BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF051A22

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97395.1|  unnamed protein product                              93.2    3e-19   Coffea canephora [robusta coffee]
ref|XP_009795485.1|  PREDICTED: uncharacterized protein LOC104242165  89.7    6e-18   Nicotiana sylvestris
ref|XP_004230605.1|  PREDICTED: uncharacterized protein LOC101261168  89.4    8e-18   Solanum lycopersicum
ref|XP_004136424.1|  PREDICTED: uncharacterized protein LOC101205953  87.0    3e-17   Cucumis sativus [cucumbers]
ref|XP_002522625.1|  conserved hypothetical protein                   86.7    5e-17   
ref|XP_008466168.1|  PREDICTED: uncharacterized protein LOC103503664  85.9    7e-17   Cucumis melo [Oriental melon]
ref|XP_002283891.2|  PREDICTED: uncharacterized protein LOC100247170  86.7    7e-17   
gb|KHN08240.1|  hypothetical protein glysoja_017718                   82.8    1e-16   Glycine soja [wild soybean]
ref|XP_004501628.1|  PREDICTED: uncharacterized protein LOC101506643  85.9    2e-16   Cicer arietinum [garbanzo]
gb|KHN25062.1|  hypothetical protein glysoja_046599                   82.0    2e-16   Glycine soja [wild soybean]
ref|XP_011088137.1|  PREDICTED: uncharacterized protein LOC105169445  85.5    2e-16   Sesamum indicum [beniseed]
ref|XP_003522750.2|  PREDICTED: uncharacterized protein LOC100789170  83.6    3e-16   Glycine max [soybeans]
ref|XP_003527872.2|  PREDICTED: uncharacterized protein LOC100793605  83.2    3e-16   
gb|KHN26129.1|  hypothetical protein glysoja_019453                   81.6    3e-16   Glycine soja [wild soybean]
ref|XP_003544241.1|  PREDICTED: uncharacterized protein LOC100781768  82.8    5e-16   
ref|XP_003518255.1|  PREDICTED: uncharacterized protein LOC100814797  82.4    7e-16   Glycine max [soybeans]
ref|XP_008219312.1|  PREDICTED: uncharacterized protein LOC103319539  83.2    7e-16   
gb|EYU39115.1|  hypothetical protein MIMGU_mgv1a027069mg              84.0    7e-16   Erythranthe guttata [common monkey flower]
ref|XP_002273743.3|  PREDICTED: uncharacterized protein LOC100249012  84.0    8e-16   
ref|XP_008347812.1|  PREDICTED: uncharacterized protein LOC103410942  84.0    8e-16   Malus domestica [apple tree]
gb|KJB59886.1|  hypothetical protein B456_009G279400                  83.2    1e-15   Gossypium raimondii
ref|XP_003602935.1|  hypothetical protein MTR_3g100550                83.2    1e-15   
ref|XP_010030014.1|  PREDICTED: uncharacterized protein LOC104419886  83.2    1e-15   Eucalyptus grandis [rose gum]
ref|XP_007226906.1|  hypothetical protein PRUPE_ppa016217mg           83.2    2e-15   
ref|XP_008352712.1|  PREDICTED: uncharacterized protein LOC103416231  82.8    2e-15   
ref|XP_009374286.1|  PREDICTED: uncharacterized protein LOC103963226  82.4    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_009342577.1|  PREDICTED: uncharacterized protein LOC103934551  82.4    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_009375494.1|  PREDICTED: uncharacterized protein LOC103964299  82.0    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_010064231.1|  PREDICTED: uncharacterized protein LOC104451216  82.0    4e-15   Eucalyptus grandis [rose gum]
ref|XP_009595944.1|  PREDICTED: uncharacterized protein LOC104092128  82.8    4e-15   
ref|XP_010939748.1|  PREDICTED: uncharacterized protein LOC105058495  81.6    4e-15   Elaeis guineensis
ref|XP_010273765.1|  PREDICTED: uncharacterized protein LOC104609205  81.6    6e-15   Nelumbo nucifera [Indian lotus]
ref|XP_007018202.1|  Uncharacterized protein TCM_034490               81.6    6e-15   
ref|XP_007141255.1|  hypothetical protein PHAVU_008G180600g           79.3    7e-15   Phaseolus vulgaris [French bean]
ref|XP_010099469.1|  hypothetical protein L484_011169                 82.0    7e-15   
ref|XP_008223356.1|  PREDICTED: uncharacterized protein LOC103323165  80.9    8e-15   Prunus mume [ume]
ref|XP_007137646.1|  hypothetical protein PHAVU_009G143900g           79.3    8e-15   Phaseolus vulgaris [French bean]
ref|XP_009381478.1|  PREDICTED: uncharacterized protein LOC103969619  80.9    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP41466.1|  hypothetical protein JCGZ_15873                       80.5    1e-14   Jatropha curcas
gb|KDP26665.1|  hypothetical protein JCGZ_17823                       80.1    2e-14   Jatropha curcas
gb|AFK37639.1|  unknown                                               80.1    2e-14   Medicago truncatula
ref|XP_008390578.1|  PREDICTED: uncharacterized protein LOC103452820  80.1    2e-14   
ref|XP_002514025.1|  conserved hypothetical protein                   80.1    2e-14   Ricinus communis
ref|XP_011092449.1|  PREDICTED: uncharacterized protein LOC105172627  80.1    2e-14   
gb|AES98227.2|  transmembrane protein, putative                       80.1    2e-14   Medicago truncatula
ref|XP_003608416.1|  hypothetical protein MTR_4g093860                79.7    2e-14   Medicago truncatula
ref|XP_011462229.1|  PREDICTED: uncharacterized protein LOC105350910  79.7    2e-14   Fragaria vesca subsp. vesca
gb|KDP27984.1|  hypothetical protein JCGZ_19064                       80.1    2e-14   Jatropha curcas
ref|XP_002301090.2|  hypothetical protein POPTR_0002s10470g           79.3    2e-14   
ref|XP_009588038.1|  PREDICTED: uncharacterized protein LOC104085654  79.7    3e-14   Nicotiana tomentosiformis
ref|XP_004252809.1|  PREDICTED: uncharacterized protein LOC101251865  79.7    3e-14   Solanum lycopersicum
emb|CDY39912.1|  BnaA09g14940D                                        79.7    3e-14   Brassica napus [oilseed rape]
gb|AEM45875.1|  hypothetical protein                                  79.7    3e-14   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_009113331.1|  PREDICTED: uncharacterized protein LOC103838632  79.3    3e-14   Brassica rapa
gb|KJB29354.1|  hypothetical protein B456_005G0963001                 77.8    3e-14   Gossypium raimondii
ref|XP_003615269.1|  hypothetical protein MTR_5g065970                79.7    3e-14   
ref|XP_011016907.1|  PREDICTED: uncharacterized protein LOC105120427  79.3    3e-14   Populus euphratica
emb|CDY29160.1|  BnaC09g15570D                                        79.3    4e-14   Brassica napus [oilseed rape]
