BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051A23

Length=410
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB25374.1|  hypothetical protein B456_004G188200                  90.9    3e-19   Gossypium raimondii
ref|XP_011028243.1|  PREDICTED: tobamovirus multiplication protei...  90.9    3e-19   Populus euphratica
gb|KHG08208.1|  Tetraspanin-33                                        89.0    1e-18   Gossypium arboreum [tree cotton]
gb|KHG29162.1|  Solute carrier family 28 member 3                     87.4    3e-18   Gossypium arboreum [tree cotton]
ref|XP_007039575.1|  Tobamovirus multiplication 2A isoform 1          88.2    3e-18   Theobroma cacao [chocolate]
gb|KDO40488.1|  hypothetical protein CISIN_1g033708mg                 84.7    4e-18   Citrus sinensis [apfelsine]
ref|XP_006385612.1|  GMFP4 family protein                             87.4    6e-18   Populus trichocarpa [western balsam poplar]
gb|KJB51696.1|  hypothetical protein B456_008G228700                  86.7    7e-18   Gossypium raimondii
gb|KJB51694.1|  hypothetical protein B456_008G228700                  87.0    7e-18   Gossypium raimondii
ref|XP_003517379.1|  PREDICTED: tobamovirus multiplication protei...  87.0    8e-18   Glycine max [soybeans]
gb|KHG29161.1|  Stk31                                                 86.7    8e-18   Gossypium arboreum [tree cotton]
gb|KHN42626.1|  hypothetical protein glysoja_018869                   87.0    9e-18   Glycine soja [wild soybean]
ref|XP_002279170.2|  PREDICTED: tobamovirus multiplication protei...  86.3    1e-17   Vitis vinifera
emb|CBI33948.3|  unnamed protein product                              85.9    1e-17   Vitis vinifera
gb|KHG01123.1|  hypothetical protein F383_00667                       86.3    2e-17   Gossypium arboreum [tree cotton]
ref|XP_004509001.1|  PREDICTED: tetraspanin-20-like isoform X1        85.9    2e-17   Cicer arietinum [garbanzo]
ref|XP_004245872.1|  PREDICTED: tobamovirus multiplication protei...  85.9    2e-17   Solanum lycopersicum
gb|KHN01670.1|  hypothetical protein glysoja_012981                   85.9    2e-17   Glycine soja [wild soybean]
ref|NP_001240069.1|  uncharacterized protein LOC100793680             85.9    2e-17   Glycine max [soybeans]
ref|XP_008238361.1|  PREDICTED: tobamovirus multiplication protei...  85.9    2e-17   Prunus mume [ume]
ref|XP_007209447.1|  hypothetical protein PRUPE_ppa009704mg           85.9    2e-17   Prunus persica
gb|KEH31557.1|  tetraspanin family protein                            85.5    2e-17   Medicago truncatula
gb|ACU24289.1|  unknown                                               85.5    2e-17   Glycine max [soybeans]
ref|XP_010275310.1|  PREDICTED: tobamovirus multiplication protei...  85.5    3e-17   Nelumbo nucifera [Indian lotus]
dbj|BAD94952.1|  hypothetical protein                                 82.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAD09513.1|  GMFP4                                                 82.8    3e-17   Glycine max [soybeans]
ref|XP_003539155.1|  PREDICTED: tobamovirus multiplication protei...  85.1    3e-17   Glycine max [soybeans]
ref|XP_007156638.1|  hypothetical protein PHAVU_002G004900g           85.1    4e-17   Phaseolus vulgaris [French bean]
ref|XP_006485406.1|  PREDICTED: tobamovirus multiplication protei...  84.7    4e-17   Citrus sinensis [apfelsine]
ref|XP_010104372.1|  hypothetical protein L484_023325                 84.3    6e-17   
gb|AFK40219.1|  unknown                                               84.3    6e-17   Lotus japonicus
ref|XP_010269960.1|  PREDICTED: tobamovirus multiplication protei...  84.3    7e-17   Nelumbo nucifera [Indian lotus]
gb|KJB37690.1|  hypothetical protein B456_006G215600                  84.3    7e-17   Gossypium raimondii
gb|KDP36200.1|  hypothetical protein JCGZ_10291                       83.6    1e-16   Jatropha curcas
ref|XP_007156641.1|  hypothetical protein PHAVU_002G005100g           83.6    1e-16   Phaseolus vulgaris [French bean]
ref|XP_004511769.1|  PREDICTED: tetraspanin-20-like isoform X1        83.6    1e-16   Cicer arietinum [garbanzo]
ref|XP_002893721.1|  hypothetical protein ARALYDRAFT_473428           83.6    1e-16   
ref|XP_004148498.1|  PREDICTED: uncharacterized protein LOC101203030  83.2    1e-16   Cucumis sativus [cucumbers]
ref|XP_007156640.1|  hypothetical protein PHAVU_002G005000g           83.2    2e-16   Phaseolus vulgaris [French bean]
ref|XP_003611446.1|  GMFP4                                            82.8    2e-16   
ref|XP_011018623.1|  PREDICTED: tobamovirus multiplication protei...  83.2    2e-16   Populus euphratica
ref|XP_003611445.1|  GMFP4                                            83.2    2e-16   
ref|XP_003524459.1|  PREDICTED: tobamovirus multiplication protei...  82.8    2e-16   
ref|XP_003611447.1|  GMFP4                                            82.8    2e-16   Medicago truncatula
gb|KHN21027.1|  hypothetical protein glysoja_034149                   82.4    2e-16   Glycine soja [wild soybean]
ref|XP_002527636.1|  conserved hypothetical protein                   82.8    2e-16   Ricinus communis
ref|XP_009385932.1|  PREDICTED: tobamovirus multiplication protei...  82.8    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006358577.1|  PREDICTED: tobamovirus multiplication protei...  82.8    3e-16   Solanum tuberosum [potatoes]
gb|EPS67767.1|  hypothetical protein M569_07007                       82.4    3e-16   Genlisea aurea
ref|XP_006368443.1|  GMFP4 family protein                             82.4    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008354195.1|  PREDICTED: tobamovirus multiplication protei...  79.7    4e-16   
ref|XP_008465936.1|  PREDICTED: tobamovirus multiplication protei...  82.0    4e-16   Cucumis melo [Oriental melon]
ref|XP_006305495.1|  hypothetical protein CARUB_v10009959mg           82.0    4e-16   
ref|XP_010499788.1|  PREDICTED: tobamovirus multiplication protei...  82.0    4e-16   Camelina sativa [gold-of-pleasure]
gb|AFK47448.1|  unknown                                               81.6    4e-16   Medicago truncatula
ref|XP_006305496.1|  hypothetical protein CARUB_v10009959mg           82.0    4e-16   Capsella rubella
gb|AAF81337.1|AC007767_17  Contains similarity to GMFP4 from Glyc...  81.6    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564399.1|  tobamovirus multiplication 2A protein               82.0    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461064.1|  PREDICTED: tobamovirus multiplication protei...  82.0    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010478663.1|  PREDICTED: tobamovirus multiplication protei...  81.6    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010677296.1|  PREDICTED: tobamovirus multiplication protei...  81.3    7e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008784675.1|  PREDICTED: tobamovirus multiplication protei...  80.9    1e-15   Phoenix dactylifera
gb|AIX10945.1|  putative tetraspanin family protein                   80.9    1e-15   Gardenia jasminoides
