
Sbjct  584  VLDQLAQILVEKETVDAEELQALLANNDVKM  614



>ref|WP_002806664.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|EEE40173.1| ATP-dependent metallopeptidase HflB subfamily protein [Prochlorococcus 
marinus str. MIT 9202]
Length=617

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025925903.1| cell division protein FtsH [Prochlorococcus sp. scB241_528J8]
Length=617

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025914082.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520K10]
Length=617

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025933036.1| cell division protein FtsH [Prochlorococcus sp. scB243_498A3]
Length=617

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_015177320.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis]
 gb|AFZ08063.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis 
PCC 7112]
Length=612

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG 
Sbjct  458  DRMDSGLYSRSYLQNQMAVALGGRIAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   GN F+G+ +  ++D+S  TA  +D EVR LVE+AY RA  ++  +  
Sbjct  518  SDRLGPVALGRQQGNMFMGRDIMAERDFSEETAATIDDEVRLLVEQAYRRAKDVLVGNRH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  118
            +L+ LA LL+EKETVD +E  SL  +   ++
Sbjct  578  VLNALADLLVEKETVDADELQSLLANSDVKM  608



>ref|WP_042849723.1| cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=617

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_011817719.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM69535.1| cell division protein FtsH2 [Prochlorococcus marinus str. AS9601]
Length=617

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_044492620.1| cell division protein FtsH [Moorea producens]
Length=613

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  G++SRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV R+G 
Sbjct  458  DRMDSGMFSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVTRVARQMVMRYGM  517

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S ++G +A+G   G+ FLG+ +++ +D+S ATA  +D EVR+LV+ AY RA  +I  +  
Sbjct  518  SDRLGPVALGRQNGSMFLGRDIASDRDFSDATASTIDEEVRKLVDEAYERAKNVILGNKH  577

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL KLA++LI+KETVD EE   + 
Sbjct  578  ILDKLAEMLIDKETVDAEELQEIL  601



>ref|WP_010995433.1| cell division protein FtsH [Nostoc sp. PCC 7120]
 dbj|BAB73218.1| cell division protein [Nostoc sp. PCC 7120]
Length=613

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  459  DRMDTGLYSRAYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   GN FLG+ + +++D+S  TA  +D EV +LVE AY+RA +++  +  
Sbjct  519  SDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVHKLVETAYTRAKEVLVNNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL ++AQ+L++KETVD +E   + 
Sbjct  579  ILDQIAQMLVDKETVDADELQEIL  602



>ref|WP_025921388.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025979191.1| cell division protein FtsH [Prochlorococcus sp. scB243_497E17]
Length=617

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_012007029.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABV49865.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9215]
Length=617

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            ER+  GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG 
Sbjct  463  ERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGM  522

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  
Sbjct  523  SDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRT  582

Query  210  ILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  109
            +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  583  VLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_015139560.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
 gb|AFY49129.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
Length=613

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  570  ERLSRGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGF  391
            +R+  GLYSR+YLENQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG 
Sbjct  459  DRMDTGLYSRAYLENQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQMITRFGM  518

Query  390  SKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHID  211
            S K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA  ++ ++  
Sbjct  519  SDKLGPVALGRQQGNMFLGRDIMSERDFSEETAATVDEEVRKLVDTAYNRAKDVLVSNRH  578

Query  210  ILHKLAQLLIEKETVDGEEFMSLF  139
            IL ++AQ+L++KETVD +E   + 
Sbjct  579  ILDQIAQMLVDKETVDADELQEIL  602



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515