ref|XP_009770120.1|  PREDICTED: uncharacterized protein LOC104220858  79.0    5e-14   Nicotiana sylvestris
ref|XP_009618057.1|  PREDICTED: uncharacterized protein LOC104110298  79.0    5e-14   Nicotiana tomentosiformis
ref|XP_011023096.1|  PREDICTED: uncharacterized protein LOC105124692  78.6    7e-14   Populus euphratica
ref|XP_002323954.2|  hypothetical protein POPTR_0017s07500g           78.2    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010548868.1|  PREDICTED: uncharacterized protein LOC104820197  78.2    9e-14   Tarenaya hassleriana [spider flower]
ref|XP_002310494.2|  hypothetical protein POPTR_0007s03500g           78.2    9e-14   
ref|XP_004504833.1|  PREDICTED: uncharacterized protein LOC101507733  77.8    9e-14   Cicer arietinum [garbanzo]
gb|KFK40909.1|  hypothetical protein AALP_AA2G059000                  78.2    1e-13   Arabis alpina [alpine rockcress]
ref|XP_011043120.1|  PREDICTED: uncharacterized protein LOC105138666  77.8    1e-13   Populus euphratica
emb|CDY23810.1|  BnaA01g21610D                                        76.3    1e-13   Brassica napus [oilseed rape]
emb|CDP11491.1|  unnamed protein product                              77.8    1e-13   Coffea canephora [robusta coffee]
gb|AAG50763.1|AC079131_8  hypothetical protein                        77.8    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301429.1|  hypothetical protein CARUB_v10021847mg           77.8    1e-13   Capsella rubella
ref|XP_010470285.1|  PREDICTED: uncharacterized protein LOC104750...  77.8    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002886704.1|  hypothetical protein ARALYDRAFT_475423           77.4    2e-13   Arabidopsis lyrata subsp. lyrata
ref|NP_176109.2|  uncharacterized protein                             77.4    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006597360.1|  PREDICTED: uncharacterized protein LOC102659744  77.0    2e-13   Glycine max [soybeans]
ref|XP_006392327.1|  hypothetical protein EUTSA_v10023489mg           77.0    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010511088.1|  PREDICTED: uncharacterized protein LOC104787248  77.0    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_007223120.1|  hypothetical protein PRUPE_ppa007125mg           76.6    3e-13   
ref|XP_006338079.1|  PREDICTED: uncharacterized protein LOC102584542  76.6    3e-13   Solanum tuberosum [potatoes]
ref|XP_010414766.1|  PREDICTED: uncharacterized protein LOC104700863  76.6    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010470286.1|  PREDICTED: uncharacterized protein LOC104750...  76.6    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009774622.1|  PREDICTED: uncharacterized protein LOC104224639  76.6    3e-13   Nicotiana sylvestris
ref|XP_010272926.1|  PREDICTED: uncharacterized protein LOC104608592  76.3    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_004301360.1|  PREDICTED: uncharacterized protein LOC101307700  75.9    5e-13   Fragaria vesca subsp. vesca
ref|XP_009102651.1|  PREDICTED: uncharacterized protein LOC103828765  75.9    6e-13   Brassica rapa
gb|EPS65863.1|  hypothetical protein M569_08912                       75.1    6e-13   Genlisea aurea
ref|XP_004490432.1|  PREDICTED: uncharacterized protein LOC101499123  75.9    6e-13   
emb|CDY46867.1|  BnaC01g27710D                                        75.9    7e-13   Brassica napus [oilseed rape]
gb|AFK34019.1|  unknown                                               73.6    8e-13   Lotus japonicus
ref|XP_010544075.1|  PREDICTED: uncharacterized protein LOC104816801  75.5    9e-13   Tarenaya hassleriana [spider flower]
ref|XP_008340704.1|  PREDICTED: uncharacterized protein LOC103403638  74.7    1e-12   Malus domestica [apple tree]
ref|XP_004237982.2|  PREDICTED: uncharacterized protein LOC101250984  73.9    1e-12   
ref|XP_009387165.1|  PREDICTED: uncharacterized protein LOC103974130  73.9    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413889.1|  PREDICTED: uncharacterized protein LOC103995101  73.6    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007042870.1|  Nuclear transcription factor Y subunit C-4, ...  72.8    7e-12   
ref|XP_010675283.1|  PREDICTED: uncharacterized protein LOC104891302  71.6    2e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB32109.1|  hypothetical protein B456_005G224700                  70.9    3e-11   Gossypium raimondii
gb|KJB29352.1|  hypothetical protein B456_005G0962001                 65.5    6e-11   Gossypium raimondii
ref|XP_010107693.1|  hypothetical protein L484_007712                 64.7    1e-10   
gb|AFK46323.1|  unknown                                               63.9    2e-10   Lotus japonicus
gb|KDO43414.1|  hypothetical protein CISIN_1g038765mg                 62.4    1e-09   Citrus sinensis [apfelsine]
ref|XP_009389561.1|  PREDICTED: uncharacterized protein LOC103976099  65.1    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404440.1|  PREDICTED: uncharacterized protein LOC103987768  64.3    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916833.1|  PREDICTED: uncharacterized protein LOC105041590  63.5    9e-09   
gb|KJB77076.1|  hypothetical protein B456_012G119400                  62.4    3e-08   Gossypium raimondii
ref|XP_006657971.1|  PREDICTED: uncharacterized protein LOC102715955  61.2    4e-08   Oryza brachyantha
ref|XP_006433845.1|  hypothetical protein CICLE_v10003130mg           60.5    5e-08   
gb|KDO81145.1|  hypothetical protein CISIN_1g016299mg                 60.8    6e-08   Citrus sinensis [apfelsine]
ref|XP_006841211.1|  hypothetical protein AMTR_s00135p00032540        58.9    3e-07   Amborella trichopoda
ref|XP_008384718.1|  PREDICTED: uncharacterized protein LOC103447298  58.9    4e-07   
ref|XP_010423986.1|  PREDICTED: uncharacterized protein LOC104709020  58.5    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010451944.1|  PREDICTED: uncharacterized protein LOC104734132  58.5    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010093564.1|  hypothetical protein L484_014002                 57.4    5e-07   
ref|XP_006289569.1|  hypothetical protein CARUB_v10003115mg           57.8    8e-07   Capsella rubella