emb|CDX93836.1|  BnaA09g24360D                                        80.5    1e-15   
ref|XP_009114889.1|  PREDICTED: tobamovirus multiplication protei...  80.5    1e-15   Brassica rapa
ref|XP_009345636.1|  PREDICTED: tobamovirus multiplication protei...  80.5    2e-15   Pyrus x bretschneideri [bai li]
emb|CDY01278.1|  BnaC05g24540D                                        80.5    2e-15   
ref|XP_009397919.1|  PREDICTED: tobamovirus multiplication protei...  80.5    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS54049.1|  hypothetical protein TRIUR3_29725                     80.5    2e-15   Triticum urartu
dbj|BAK04010.1|  predicted protein                                    80.1    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ06370.1|  hypothetical protein OsI_28599                        78.2    2e-15   Oryza sativa Indica Group [Indian rice]
gb|EYU17843.1|  hypothetical protein MIMGU_mgv1a0124672mg             79.7    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_003573849.1|  PREDICTED: tobamovirus multiplication protei...  80.1    2e-15   Brachypodium distachyon [annual false brome]
ref|XP_011070225.1|  PREDICTED: tobamovirus multiplication protei...  80.1    2e-15   Sesamum indicum [beniseed]
gb|KCW77897.1|  hypothetical protein EUGRSUZ_D021561                  79.0    2e-15   Eucalyptus grandis [rose gum]
ref|XP_010919853.1|  PREDICTED: tobamovirus multiplication protei...  79.7    2e-15   Elaeis guineensis
ref|XP_006659267.1|  PREDICTED: tobamovirus multiplication protei...  79.7    3e-15   Oryza brachyantha
ref|XP_009151428.1|  PREDICTED: tobamovirus multiplication protei...  79.7    3e-15   Brassica rapa
emb|CDY48874.1|  BnaA05g35820D                                        80.1    3e-15   Brassica napus [oilseed rape]
gb|EYU33039.1|  hypothetical protein MIMGU_mgv1a011319mg              79.7    3e-15   Erythranthe guttata [common monkey flower]
emb|CDY32286.1|  BnaC05g28640D                                        80.5    4e-15   Brassica napus [oilseed rape]
gb|KCW77895.1|  hypothetical protein EUGRSUZ_D021561                  78.6    4e-15   Eucalyptus grandis [rose gum]
ref|XP_010053569.1|  PREDICTED: tobamovirus multiplication protei...  79.3    4e-15   Eucalyptus grandis [rose gum]
ref|XP_010055355.1|  PREDICTED: tobamovirus multiplication protei...  79.0    5e-15   Eucalyptus grandis [rose gum]
gb|KCW71821.1|  hypothetical protein EUGRSUZ_E00307                   78.6    6e-15   Eucalyptus grandis [rose gum]
ref|XP_010933519.1|  PREDICTED: tobamovirus multiplication protei...  78.6    8e-15   Elaeis guineensis
emb|CDP12960.1|  unnamed protein product                              78.2    8e-15   Coffea canephora [robusta coffee]
ref|XP_009590611.1|  PREDICTED: tobamovirus multiplication protei...  78.6    8e-15   Nicotiana tomentosiformis
ref|XP_009788106.1|  PREDICTED: tobamovirus multiplication protei...  78.2    8e-15   Nicotiana sylvestris
ref|XP_010518876.1|  PREDICTED: tobamovirus multiplication protei...  77.8    1e-14   Tarenaya hassleriana [spider flower]
ref|NP_001061444.1|  Os08g0282000                                     77.4    2e-14   
ref|XP_010934868.1|  PREDICTED: tobamovirus multiplication protei...  77.4    2e-14   Elaeis guineensis
ref|NP_001150827.1|  tetraspanin family protein                       77.0    2e-14   Zea mays [maize]
ref|XP_008373605.1|  PREDICTED: tobamovirus multiplication protei...  75.1    2e-14   
ref|XP_006415200.1|  hypothetical protein EUTSA_v10008423mg           76.6    3e-14   Eutrema salsugineum [saltwater cress]
gb|AFW87792.1|  hypothetical protein ZEAMMB73_665682                  74.7    3e-14   
gb|ABK25767.1|  unknown                                               75.9    4e-14   Picea sitchensis
gb|EYU33040.1|  hypothetical protein MIMGU_mgv1a011318mg              76.3    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_004983591.1|  PREDICTED: tetraspanin-18-like isoform X1        76.3    5e-14   
gb|ACL54399.1|  unknown                                               74.3    6e-14   Zea mays [maize]
gb|ABK22053.1|  unknown                                               75.9    7e-14   Picea sitchensis
gb|ACG40574.1|  tetraspanin family protein                            75.5    7e-14   Zea mays [maize]
ref|XP_006847670.1|  hypothetical protein AMTR_s00149p00039360        75.5    8e-14   Amborella trichopoda
ref|XP_008788693.1|  PREDICTED: tobamovirus multiplication protei...  74.7    9e-14   
ref|XP_008788690.1|  PREDICTED: tobamovirus multiplication protei...  75.1    1e-13   Phoenix dactylifera
ref|NP_001146619.1|  hypothetical protein                             74.3    2e-13   Zea mays [maize]
ref|XP_006850026.1|  hypothetical protein AMTR_s00022p00189290        74.3    2e-13   
ref|XP_010538377.1|  PREDICTED: tobamovirus multiplication protei...  73.9    3e-13   Tarenaya hassleriana [spider flower]
ref|XP_009371175.1|  PREDICTED: tobamovirus multiplication protei...  68.6    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_002972323.1|  hypothetical protein SELMODRAFT_172827           66.6    1e-10   
ref|XP_009398578.1|  PREDICTED: tobamovirus multiplication protei...  64.3    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGW24511.1|  hypothetical protein                                  59.3    8e-09   Avicennia marina subsp. marina
ref|XP_001775831.1|  predicted protein                                61.6    1e-08   
ref|XP_009391069.1|  PREDICTED: tobamovirus multiplication protei...  61.2    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN35034.1|  unknown                                               58.9    7e-08   Zea mays [maize]
ref|XP_006659854.1|  PREDICTED: tobamovirus multiplication protei...  58.5    8e-08   
ref|XP_004300273.1|  PREDICTED: tobamovirus multiplication protei...  57.8    2e-07   Fragaria vesca subsp. vesca
ref|XP_001763914.1|  predicted protein                                57.4    3e-07   
ref|XP_003573463.1|  PREDICTED: tobamovirus multiplication protei...  57.4    3e-07   Brachypodium distachyon [annual false brome]
gb|EYU17846.1|  hypothetical protein MIMGU_mgv1a0219311mg             53.9    3e-07   Erythranthe guttata [common monkey flower]
ref|XP_004972786.1|  PREDICTED: tetraspanin-20-like isoform X2        57.0    4e-07   Setaria italica
ref|NP_001061041.1|  Os08g0159100                                     56.2    7e-07   
gb|EEC82932.1|  hypothetical protein OsI_27894                        56.2    8e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002443902.1|  hypothetical protein SORBIDRAFT_07g004040        55.5    1e-06   Sorghum bicolor [broomcorn]
ref|XP_005644373.1|  hypothetical protein COCSUDRAFT_44255            54.7    2e-06   Coccomyxa subellipsoidea C-169
ref|XP_006854320.1|  hypothetical protein AMTR_s00039p00118150        51.6    3e-05   Amborella trichopoda
ref|XP_001762411.1|  predicted protein                                50.8    6e-05   



>gb|KJB25374.1| hypothetical protein B456_004G188200 [Gossypium raimondii]
Length=280

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNRYQP   QPAEER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSESNRYQPVAPQPAEERSRCTIM  280



>ref|XP_011028243.1| PREDICTED: tobamovirus multiplication protein 2A-like [Populus 
euphratica]
Length=280

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+R+QP +AQPAEER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSESHRFQPVSAQPAEERSRCTIM  280



>gb|KHG08208.1| Tetraspanin-33 [Gossypium arboreum]
Length=280

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTY+P ESNRYQP   QPAEER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYSPSESNRYQPVAPQPAEERSRCTIM  280



>gb|KHG29162.1| Solute carrier family 28 member 3 [Gossypium arboreum]
Length=201

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ESNRYQ     PAEER RCTIM
Sbjct  154  SRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  201



>ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039576.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039577.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24076.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24077.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24078.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
Length=280

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNRYQ    QPAEER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSESNRYQQVTPQPAEERSRCTIM  280



>gb|KDO40488.1| hypothetical protein CISIN_1g033708mg [Citrus sinensis]
Length=113

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+R+Q    QPAEER RCTIM
Sbjct  66   SRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVATQPAEERSRCTIM  113



>ref|XP_006385612.1| GMFP4 family protein [Populus trichocarpa]
 gb|ABK92751.1| unknown [Populus trichocarpa]
 gb|ERP63409.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP E +R+QP +AQP EER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSEPHRFQPVSAQPTEERSRCTIM  280



>gb|KJB51696.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=219

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ESNRYQ     PAEER RCTIM
Sbjct  172  SRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  219



>gb|KJB51694.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
 gb|KJB51695.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=280

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ESNRYQ     PAEER RCTIM
Sbjct  233  SRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  280



>ref|XP_003517379.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
Length=283

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNR+Q  N+QP EE+ RCTIM
Sbjct  236  SRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCTIM  283



>gb|KHG29161.1| Stk31 [Gossypium arboreum]
Length=259

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ESNRYQ     PAEER RCTIM
Sbjct  212  SRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  259



>gb|KHN42626.1| hypothetical protein glysoja_018869 [Glycine soja]
Length=283

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNR+Q  N+QP EE+ RCTIM
Sbjct  236  SRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCTIM  283



>ref|XP_002279170.2| PREDICTED: tobamovirus multiplication protein 2A [Vitis vinifera]
Length=280

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNRY P   QP EER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPGQQQPTEERSRCTIM  280



>emb|CBI33948.3| unnamed protein product [Vitis vinifera]
Length=217

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNRY P   QP EER RCTIM
Sbjct  170  SRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPGQQQPTEERSRCTIM  217



>gb|KHG01123.1| hypothetical protein F383_00667 [Gossypium arboreum]
Length=278

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ESNRYQ T  QPAE   RCTIM
Sbjct  231  SRNDAWSARMREKYGLDTSEFTYNPSESNRYQQTAPQPAEGSSRCTIM  278



>ref|XP_004509001.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004509002.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
Length=280

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+R+Q  N+QP EER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVNSQPTEERSRCTIM  280



>ref|XP_004245872.1| PREDICTED: tobamovirus multiplication protein 2A [Solanum lycopersicum]
Length=284