gb|KDO63279.1|  hypothetical protein CISIN_1g010086mg                 57.8    8e-07   Citrus sinensis [apfelsine]
ref|XP_006481123.1|  PREDICTED: uncharacterized protein LOC102608338  57.8    8e-07   Citrus sinensis [apfelsine]
gb|EEE67606.1|  hypothetical protein OsJ_25158                        57.4    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002272461.1|  PREDICTED: uncharacterized protein LOC100265673  57.8    9e-07   Vitis vinifera
ref|XP_006429503.1|  hypothetical protein CICLE_v10011494mg           57.8    9e-07   Citrus clementina [clementine]
gb|EYU41971.1|  hypothetical protein MIMGU_mgv1a027046mg              57.4    1e-06   Erythranthe guttata [common monkey flower]
emb|CAN65583.1|  hypothetical protein VITISV_019793                   56.2    1e-06   Vitis vinifera
ref|XP_008231499.1|  PREDICTED: uncharacterized protein LOC103330643  57.0    2e-06   Prunus mume [ume]
ref|XP_002264939.1|  PREDICTED: uncharacterized protein LOC100263765  56.6    2e-06   Vitis vinifera
ref|XP_010490518.1|  PREDICTED: uncharacterized protein LOC104768289  56.6    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011095084.1|  PREDICTED: uncharacterized protein LOC105174622  56.6    2e-06   
tpg|DAA64242.1|  TPA: hypothetical protein ZEAMMB73_693239            53.1    2e-06   
ref|XP_010543177.1|  PREDICTED: uncharacterized protein LOC104816178  56.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010277645.1|  PREDICTED: uncharacterized protein LOC104612037  56.2    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006398590.1|  hypothetical protein EUTSA_v10015877mg           56.2    3e-06   Eutrema salsugineum [saltwater cress]
gb|KFK24641.1|  hypothetical protein AALP_AA8G005900                  55.8    3e-06   Arabis alpina [alpine rockcress]
ref|XP_007208450.1|  hypothetical protein PRUPE_ppa004250mg           55.8    4e-06   Prunus persica
ref|XP_002526697.1|  conserved hypothetical protein                   55.5    4e-06   
ref|XP_010038433.1|  PREDICTED: uncharacterized protein LOC104426933  55.5    5e-06   Eucalyptus grandis [rose gum]
ref|NP_195791.1|  methyltransferase                                   55.5    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264515.1|  PREDICTED: uncharacterized protein LOC104602499  55.5    5e-06   Nelumbo nucifera [Indian lotus]
emb|CDP19944.1|  unnamed protein product                              55.5    5e-06   Coffea canephora [robusta coffee]
emb|CDX80754.1|  BnaC03g00080D                                        55.1    5e-06   
ref|XP_004156629.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.1    5e-06   
ref|XP_004137689.1|  PREDICTED: uncharacterized protein LOC101205174  55.1    6e-06   Cucumis sativus [cucumbers]
ref|XP_004148602.1|  PREDICTED: uncharacterized protein LOC101209474  55.1    6e-06   Cucumis sativus [cucumbers]
ref|XP_007208593.1|  hypothetical protein PRUPE_ppa022624mg           55.1    6e-06   Prunus persica
ref|XP_002870902.1|  hypothetical protein ARALYDRAFT_486898           55.1    6e-06   
ref|XP_011080707.1|  PREDICTED: uncharacterized protein LOC105163...  55.1    7e-06   Sesamum indicum [beniseed]
ref|XP_009125399.1|  PREDICTED: uncharacterized protein LOC103850409  55.1    7e-06   Brassica rapa
ref|XP_006658171.1|  PREDICTED: uncharacterized protein LOC102700724  54.7    7e-06   Oryza brachyantha
ref|XP_008464242.1|  PREDICTED: uncharacterized protein LOC103502172  55.1    7e-06   Cucumis melo [Oriental melon]
emb|CDY11183.1|  BnaA03g00190D                                        54.7    7e-06   Brassica napus [oilseed rape]
ref|XP_004492512.1|  PREDICTED: uncharacterized protein LOC101509260  54.7    8e-06   Cicer arietinum [garbanzo]
ref|XP_009781173.1|  PREDICTED: uncharacterized protein LOC104230131  54.7    8e-06   Nicotiana sylvestris
ref|XP_009342226.1|  PREDICTED: uncharacterized protein LOC103934219  54.7    9e-06   
gb|KDP22815.1|  hypothetical protein JCGZ_00402                       54.7    9e-06   Jatropha curcas
ref|XP_008370209.1|  PREDICTED: uncharacterized protein LOC103433716  54.7    9e-06   
gb|EEC82462.1|  hypothetical protein OsI_26902                        54.3    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_004172269.1|  PREDICTED: uncharacterized LOC101209474          54.3    1e-05   
ref|NP_001060302.1|  Os07g0620600                                     54.3    1e-05   
gb|EYU45992.1|  hypothetical protein MIMGU_mgv1a025887mg              54.3    1e-05   Erythranthe guttata [common monkey flower]
ref|NP_001175347.1|  Os07g0692401                                     54.3    1e-05   
dbj|BAC75560.1|  hypothetical protein                                 54.3    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130631.1|  PREDICTED: uncharacterized protein LOC103855402  54.3    1e-05   Brassica rapa
gb|EPS62213.1|  hypothetical protein M569_12578                       54.3    1e-05   Genlisea aurea
ref|XP_001771643.1|  predicted protein                                53.9    1e-05   
ref|XP_009373100.1|  PREDICTED: uncharacterized protein LOC103962151  54.3    1e-05   Pyrus x bretschneideri [bai li]
tpg|DAA41831.1|  TPA: hypothetical protein ZEAMMB73_867074            54.3    1e-05   
ref|XP_011015027.1|  PREDICTED: uncharacterized protein LOC105118715  53.9    1e-05   Populus euphratica
ref|XP_007026550.1|  Methyltransferases                               53.9    2e-05   
ref|XP_009412633.1|  PREDICTED: uncharacterized protein LOC103994078  53.5    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008442352.1|  PREDICTED: uncharacterized protein LOC103486248  53.5    2e-05   Cucumis melo [Oriental melon]
gb|AFW71483.1|  hypothetical protein ZEAMMB73_430632                  53.5    2e-05   
ref|XP_008647032.1|  PREDICTED: uncharacterized protein LOC103628641  53.5    2e-05   
emb|CDP19032.1|  unnamed protein product                              53.5    2e-05   Coffea canephora [robusta coffee]
ref|XP_007017010.1|  Methyltransferase                                53.5    2e-05   
ref|NP_001143103.1|  hypothetical protein precursor                   53.1    2e-05   Zea mays [maize]
ref|XP_008244798.1|  PREDICTED: uncharacterized protein LOC103342911  53.1    2e-05   