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNRY PT AQP EER  CTIM
Sbjct  237  SRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPTAAQPQEERKGCTIM  284



>gb|KHN01670.1| hypothetical protein glysoja_012981 [Glycine soja]
Length=250

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ES+RYQ  N QP EER RC IM
Sbjct  203  SRNDAWSARMREKYGLDTSEFTYNPSESHRYQQVNPQPTEERSRCAIM  250



>ref|NP_001240069.1| uncharacterized protein LOC100793680 [Glycine max]
 gb|ACU21254.1| unknown [Glycine max]
Length=277

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ES+RYQ  N QP EER RC IM
Sbjct  230  SRNDAWSARMREKYGLDTSEFTYNPSESHRYQQVNPQPTEERSRCAIM  277



>ref|XP_008238361.1| PREDICTED: tobamovirus multiplication protein 2A [Prunus mume]
Length=281

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDT+EFTYNP ESNR+QP  AQP EER RC+IM
Sbjct  235  RNDAWSTRMREKYGLDTAEFTYNPSESNRFQPVPAQPQEERSRCSIM  281



>ref|XP_007209447.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 ref|XP_007209448.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10646.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10647.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
Length=281

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDT+EFTYNP ESNR+QP  AQP EER RC+IM
Sbjct  235  RNDAWSTRMREKYGLDTAEFTYNPSESNRFQPVPAQPQEERSRCSIM  281



>gb|KEH31557.1| tetraspanin family protein [Medicago truncatula]
Length=280

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDTSEFTYNP ES R+Q  N+QPAEER RCTIM
Sbjct  234  RNDAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQPAEERSRCTIM  280



>gb|ACU24289.1| unknown [Glycine max]
Length=283

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
             RNDAWS RMREKYGLDTSEFTYNP ESNR+Q  N+QP EE+ RCTIM
Sbjct  236  GRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCTIM  283



>ref|XP_010275310.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275311.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275312.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275313.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
Length=280

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNR+Q    QPAEER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQGPVQPAEERSRCTIM  280



>dbj|BAD94952.1| hypothetical protein [Arabidopsis thaliana]
Length=95

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  48   SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  95



>gb|AAD09513.1| GMFP4, partial [Glycine max]
Length=111

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+RYQ  N+QP EE  RC IM
Sbjct  64   SRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTEEGSRCAIM  111



>ref|XP_003539155.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
 gb|KHN34864.1| hypothetical protein glysoja_004630 [Glycine soja]
Length=283

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNR+Q  N+QP EE+ RC IM
Sbjct  236  SRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCAIM  283



>ref|XP_007156638.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 ref|XP_007156639.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28632.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28633.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
Length=283

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+DAWSARMREKYGLDTSEFTYNP ES+R+Q  N+QP EE+ RCTIM
Sbjct  236  SRSDAWSARMREKYGLDTSEFTYNPSESSRFQQVNSQPTEEKSRCTIM  283



>ref|XP_006485406.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006485407.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Citrus sinensis]
Length=279

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+R+Q    QPAEER RCTIM
Sbjct  232  SRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVATQPAEERSRCTIM  279



>ref|XP_010104372.1| hypothetical protein L484_023325 [Morus notabilis]
 gb|EXB99792.1| hypothetical protein L484_023325 [Morus notabilis]
Length=251

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNR+Q    QP EER RCTIM
Sbjct  204  SRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVAPQPTEERSRCTIM  251



>gb|AFK40219.1| unknown [Lotus japonicus]
Length=282

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES R+Q  N+QP EER RC IM
Sbjct  235  SRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQPTEERSRCAIM  282



>ref|XP_010269960.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269962.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269963.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269964.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
Length=280

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + NR+Q   AQPAEER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFTYNPSDPNRFQQAPAQPAEERSRCTIM  280



>gb|KJB37690.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
 gb|KJB37691.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
Length=277

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ESNRYQ    QPAEE   CTIM
Sbjct  230  SRNDAWSARMREKYGLDTSEFTYNPSESNRYQQAAPQPAEESSCCTIM  277



>gb|KDP36200.1| hypothetical protein JCGZ_10291 [Jatropha curcas]
Length=279

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEF+YNP ES R+Q    QPAEER RCTIM
Sbjct  232  SRNDAWSTRMREKYGLDTSEFSYNPSESQRFQQVQTQPAEERSRCTIM  279



>ref|XP_007156641.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 ref|XP_007156642.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28635.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28636.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
Length=279

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ES+R+Q  N+Q  EE+ RCTIM
Sbjct  232  SRNDAWSARMREKYGLDTSEFTYNPSESSRFQQVNSQSTEEKSRCTIM  279



>ref|XP_004511769.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004511770.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
 ref|XP_004511771.1| PREDICTED: tetraspanin-20-like isoform X3 [Cicer arietinum]
Length=281

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDTSEFTYNP ES R+Q  N+QP EE+ RCTIM
Sbjct  235  RNDAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQPTEEKSRCTIM  281



>ref|XP_002893721.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69980.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRND WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  233  SRNDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_004148498.1| PREDICTED: uncharacterized protein LOC101203030 [Cucumis sativus]
 ref|XP_004170668.1| PREDICTED: uncharacterized protein LOC101226567 [Cucumis sativus]
 gb|KGN60424.1| hypothetical protein Csa_3G904130 [Cucumis sativus]
Length=279

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+R+Q    QPAEE+ RCTIM
Sbjct  232  SRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVAPQPAEEKSRCTIM  279



>ref|XP_007156640.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
 gb|ESW28634.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
Length=282

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+R+Q  N+Q AEE+ RCTIM
Sbjct  235  SRNDAWSTRMREKYGLDTSEFTYNPSESSRFQQVNSQIAEEKSRCTIM  282



>ref|XP_003611446.1| GMFP4 [Medicago truncatula]
Length=220

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            +RNDAWS RMREKYGLDTSEFTYNP ES R+Q  N+QP EE+ RCTIM
Sbjct  173  NRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANSQPTEEKSRCTIM  220



>ref|XP_011018623.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018624.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018625.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
Length=280

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
             RNDAWS RMREKYGLDTSEF+YNP E +R QP +AQP EER RCTIM
Sbjct  233  GRNDAWSTRMREKYGLDTSEFSYNPSEPHRLQPASAQPTEERSRCTIM  280



>ref|XP_003611445.1| GMFP4 [Medicago truncatula]
Length=294

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDTSEFTYNP ES R+Q  N+QP EE+ RCTIM
Sbjct  248  RNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANSQPTEEKSRCTIM  294



>ref|XP_003524459.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Glycine 
max]
 ref|XP_006579675.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Glycine 
max]
 ref|XP_006579676.1| PREDICTED: tobamovirus multiplication protein 2A isoform X3 [Glycine 
max]
Length=277

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+RYQ  N+QP EE  RC IM
Sbjct  230  SRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTEEGSRCAIM  277



>ref|XP_003611447.1| GMFP4 [Medicago truncatula]
 gb|AES94405.1| tobamovirus multiplication protein 2A [Medicago truncatula]
Length=289

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDTSEFTYNP ES R+Q  N+QP EE+ RCTIM
Sbjct  243  RNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANSQPTEEKSRCTIM  289



>gb|KHN21027.1| hypothetical protein glysoja_034149 [Glycine soja]
Length=250

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+RYQ  N+QP EE  RC IM
Sbjct  203  SRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTEEGSRCAIM  250



>ref|XP_002527636.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34707.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEF+YNP ES+R+Q  + QP EER RCTIM
Sbjct  233  SRNDAWSTRMREKYGLDTSEFSYNPSESHRFQQVSTQPTEERSRCTIM  280



>ref|XP_009385932.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385933.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + NRYQP  A   EERGRC IM
Sbjct  236  SRNDAWSQRMREKYGLDTSEFTYNPSDPNRYQPATAPQVEERGRCIIM  283



>ref|XP_006358577.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358578.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Solanum tuberosum]
Length=284

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNRY PT  QP EER  C IM
Sbjct  237  SRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPTATQPQEERKGCAIM  284



>gb|EPS67767.1| hypothetical protein M569_07007 [Genlisea aurea]
Length=281

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDT+EFTYNP + NRYQ +  QPAEER RCTIM
Sbjct  234  SRNDAWSTRMREKYGLDTTEFTYNPSDPNRYQQSATQPAEERSRCTIM  281



>ref|XP_006368443.1| GMFP4 family protein [Populus trichocarpa]
 gb|ERP65012.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
             RNDAWS RMREKYGLDTSEF+YNP E +R QP  AQP EER RCTIM
Sbjct  233  GRNDAWSTRMREKYGLDTSEFSYNPSEPHRLQPAAAQPTEERSRCTIM  280



>ref|XP_008354195.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=111

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDT+EFTYNP ES+R+Q   AQP EER RC +M
Sbjct  65   RNDAWSTRMREKYGLDTAEFTYNPSESHRFQQVAAQPQEERSRCIVM  111



>ref|XP_008465936.1| PREDICTED: tobamovirus multiplication protein 2A [Cucumis melo]
Length=279

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ES+R+Q    Q AEE+ RCTIM
Sbjct  232  SRNDAWSARMREKYGLDTSEFTYNPSESHRFQQVAPQAAEEKSRCTIM  279



>ref|XP_006305495.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38393.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=256

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  209  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  256



>ref|XP_010499788.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Camelina 
sativa]
 ref|XP_010499789.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Camelina 
sativa]
Length=276

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  229  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  276



>gb|AFK47448.1| unknown [Medicago truncatula]
Length=220

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            +RNDAWS RMREKYGLDTSEFTYNP ES R+Q  N QP EE+ RCTIM
Sbjct  173  NRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANFQPTEEKSRCTIM  220



>ref|XP_006305496.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38394.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=280

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  233  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>gb|AAF81337.1|AC007767_17 Contains similarity to GMFP4 from Glycine max gb|U64915. ESTs 
gb|AV442477, gb|AV441037, gb|AV534954, gb|AV560678 and gb|AV518757 
come from this gene [Arabidopsis thaliana]
Length=252

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  205  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  252



>ref|NP_564399.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_973952.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_001031127.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 sp|Q9C5W7.1|TOM2A_ARATH RecName: Full=Tobamovirus multiplication protein 2A; Short=AtTOM2A 
[Arabidopsis thaliana]
 gb|AAG50101.1|AF334723_1 unknown protein [Arabidopsis thaliana]
 gb|AAK60280.1|AF385687_1 At1g32400/F5D14_22 [Arabidopsis thaliana]
 gb|AAM66092.1| unknown [Arabidopsis thaliana]
 dbj|BAC24019.1| tobamovirus multiplication 2A [Arabidopsis thaliana]
 gb|AEE31476.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31477.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31478.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
Length=280

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  233  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_010461064.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=280

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  233  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_010478663.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=281

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q   AQP EE+GRCTIM
Sbjct  234  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  281



>ref|XP_010677296.1| PREDICTED: tobamovirus multiplication protein 2A [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWSARMREKYGLDTSEFTYNP ES RYQ   AQP  E  RCTIM
Sbjct  231  SRNDAWSARMREKYGLDTSEFTYNPTESGRYQQPAAQPTVEGNRCTIM  278



>ref|XP_008784675.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784676.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784677.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
Length=282

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + +R+Q  +A PA ERGRCTI+
Sbjct  235  SRNDAWSQRMREKYGLDTSEFTYNPLDPSRHQQASAPPAAERGRCTIL  282



>gb|AIX10945.1| putative tetraspanin family protein [Gardenia jasminoides]
Length=286

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNR     AQP EER RCTIM
Sbjct  239  SRNDAWSTRMREKYGLDTSEFTYNPSESNRTLQGAAQPTEERSRCTIM  286



>emb|CDX93836.1| BnaA09g24360D [Brassica napus]
Length=281

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q    QP EE+GRCTIM
Sbjct  234  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_009114889.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=281

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q    QP EE+GRCTIM
Sbjct  234  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_009345636.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009345644.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=282