ref|XP_009774872.1|  PREDICTED: uncharacterized protein LOC104224855  53.1    2e-05   Nicotiana sylvestris
ref|XP_004987042.1|  PREDICTED: uncharacterized protein LOC101779612  53.1    3e-05   Setaria italica
ref|XP_011019055.1|  PREDICTED: uncharacterized protein LOC105121895  53.1    3e-05   Populus euphratica
emb|CDY04832.1|  BnaAnng00140D                                        53.1    3e-05   
ref|XP_009606484.1|  PREDICTED: uncharacterized protein LOC104100...  52.8    4e-05   
gb|EMS66683.1|  hypothetical protein TRIUR3_26284                     51.6    4e-05   Triticum urartu
ref|XP_009615562.1|  PREDICTED: uncharacterized protein LOC104108275  52.4    5e-05   Nicotiana tomentosiformis
ref|XP_002461266.1|  hypothetical protein SORBIDRAFT_02g043860        52.4    5e-05   Sorghum bicolor [broomcorn]
ref|XP_008359661.1|  PREDICTED: uncharacterized protein LOC103423371  51.6    5e-05   
ref|XP_004302571.1|  PREDICTED: uncharacterized protein LOC101290967  52.4    5e-05   Fragaria vesca subsp. vesca
gb|EMT30745.1|  hypothetical protein F775_21759                       52.0    5e-05   
ref|XP_006828158.1|  hypothetical protein AMTR_s00023p00093390        52.0    6e-05   Amborella trichopoda
ref|XP_002465406.1|  hypothetical protein SORBIDRAFT_01g038110        52.0    6e-05   
ref|NP_001169287.1|  hypothetical protein                             52.0    6e-05   Zea mays [maize]
gb|KHN33252.1|  hypothetical protein glysoja_027939                   51.6    6e-05   Glycine soja [wild soybean]
ref|XP_004296044.1|  PREDICTED: uncharacterized protein LOC101312240  52.0    6e-05   Fragaria vesca subsp. vesca
ref|XP_003623416.1|  hypothetical protein MTR_7g070530                52.0    7e-05   Medicago truncatula
ref|XP_008369759.1|  PREDICTED: uncharacterized protein LOC103433285  52.0    7e-05   
ref|XP_008809973.1|  PREDICTED: uncharacterized protein LOC103721505  52.0    7e-05   
ref|XP_004958788.1|  PREDICTED: uncharacterized protein LOC101783448  52.0    7e-05   Setaria italica
ref|XP_010937964.1|  PREDICTED: uncharacterized protein LOC105057170  51.6    8e-05   Elaeis guineensis
ref|XP_003516409.1|  PREDICTED: uncharacterized protein LOC100811015  51.6    8e-05   
dbj|BAJ97336.1|  predicted protein                                    51.6    8e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010683597.1|  PREDICTED: uncharacterized protein LOC104898243  51.6    9e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007134628.1|  hypothetical protein PHAVU_010G062900g           51.6    9e-05   Phaseolus vulgaris [French bean]
gb|KHN02118.1|  hypothetical protein glysoja_028321                   48.1    9e-05   Glycine soja [wild soybean]
ref|XP_011048563.1|  PREDICTED: uncharacterized protein LOC105142571  51.6    9e-05   Populus euphratica
gb|KHN44850.1|  hypothetical protein glysoja_024421                   51.2    1e-04   Glycine soja [wild soybean]
ref|XP_010553127.1|  PREDICTED: uncharacterized protein LOC104823307  51.2    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_004506826.1|  PREDICTED: uncharacterized protein LOC101508795  51.2    1e-04   Cicer arietinum [garbanzo]
ref|XP_006381463.1|  hypothetical protein POPTR_0006s13070g           51.2    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008387644.1|  PREDICTED: uncharacterized protein LOC103450101  51.2    1e-04   
ref|XP_008366676.1|  PREDICTED: uncharacterized protein LOC103430317  51.2    1e-04   
ref|XP_009349043.1|  PREDICTED: uncharacterized protein LOC103940618  50.8    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_004246304.1|  PREDICTED: uncharacterized protein LOC101267731  50.8    2e-04   Solanum lycopersicum
ref|XP_010233621.1|  PREDICTED: uncharacterized protein LOC104583389  50.8    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_004500447.1|  PREDICTED: uncharacterized protein LOC101506752  50.8    2e-04   Cicer arietinum [garbanzo]
ref|XP_006360824.1|  PREDICTED: uncharacterized protein LOC102590367  50.8    2e-04   Solanum tuberosum [potatoes]
gb|KCW49402.1|  hypothetical protein EUGRSUZ_K02942                   50.8    2e-04   Eucalyptus grandis [rose gum]
ref|XP_007205122.1|  hypothetical protein PRUPE_ppa004877mg           50.4    2e-04   
ref|XP_006603554.1|  PREDICTED: uncharacterized protein LOC102670512  50.4    2e-04   
ref|XP_007140185.1|  hypothetical protein PHAVU_008G091100g           50.4    2e-04   Phaseolus vulgaris [French bean]
gb|KHN40685.1|  hypothetical protein glysoja_001183                   50.1    2e-04   Glycine soja [wild soybean]
ref|XP_010921054.1|  PREDICTED: uncharacterized protein LOC105044755  50.4    2e-04   Elaeis guineensis
gb|AGV54215.1|  hypothetical protein                                  50.1    3e-04   Phaseolus vulgaris [French bean]
ref|XP_003537325.1|  PREDICTED: uncharacterized protein LOC100788611  49.7    4e-04   Glycine max [soybeans]
gb|KHN22782.1|  hypothetical protein glysoja_026750                   49.3    4e-04   Glycine soja [wild soybean]
gb|KHN41361.1|  hypothetical protein glysoja_047806                   48.5    4e-04   Glycine soja [wild soybean]
ref|XP_009606489.1|  PREDICTED: uncharacterized protein LOC104100...  49.3    4e-04   
ref|XP_006376546.1|  hypothetical protein POPTR_0013s14950g           49.3    5e-04   
ref|XP_008804157.1|  PREDICTED: uncharacterized protein LOC103717510  49.3    5e-04   
ref|XP_004497494.1|  PREDICTED: uncharacterized protein LOC101500848  49.3    6e-04   Cicer arietinum [garbanzo]
ref|XP_010099438.1|  hypothetical protein L484_011136                 48.9    6e-04   Morus notabilis
gb|KEH28818.1|  methyltransferase domain protein                      48.9    6e-04   Medicago truncatula
gb|KHN19114.1|  hypothetical protein glysoja_036230                   46.6    8e-04   Glycine soja [wild soybean]
gb|KJB78695.1|  hypothetical protein B456_013G013000                  48.9    8e-04   Gossypium raimondii
gb|KHN29556.1|  hypothetical protein glysoja_005280                   48.5    8e-04   Glycine soja [wild soybean]
ref|XP_010686186.1|  PREDICTED: uncharacterized protein LOC104900468  48.5    8e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008243928.1|  PREDICTED: uncharacterized protein LOC103342124  48.5    9e-04   Prunus mume [ume]