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDT+EFTYNP ES+R+Q   AQP EER RC +M
Sbjct  236  RNDAWSTRMREKYGLDTAEFTYNPSESHRFQQVAAQPQEERSRCIVM  282



>emb|CDY01278.1| BnaC05g24540D [Brassica napus]
Length=281

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q    QP EE+GRCTIM
Sbjct  234  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_009397919.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + +RYQ     PAEERG CTI+
Sbjct  237  SRNDAWSQRMREKYGLDTSEFTYNPSDPSRYQQATVPPAEERGHCTIL  284



>gb|EMS54049.1| hypothetical protein TRIUR3_29725 [Triticum urartu]
Length=285

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP ++ RYQ   A PAEER RCT+M
Sbjct  238  SRNDAWSQRMREKYGLDTSQFTYNPSDATRYQQNGAPPAEERSRCTVM  285



>dbj|BAK04010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP ++ RYQ   A PAEER RCT+M
Sbjct  238  SRNDAWSQRMREKYGLDTSQFTYNPSDATRYQQNGAPPAEERSRCTVM  285



>gb|EAZ06370.1| hypothetical protein OsI_28599 [Oryza sativa Indica Group]
 gb|EAZ42170.1| hypothetical protein OsJ_26734 [Oryza sativa Japonica Group]
Length=134

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ   A PAEER RC I+
Sbjct  87   SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPPAEERNRCVIL  134



>gb|EYU17843.1| hypothetical protein MIMGU_mgv1a0124672mg, partial [Erythranthe 
guttata]
Length=221

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR D+WS RMREKYGLDTSEFTYNP ESNRYQ +  QP+EER RC I+
Sbjct  173  SRTDSWSTRMREKYGLDTSEFTYNPSESNRYQQSATQPSEERNRCCII  220



>ref|XP_003573849.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=283

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP +S RYQ   A PAEER RCTI+
Sbjct  236  SRNDAWSQRMREKYGLDTSQFTYNPSDSARYQQNGAPPAEERNRCTIL  283



>ref|XP_011070225.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
 ref|XP_011070226.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
Length=281

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ESNRY     QP EER RC IM
Sbjct  234  SRNDAWSTRMREKYGLDTSEFTYNPNESNRYPQAATQPQEERSRCIIM  281



>gb|KCW77897.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=188

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDT+EF+YNP ESNR+Q    QP EER RC+IM
Sbjct  141  SRNDAWSTRMREKYGLDTAEFSYNPNESNRFQQGPTQPTEERSRCSIM  188



>ref|XP_010919853.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
 ref|XP_010919854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=282

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + +R+Q  +A P +ERGRCTI+
Sbjct  235  SRNDAWSQRMREKYGLDTSEFTYNPLDPSRHQQASAPPPDERGRCTIL  282



>ref|XP_006659267.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=287

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP ++ RYQ   A PAEER RC IM
Sbjct  240  SRNDAWSQRMREKYGLDTSQFTYNPSDAGRYQQNGAPPAEERSRCVIM  287



>ref|XP_009151428.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=279

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q    QP EE+GRCTIM
Sbjct  232  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  279



>emb|CDY48874.1| BnaA05g35820D [Brassica napus]
Length=344

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q    QP EE+GRCTIM
Sbjct  297  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  344



>gb|EYU33039.1| hypothetical protein MIMGU_mgv1a011319mg [Erythranthe guttata]
Length=285

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR D+WS RMREKYGLDTSEFTYNP ESNRYQ +  QP+EER RC I+
Sbjct  237  SRTDSWSTRMREKYGLDTSEFTYNPSESNRYQQSATQPSEERNRCCII  284



>emb|CDY32286.1| BnaC05g28640D [Brassica napus]
Length=370

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q    QP EE+GRCTIM
Sbjct  323  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  370



>gb|KCW77895.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
 gb|KCW77896.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=204

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDT+EF+YNP ESNR+Q    QP EER RC+IM
Sbjct  157  SRNDAWSTRMREKYGLDTAEFSYNPNESNRFQQGPTQPTEERSRCSIM  204



>ref|XP_010053569.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053570.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053571.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
Length=284

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDT+EF+YNP ESNR+Q    QP EER RC+IM
Sbjct  237  SRNDAWSTRMREKYGLDTAEFSYNPNESNRFQQGPTQPTEERSRCSIM  284



>ref|XP_010055355.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 gb|KCW71822.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=279

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAW+ARMREKYGLDTSEFTYNP ES+R+Q    Q AEER RCTIM
Sbjct  233  RNDAWTARMREKYGLDTSEFTYNPSESSRHQQVPPQNAEERSRCTIM  279



>gb|KCW71821.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=260

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAW+ARMREKYGLDTSEFTYNP ES+R+Q    Q AEER RCTIM
Sbjct  214  RNDAWTARMREKYGLDTSEFTYNPSESSRHQQVPPQNAEERSRCTIM  260



>ref|XP_010933519.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=283

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFT+NP   +RY   +A PAEERGRCTI+
Sbjct  236  SRNDAWSQRMREKYGLDTSEFTHNPSGLSRYHQASAPPAEERGRCTIL  283



>emb|CDP12960.1| unnamed protein product [Coffea canephora]
Length=221

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -2

Query  409  SRNDAWSARMREK--YGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREK  YGLDTSEFTYNP +SNRY    AQP EER RCTIM
Sbjct  172  SRNDAWSTRMREKACYGLDTSEFTYNPSDSNRYPQGTAQPTEERSRCTIM  221



>ref|XP_009590611.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
 ref|XP_009590612.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
Length=283

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP +SNRY  T  QP EER  C IM
Sbjct  236  SRNDAWSTRMREKYGLDTSEFTYNPSDSNRYPQTAVQPQEERKGCAIM  283



>ref|XP_009788106.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
 ref|XP_009788107.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
Length=283

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP +SNRY  T  QP EER  C IM
Sbjct  236  SRNDAWSTRMREKYGLDTSEFTYNPSDSNRYPQTAVQPQEERKGCAIM  283



>ref|XP_010518876.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
 ref|XP_010518877.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
Length=279

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ES+R+Q   AQ  EER RC +M
Sbjct  232  SRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQMPAQQNEERSRCIVM  279



>ref|NP_001061444.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAC99958.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF23358.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAG95056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ   A PAEER RC I+
Sbjct  237  SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPPAEERNRCVIL  284



>ref|XP_010934868.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Elaeis 
guineensis]
Length=280

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + +R+Q      AEERGRCTI+
Sbjct  233  SRNDAWSQRMREKYGLDTSEFTYNPSDPSRFQQATITSAEERGRCTIL  280



>ref|NP_001150827.1| tetraspanin family protein [Zea mays]
 ref|XP_008678655.1| PREDICTED: tetraspanin family protein isoform X1 [Zea mays]
 gb|ACN27909.1| unknown [Zea mays]
 tpg|DAA46389.1| TPA: tetraspanin family protein isoform 1 [Zea mays]
 tpg|DAA46390.1| TPA: tetraspanin family protein isoform 2 [Zea mays]
Length=279

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ   A  AEER RCTIM
Sbjct  232  SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQAEERSRCTIM  279



>ref|XP_008373605.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=109

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDT+EFTYNP ES R    +AQP EER RC IM
Sbjct  64   SRNDAWSTRMREKYGLDTAEFTYNPSESQRQ--VSAQPQEERSRCIIM  109



>ref|XP_006415200.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
 dbj|BAJ34310.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33553.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
Length=280

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+D WSARMREKYGLDTSEFTYNP ES+R+Q    Q  EE+GRCTIM
Sbjct  233  SRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQQNEEKGRCTIM  280



>gb|AFW87792.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=113

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ      AEER RCTIM
Sbjct  66   SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTPRAEERSRCTIM  113



>gb|ABK25767.1| unknown [Picea sitchensis]
Length=196

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ++NRY      P EE+ RCTIM
Sbjct  149  SRNDAWSTRMREKYGLDTSEFTYNPTDANRYAQPAPPPPEEKSRCTIM  196



>gb|EYU33040.1| hypothetical protein MIMGU_mgv1a011318mg [Erythranthe guttata]
Length=285

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGR-CTIM  266
            SR D+WS RMREKYGLDTSE+TYNP ESNRYQ +  QP+EER R CTIM
Sbjct  237  SRTDSWSRRMREKYGLDTSEYTYNPSESNRYQQSTTQPSEERSRGCTIM  285



>ref|XP_004983591.1| PREDICTED: tetraspanin-18-like isoform X1 [Setaria italica]
 ref|XP_004983592.1| PREDICTED: tetraspanin-18-like isoform X2 [Setaria italica]
Length=278

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ   A  AEER RCTI+
Sbjct  231  SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQAEERSRCTIL  278



>gb|ACL54399.1| unknown [Zea mays]
 gb|AFW87793.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
 gb|AFW87794.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=129

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ      AEER RCTIM
Sbjct  82   SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTPRAEERSRCTIM  129



>gb|ABK22053.1| unknown [Picea sitchensis]
Length=282

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP ++NRY      P EE+ RCTIM
Sbjct  235  SRNDAWSTRMREKYGLDTSEFTYNPTDANRYAQPAPPPPEEKSRCTIM  282



>gb|ACG40574.1| tetraspanin family protein [Zea mays]
Length=279

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ   A  AEER +CTIM
Sbjct  232  SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQAEERSQCTIM  279



>ref|XP_006847670.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
 gb|ERN09251.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
Length=284

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS R+REKYGLDTSEFTYNP +S+R+Q   A  AEER RC+I+
Sbjct  237  SRNDAWSTRLREKYGLDTSEFTYNPTDSSRFQQQAAPVAEERSRCSIL  284



>ref|XP_008788693.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Phoenix dactylifera]
Length=202

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + +R+Q      AEE GRCTI+
Sbjct  155  SRNDAWSQRMREKYGLDTSEFTYNPSDPSRFQQATVTSAEESGRCTIL  202



>ref|XP_008788690.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788691.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788692.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
Length=279

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTSEFTYNP + +R+Q      AEE GRCTI+
Sbjct  232  SRNDAWSQRMREKYGLDTSEFTYNPSDPSRFQQATVTSAEESGRCTIL  279



>ref|NP_001146619.1| hypothetical protein [Zea mays]
 gb|ACF86508.1| unknown [Zea mays]
 gb|ACR38384.1| unknown [Zea mays]
 gb|AFW87797.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=279

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SRNDAWS RMREKYGLDTS+FTYNP + +RYQ      AEER RCTIM
Sbjct  232  SRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTPRAEERSRCTIM  279



>ref|XP_006850026.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
 gb|ERN11607.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
Length=276

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            R DAWS RM+EKYGLDTSEFTYNP ES RY      PAEER RCTIM
Sbjct  230  RPDAWSTRMKEKYGLDTSEFTYNPSESGRYTAPAPAPAEERSRCTIM  276



>ref|XP_010538377.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
 ref|XP_010538378.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
Length=280

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERG-RCTIM  266
            SR+DAWS RMREKYGLDTSEFTYNP E+NR+Q   +Q  +ERG RCTIM
Sbjct  232  SRDDAWSTRMREKYGLDTSEFTYNPSEANRFQQMPSQQNDERGSRCTIM  280



>ref|XP_009371175.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371176.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371177.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=280

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGL+T+EFTYNP ES      +AQP EER RC IM
Sbjct  236  RNDAWSTRMREKYGLNTAEFTYNPSESQ--SQVSAQPQEERSRCIIM  280



>ref|XP_002972323.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
 gb|EFJ26409.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
Length=282

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYGLDT+EFTYNP +S R    N  P E +  C IM
Sbjct  236  RNDAWSTRMREKYGLDTAEFTYNPVDSKRVPAQNQPPPEPKRGCVIM  282



>ref|XP_009398578.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            SR+DAWS RMREKYGLDTS+FTYN  + NR Q +    +EERG C I+
Sbjct  236  SRHDAWSQRMREKYGLDTSKFTYNSSDPNRSQQSATPSSEERGGCNIL  283