>emb|CDO97395.1| unnamed protein product [Coffea canephora]
Length=405

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N+++  E          + G+S WL+N V+  D+VVMKAEA+VV+EM+ E+TICLVDELF
Sbjct  302  NLEITAEKLSSRSMVNPAAGISGWLKNNVRQEDFVVMKAEAQVVDEMMEEKTICLVDELF  361

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            LECK+ +++   G+EN+ +RAYWQCL L+G LR++GVAVHQWW+
Sbjct  362  LECKNHFQDDGVGDENESKRAYWQCLALYGSLRDQGVAVHQWWN  405



>ref|XP_009795485.1| PREDICTED: uncharacterized protein LOC104242165 [Nicotiana sylvestris]
Length=409

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N+DV+++DSEE   G   +G + WL   VK+ DYVVMKAEAEVVEEM++++TICLVDELF
Sbjct  302  NLDVEIQDSEEWGNGVPLLGAAEWLSKNVKEEDYVVMKAEAEVVEEMIKKKTICLVDELF  361

Query  346  LECKSQWeegeggeE---NQRQR-AYWQCLELHGRLREEGVAVHQWWS  215
            L C++Q E+ +  +    N  QR AYWQCL L+G+L +EGVAVHQWWS
Sbjct  362  LHCRNQLEDDDDDDYEEENGSQRKAYWQCLTLYGKLIDEGVAVHQWWS  409



>ref|XP_004230605.1| PREDICTED: uncharacterized protein LOC101261168 [Solanum lycopersicum]
Length=411

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N+DV++++SE++  G   VG + WL   VK+ DYVVMKAEAEVVEE+++++ ICLVDELF
Sbjct  303  NLDVEIQESEQSGDGVALVGTAEWLSKNVKEEDYVVMKAEAEVVEEIIKKKAICLVDELF  362

Query  346  LECKSQWeegeggeENQ-----RQRAYWQCLELHGRLREEGVAVHQWWS  215
            L C++Q EE    ++++     ++RAYWQCL L+G+L +EG+AVHQWWS
Sbjct  363  LHCRNQLEEVGNDDDDEEENGSQKRAYWQCLTLYGKLIDEGIAVHQWWS  411



>ref|XP_004136424.1| PREDICTED: uncharacterized protein LOC101205953 [Cucumis sativus]
 ref|XP_004160303.1| PREDICTED: uncharacterized protein LOC101230494 [Cucumis sativus]
 gb|KGN60254.1| hypothetical protein Csa_3G890100 [Cucumis sativus]
Length=311

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = -3

Query  517  VKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLEC  338
            V  +   E+ + E  VG+S+WL N VK  DYVVMKAEAE VE+M++ + + LVDELFLEC
Sbjct  212  VSTDQLAESSSKEPQVGISDWLSNNVKAEDYVVMKAEAEAVEDMMKSKVVRLVDELFLEC  271

Query  337  KSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            K Q   G       R RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  272  KPQKNGGRKVSGGGR-RAYWQCLALYGQLRDEGVAVHQWW  310



>ref|XP_002522625.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39712.1| conserved hypothetical protein [Ricinus communis]
Length=368

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 3/93 (3%)
 Frame = -3

Query  493  TKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeege  314
            +KT E SV +S+WL   VK+ ++VV+KAEAEVVEEM+R RT+ LVDELFLEC++QW+ GE
Sbjct  279  SKTAEASVNISDWLMKNVKEDEFVVLKAEAEVVEEMIRRRTVGLVDELFLECQNQWQNGE  338

Query  313  ggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            G   N+ +RAYW+CL L+GRLR++GVAVHQWW 
Sbjct  339  G---NKGKRAYWECLALYGRLRDKGVAVHQWWG  368



>ref|XP_008466168.1| PREDICTED: uncharacterized protein LOC103503664 [Cucumis melo]
Length=308

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = -3

Query  511  VEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKS  332
            V   + + + E  VG+S+WL N VK  DYVVMKAEAEVVE+M++ + + LVDELFLECK 
Sbjct  211  VSTDQASSSKEPQVGISDWLSNNVKAEDYVVMKAEAEVVEDMMKSKVVRLVDELFLECKP  270

Query  331  QWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            Q   G       R RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  271  QKNGGRKVSGGGR-RAYWQCLALYGQLRDEGVAVHQWW  307



>ref|XP_002283891.2| PREDICTED: uncharacterized protein LOC100247170 [Vitis vinifera]
 emb|CAN74009.1| hypothetical protein VITISV_003546 [Vitis vinifera]
Length=403

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 3/97 (3%)
 Frame = -3

Query  502  SEETKTGEES-VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQW  326
            +EE+K  EE+ +G+S WLR  VK+ +YVVMKAEAEVVEEMV+ + I LVDELFLECK Q 
Sbjct  309  TEESKGKEEAELGMSEWLRKNVKEEEYVVMKAEAEVVEEMVKSKAIGLVDELFLECKPQ-  367

Query  325  eegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
                  + N   RAYW+CL L+G+LR+EGVAVHQWWS
Sbjct  368  -SLNNRKSNTGGRAYWECLALYGQLRDEGVAVHQWWS  403