>gb|AGW24511.1| hypothetical protein, partial [Avicennia marina var. marina]
Length=91

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNR  320
            SRNDAWS RMREKYGLDTSEFTY+P ESNR
Sbjct  59   SRNDAWSQRMREKYGLDTSEFTYSPSESNR  88



>ref|XP_001775831.1| predicted protein [Physcomitrella patens]
 gb|EDQ59370.1| predicted protein [Physcomitrella patens]
Length=297

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            R+DAWS RMREKYGLDT+EFT NP ES R         E++ RCTIM
Sbjct  251  RSDAWSIRMREKYGLDTTEFTSNPSESMRLSNQTPAAEEQQSRCTIM  297



>ref|XP_009391069.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391140.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391209.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391294.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERG-RCTIM  266
            SRNDAWS RMREKYGL+T EF Y     +RYQ   A  AEERG RC I+
Sbjct  227  SRNDAWSQRMREKYGLNTFEFAYKQSNPSRYQQATASQAEERGSRCIIL  275



>gb|ACN35034.1| unknown [Zea mays]
 gb|AFW61169.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=275

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 7/47 (15%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYG+D+       F+ NR+QP    P E+R RCTI+
Sbjct  236  RNDAWSQRMREKYGVDS-------FDPNRFQPATISPGEQRNRCTIL  275



>ref|XP_006659854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=250

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 7/47 (15%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYG+DT       F+ NR+Q     PAE+R RCTI+
Sbjct  211  RNDAWSQRMREKYGVDT-------FDPNRFQQATISPAEQRSRCTIL  250



>ref|XP_004300273.1| PREDICTED: tobamovirus multiplication protein 2A [Fragaria vesca 
subsp. vesca]
Length=271

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            +RNDAWS RMREKYGLDTS + Y+P +S+R Q   AQP EER RC+IM
Sbjct  224  TRNDAWSTRMREKYGLDTSLYPYDPSDSSRLQQPQAQPQEERSRCSIM  271



>ref|XP_001763914.1| predicted protein [Physcomitrella patens]
 gb|EDQ71318.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNR-YQPTNA-QPAEERGRCTIM  266
            R DAWS RMREKYGLDTSEFT  P ES R  QP     P E++  CTIM
Sbjct  236  RLDAWSTRMREKYGLDTSEFTSKPSESRRPLQPNQTPGPVEQQNFCTIM  284



>ref|XP_003573463.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=278

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 7/47 (15%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMR+KYG+DT       F+ NR+Q     PAE+R RCTI+
Sbjct  239  RNDAWSQRMRDKYGVDT-------FDPNRFQQATISPAEQRSRCTIL  278



>gb|EYU17846.1| hypothetical protein MIMGU_mgv1a0219311mg, partial [Erythranthe 
guttata]
Length=35

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -2

Query  370  YGLDTSEFTYNPFESNRYQPTNAQPAEERGR-CTI  269
            YGLDTSE+TYNP ESNRYQ +  QP+EER R CTI
Sbjct  1    YGLDTSEYTYNPSESNRYQQSTTQPSEERSRGCTI  35



>ref|XP_004972786.1| PREDICTED: tetraspanin-20-like isoform X2 [Setaria italica]
Length=278

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 7/47 (15%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYG+D+       F+ NR+Q     PAE+R RCTI+
Sbjct  239  RNDAWSQRMREKYGVDS-------FDPNRFQQATISPAEQRNRCTIL  278



>ref|NP_001061041.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAC99658.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF22955.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAG92210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91640.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68082.1| hypothetical protein OsJ_26119 [Oryza sativa Japonica Group]
Length=278

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 7/47 (15%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYG+DT       F+ NR+Q     PAE+R RC I+
Sbjct  239  RNDAWSQRMREKYGVDT-------FDPNRFQQATISPAEQRNRCAIL  278



>gb|EEC82932.1| hypothetical protein OsI_27894 [Oryza sativa Indica Group]
Length=305

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 7/47 (15%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYG+DT       F+ NR+Q     PAE+R RC I+
Sbjct  266  RNDAWSQRMREKYGVDT-------FDPNRFQQATISPAEQRNRCAIL  305



>ref|XP_002443902.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
 gb|EES13397.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
Length=274

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 7/47 (15%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            RNDAWS RMREKYG+D+       F+ NR+Q     P E+R RCTI+
Sbjct  235  RNDAWSQRMREKYGVDS-------FDPNRFQQATISPGEQRNRCTIL  274



>ref|XP_005644373.1| hypothetical protein COCSUDRAFT_44255 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19829.1| hypothetical protein COCSUDRAFT_44255 [Coccomyxa subellipsoidea 
C-169]
Length=244

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 4/52 (8%)
 Frame = -2

Query  409  SRNDAWSARMREKYGLDTSEFTYNPFE----SNRYQPTNAQPAEERGRCTIM  266
            +R DAWSARMR+KYGLDTS +TYNP +    S    P  A+ A    RC +M
Sbjct  193  ARTDAWSARMRDKYGLDTSRYTYNPDDRRASSGSELPAGAETAATSRRCAVM  244



>ref|XP_006854320.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
 gb|ERN15787.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
Length=313

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 5/48 (10%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEE-RGRCTIM  266
            R DAWSARMREKYGL+ +EF YN  E++    T  +  EE +GRC IM
Sbjct  270  RTDAWSARMREKYGLNPNEFAYNSIEAS----TGMRNGEENQGRCIIM  313



>ref|XP_001762411.1| predicted protein [Physcomitrella patens]
 gb|EDQ72878.1| predicted protein [Physcomitrella patens]
Length=298

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  406  RNDAWSARMREKYGLDTSEFTYNPFESNRYQPTNAQPAEERGRCTIM  266
            R+DAWS RMREKYGLDT+EF+ N  +  R         E++ RC IM
Sbjct  252  RSDAWSTRMREKYGLDTTEFSSNSPDMRRLPNQTPGAEEQQSRCIIM  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566707135225