>gb|KHN08240.1| hypothetical protein glysoja_017718 [Glycine soja]
Length=144

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -3

Query  502  SEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWe  323
            +EE  TG+E + +S+W+R  VK+ +YVVMKAEAEVV+EM++   I LVDELFLECK    
Sbjct  50   TEEWSTGKEQIEMSDWVRKNVKEEEYVVMKAEAEVVKEMMKSSAIGLVDELFLECKPN-R  108

Query  322  egeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
                   N  +RAYW+CL L+G+LR++GVAVHQWW 
Sbjct  109  GSRISGINSNRRAYWECLALYGKLRDKGVAVHQWWG  144



>ref|XP_004501628.1| PREDICTED: uncharacterized protein LOC101506643 [Cicer arietinum]
Length=413

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 6/99 (6%)
 Frame = -3

Query  514  KVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECK  335
            K+E   E  +G E+ G+S+WL   VKD +YVVMKAEAEVVEEM+R  +I LVDELFLECK
Sbjct  320  KIETVMEESSGREN-GISDWLNKNVKDEEYVVMKAEAEVVEEMMRSNSIGLVDELFLECK  378

Query  334  SQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
             + +       N+ +RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  379  PRGQME-----NKNRRAYWECLALYGKLRDEGVAVHQWW  412



>gb|KHN25062.1| hypothetical protein glysoja_046599 [Glycine soja]
Length=137

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 73/104 (70%), Gaps = 4/104 (4%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N D ++   E    G   + +S+WLRN V++ +YVVMK+E EVVEEM+R + I LVDELF
Sbjct  38   NKDFEMYKIETVAEGGPQIEMSDWLRNNVREEEYVVMKSETEVVEEMMRSKAIMLVDELF  97

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            LECK Q    +G  + +  RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  98   LECKPQ----QGNRKRKNGRAYWECLALYGKLRDEGVAVHQWWG  137



>ref|XP_011088137.1| PREDICTED: uncharacterized protein LOC105169445 [Sesamum indicum]
Length=409

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGE-ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDEL  350
            N++V++  +  +K  E +   +SNW+   V+  DYVVMKAEAE+VEEM++++T+CLVDEL
Sbjct  306  NMEVEINKNGLSKRVESQETAVSNWITKKVRHEDYVVMKAEAEMVEEMLKDKTLCLVDEL  365

Query  349  FLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            FLECK+QW++      N  +RAYWQCL L+G++R+EG+AVHQWW
Sbjct  366  FLECKNQWQQDGEEG-NGGKRAYWQCLTLYGKVRDEGIAVHQWW  408



>ref|XP_003522750.2| PREDICTED: uncharacterized protein LOC100789170 [Glycine max]
Length=262

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  502  SEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWe  323
            +EE  TG+E + +S+W+R  VK+ +YVVMKAEAEVVEEM++  +I LVDELFLECK    
Sbjct  168  TEEWSTGKEQIEMSDWVRKNVKEEEYVVMKAEAEVVEEMMKSSSIGLVDELFLECKPN-R  226

Query  322  egeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                   N  +RAYW+CL L+G+LR++GVAVHQWW
Sbjct  227  GSRSSGINSNRRAYWECLALYGKLRDKGVAVHQWW  261



>ref|XP_003527872.2| PREDICTED: uncharacterized protein LOC100793605 [Glycine max]
Length=210

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = -3

Query  487  TGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegegg  308
             G+E + +S+W+R  VK+ +YVVMKAEAEVVEEM++ ++I LVDELFLECK +       
Sbjct  122  PGKEQIEMSDWVRKNVKEEEYVVMKAEAEVVEEMMKSKSIGLVDELFLECKPK--RENRS  179

Query  307  eENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
              N  +RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  180  SGNSSRRAYWECLALYGKLRDEGVAVHQWWG  210



>gb|KHN26129.1| hypothetical protein glysoja_019453 [Glycine soja]
Length=137

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 4/104 (4%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N D ++   E    G   + +S+WLR  V++ +YVVMK+EAEVVEEM+R + I LVDELF
Sbjct  38   NKDFEIYKIETVAEGGPQIEMSDWLRKNVREEEYVVMKSEAEVVEEMMRSKAIMLVDELF  97

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            LECK Q    +G  + + +RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  98   LECKPQ----QGNVKKKNRRAYWECLALYGKLRDEGVAVHQWWG  137



>ref|XP_003544241.1| PREDICTED: uncharacterized protein LOC100781768 [Glycine max]
Length=230

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 4/103 (4%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N D ++   E    G   + +S+WLRN V++ +YVVMK+E EVVEEM+R + I LVDELF
Sbjct  131  NKDFEMYKIETVAEGGPQIEMSDWLRNNVREEEYVVMKSETEVVEEMMRSKAIMLVDELF  190

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            LECK Q    +G  + +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  191  LECKPQ----QGNRKRKNGRAYWECLALYGKLRDEGVAVHQWW  229



>ref|XP_003518255.1| PREDICTED: uncharacterized protein LOC100814797 [Glycine max]
Length=230

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 4/104 (4%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N D ++   E    G   + +S+WLR  V++ +YVVMK+EAEVVEEM+R + I LVDELF
Sbjct  131  NKDFEIYKIETVAEGGPQIEMSDWLRKNVREEEYVVMKSEAEVVEEMMRSKAIMLVDELF  190

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            LECK Q    +G  + + +RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  191  LECKPQ----QGNVKKKNRRAYWECLALYGKLRDEGVAVHQWWG  230



>ref|XP_008219312.1| PREDICTED: uncharacterized protein LOC103319539 [Prunus mume]
Length=334

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 10/109 (9%)
 Frame = -3

Query  514  KVEDSEETKTGEESV--GLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  +G+E V  G+S WL+  VK+ +YVVMKAEAEVVEEM+  + I LVDELFLE
Sbjct  225  KIETVTEESSGKEVVQTGMSEWLKKNVKEEEYVVMKAEAEVVEEMMNTKVIKLVDELFLE  284

Query  340  CKSQWeegeggeEN--------QRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK Q + G+ G+ N        + +RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  285  CKPQGQNGKKGDNNSNTNTNYVRSRRAYWQCLALYGQLRDEGVAVHQWW  333



>gb|EYU39115.1| hypothetical protein MIMGU_mgv1a027069mg [Erythranthe guttata]
Length=404

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -3

Query  496  ETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeeg  317
            E     +  G+SNW+R  V   DYVVMKAEA++VEEM++E+T+CLVDELFLECK+QW++ 
Sbjct  312  EASGAHKETGVSNWMRGKVGREDYVVMKAEAQLVEEMLKEKTLCLVDELFLECKNQWQDD  371

Query  316  eggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            E   +  + RAY QCL L+G++R+EG+AVHQWW
Sbjct  372  EDQSDGSK-RAYCQCLALYGKVRDEGIAVHQWW  403



>ref|XP_002273743.3| PREDICTED: uncharacterized protein LOC100249012 [Vitis vinifera]
Length=428

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 4/86 (5%)
 Frame = -3

Query  475  SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQ  296
            +VG+S WL   VK+ +YVVMKAEAEVVEEM++ RT+CLVDELFL C  Q        EN 
Sbjct  346  NVGISGWLMENVKEEEYVVMKAEAEVVEEMIKGRTVCLVDELFLGCNHQ----RQKGENN  401

Query  295  RQRAYWQCLELHGRLREEGVAVHQWW  218
            +QRAYW+CL L+GRLR+EGVAVHQWW
Sbjct  402  KQRAYWECLALYGRLRDEGVAVHQWW  427



>ref|XP_008347812.1| PREDICTED: uncharacterized protein LOC103410942 [Malus domestica]
Length=412

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = -3

Query  514  KVEDSEETKTGEESV--GLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  +G+E V  G+S WL   VKD +YVVMKAEAEVVEEMV+ + I LVDELFLE
Sbjct  313  KIETVTEDSSGKEVVQTGISEWLNKNVKDEEYVVMKAEAEVVEEMVKSKAIHLVDELFLE  372

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK Q    +     + +RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  373  CKHQGHNQKINV--RSRRAYWQCLALYGQLRDEGVAVHQWW  411



>gb|KJB59886.1| hypothetical protein B456_009G279400 [Gossypium raimondii]
Length=397

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 3/85 (4%)
 Frame = -3

Query  472  VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQR  293
             G+SNWLR  VK+ +YVVMKAEAEVVE+MV+ + I LVDELFLECK +     GG +N  
Sbjct  315  TGMSNWLRKNVKETEYVVMKAEAEVVEDMVKTKAIRLVDELFLECKPR---KHGGRKNMS  371

Query  292  QRAYWQCLELHGRLREEGVAVHQWW  218
            +RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  372  RRAYWECLALYGKLRDEGVAVHQWW  396



>ref|XP_003602935.1| hypothetical protein MTR_3g100550 [Medicago truncatula]
 gb|AES73186.1| peptide upstream ORF protein [Medicago truncatula]
Length=419

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 5/104 (5%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEES--VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDEL  350
            I+ +V   EE+   E S  +G+S+WL   VK+ +YVVMKAEAEVVEEM+R   I LVDEL
Sbjct  318  IETRVMTEEESSRKEASSKIGMSDWLNKNVKEEEYVVMKAEAEVVEEMMRSNNIGLVDEL  377

Query  349  FLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            FLECK +        EN+ +RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  378  FLECKPR---HGFKIENKNRRAYWECLALYGKLRDEGVAVHQWW  418



>ref|XP_010030014.1| PREDICTED: uncharacterized protein LOC104419886 [Eucalyptus grandis]
 gb|KCW56953.1| hypothetical protein EUGRSUZ_I02628 [Eucalyptus grandis]
Length=405

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = -3

Query  487  TGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegegg  308
            +G     +S+WL   V++ +YVVMKA+AEV EEM+R+RTI LVDE+FLEC SQW   +  
Sbjct  318  SGGAPADVSDWLTQNVREEEYVVMKADAEVAEEMMRKRTIHLVDEMFLECSSQWGYRKT-  376

Query  307  eENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
              N+ +RAYW+CL L+GRLR+EGVAVHQWW+
Sbjct  377  --NKSRRAYWECLALYGRLRDEGVAVHQWWA  405



>ref|XP_007226906.1| hypothetical protein PRUPE_ppa016217mg [Prunus persica]
 gb|EMJ28105.1| hypothetical protein PRUPE_ppa016217mg [Prunus persica]
Length=416

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 10/109 (9%)
 Frame = -3

Query  514  KVEDSEETKTGEESV--GLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  +G+E V  G+S WL+  VK+ +YVVMKAEAEVVEEM+  + I LVDELFLE
Sbjct  307  KIETVTEESSGKEVVQTGMSEWLKKNVKEEEYVVMKAEAEVVEEMMNTKAIKLVDELFLE  366

Query  340  CKSQWeegeggeEN--------QRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK Q + G  G+ N        + +RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  367  CKPQGQNGNKGDNNSNSKTNYVRSRRAYWQCLALYGQLRDEGVAVHQWW  415



>ref|XP_008352712.1| PREDICTED: uncharacterized protein LOC103416231 [Malus domestica]
Length=412

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -3

Query  514  KVEDSEETKTGEESV--GLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  +G+E V  G+S WL   VK+ +YVVMKAEAEVVE+MV+ + I LVDELFLE
Sbjct  313  KIETVTEESSGKEVVQTGMSEWLNKNVKEEEYVVMKAEAEVVEDMVKSKAIHLVDELFLE  372

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK Q   G+     + +RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  373  CKPQGHNGKINV--RSRRAYWQCLALYGQLRDEGVAVHQWW  411



>ref|XP_009374286.1| PREDICTED: uncharacterized protein LOC103963226 [Pyrus x bretschneideri]
Length=412

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -3

Query  514  KVEDSEETKTGEESV--GLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  +G+E V  G+S WL   VK+ +YVVMKAEAEVVE+MV+ + I LVDELFLE
Sbjct  313  KIETVTEESSGKEVVQTGMSEWLNKNVKEEEYVVMKAEAEVVEDMVKSKAIHLVDELFLE  372

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK Q   G+     + +RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  373  CKPQGHNGKINI--RSRRAYWQCLALYGQLRDEGVAVHQWW  411



>ref|XP_009342577.1| PREDICTED: uncharacterized protein LOC103934551 [Pyrus x bretschneideri]
Length=412

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -3

Query  514  KVEDSEETKTGEESV--GLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  +G+E V  G+S WL   VK+ +YVVMKAEAEVVE+MV+ + I LVDELFLE
Sbjct  313  KIETVTEESSGKEVVQTGMSEWLNKNVKEEEYVVMKAEAEVVEDMVKSKAIHLVDELFLE  372

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK Q   G+     + +RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  373  CKPQGHNGKINI--RSRRAYWQCLALYGQLRDEGVAVHQWW  411



>ref|XP_009375494.1| PREDICTED: uncharacterized protein LOC103964299 [Pyrus x bretschneideri]
 ref|XP_009375495.1| PREDICTED: uncharacterized protein LOC103964300 [Pyrus x bretschneideri]
Length=412

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -3

Query  514  KVEDSEETKTGEESV--GLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  +G+E V  G+S WL   VK+ +YVVMKAEAEVV+EMV+ + I LVDELFLE
Sbjct  313  KIETVTEESSGKELVQTGMSEWLNKNVKEEEYVVMKAEAEVVDEMVKSKAIHLVDELFLE  372

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK Q   G+     + +RAYWQCL L+G+LR+EGVAVHQWW
Sbjct  373  CKPQGHNGKINV--RSRRAYWQCLALYGQLRDEGVAVHQWW  411



>ref|XP_010064231.1| PREDICTED: uncharacterized protein LOC104451216 [Eucalyptus grandis]
Length=426

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = -3

Query  499  EETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWee  320
            E T      VG+ +WL+  VK+ +YVVMKAEAEVVEEMV+ + I LVDELFLECK +   
Sbjct  334  EATAAVAAQVGMPDWLKKNVKEEEYVVMKAEAEVVEEMVKSKAIGLVDELFLECKPKGGV  393

Query  319  geggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                  ++ +RAYW+CL L+GRLR+EGVAVHQWW
Sbjct  394  TRMS--DRSRRAYWECLALYGRLRDEGVAVHQWW  425



>ref|XP_009595944.1| PREDICTED: uncharacterized protein LOC104092128 [Nicotiana tomentosiformis]
Length=527

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N+DV+++DSEE+  G   +G + WL   VK+ DYVVMKAEAEVVEEM++++TICLVDELF
Sbjct  301  NLDVEIQDSEESGNGAPLLGAAEWLSKNVKEEDYVVMKAEAEVVEEMIKKKTICLVDELF  360

Query  346  LECKSQW--eegeggeENQRQRAYWQCLELHGRLREEGVA  233
            L C++Q   ++    E   ++RAYWQCL L+G+L +EGVA
Sbjct  361  LHCRNQLEDDDDFEEENGSQRRAYWQCLTLYGKLIDEGVA  400



>ref|XP_010939748.1| PREDICTED: uncharacterized protein LOC105058495 [Elaeis guineensis]
Length=406

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = -3

Query  499  EETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWee  320
            E    G+E+VG+S WL   VK+ +YVVMKAEAEVVEEMV  RTI LVDELFLEC++QW+ 
Sbjct  317  EAVGRGKEAVGISEWLARNVKEEEYVVMKAEAEVVEEMVNGRTIGLVDELFLECQNQWQN  376

Query  319  geggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            G      + +R YW+CL L+GRL +EGVAVHQWW
Sbjct  377  G-----KRSRRTYWECLALYGRLWDEGVAVHQWW  405



>ref|XP_010273765.1| PREDICTED: uncharacterized protein LOC104609205 [Nelumbo nucifera]
Length=418

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFL  344
            I+    D   T T    + +S+WLR  VK+ +YVVMKAEAEVVEE+V+ + +CLVDELFL
Sbjct  319  IETVATDELSTDTAVPQLEMSDWLRKNVKEEEYVVMKAEAEVVEELVKNKAMCLVDELFL  378

Query  343  ECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            ECK +   G GG +N+ +R YW+CL L+G+LR+EGVAVHQWW
Sbjct  379  ECKHR---GLGGRKNKSKRVYWECLALYGKLRDEGVAVHQWW  417



>ref|XP_007018202.1| Uncharacterized protein TCM_034490 [Theobroma cacao]
 gb|EOY15427.1| Uncharacterized protein TCM_034490 [Theobroma cacao]
Length=454

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = -3

Query  472  VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQR  293
            +G+S+WLR  VK  ++VVMKAEAEVVE+MV+ ++I LVDELFLECK Q ++G     N  
Sbjct  372  IGMSDWLRKNVKGEEFVVMKAEAEVVEDMVKSKSIRLVDELFLECKPQGDDGRK---NMS  428

Query  292  QRAYWQCLELHGRLREEGVAVHQWW  218
            +RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  429  KRAYWECLALYGKLRDEGVAVHQWW  453



>ref|XP_007141255.1| hypothetical protein PHAVU_008G180600g [Phaseolus vulgaris]
 gb|ESW13249.1| hypothetical protein PHAVU_008G180600g [Phaseolus vulgaris]
Length=225

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N + ++   E    G     +S+WLR  VKD +YVVMKAEAE VEEM+R + I LVDELF
Sbjct  126  NKNFEMYKLETVAEGGPQTEMSDWLRKNVKDEEYVVMKAEAEEVEEMMRSKAIRLVDELF  185

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            LECK Q    +G  + + +RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  186  LECKPQ----QGNVKRKSRRAYWECLALYGKLRDEGVAVHQWWG  225



>ref|XP_010099469.1| hypothetical protein L484_011169 [Morus notabilis]
 gb|EXB78544.1| hypothetical protein L484_011169 [Morus notabilis]
Length=496

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQR  287
            +S+WL   V++ DYVV+KAEA+ VEEM+ +RTI LVDELF+EC +QW E     +N+ +R
Sbjct  413  ISDWLTKNVREEDYVVIKAEADAVEEMINKRTIHLVDELFMECNNQWWEVGKNSKNESKR  472

Query  286  AYWQCLELHGRLREEGVAVHQWW  218
            AYW+CL L+GR+++EGVAVHQWW
Sbjct  473  AYWECLALYGRVKDEGVAVHQWW  495



>ref|XP_008223356.1| PREDICTED: uncharacterized protein LOC103323165 [Prunus mume]
Length=408

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N++V+ E++  T        +S+WL+  V++ DYVVMKAEAE+V EM++++TICLVDELF
Sbjct  306  NLEVEPEEASSTAVAPPRNDVSDWLKKNVREEDYVVMKAEAEMVVEMIKKKTICLVDELF  365

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            LEC + W +  G     + RAYW+C+ L+GR+R+ GVAVHQW+
Sbjct  366  LECNNGWWQKNGKTYGSK-RAYWECIALYGRVRDLGVAVHQWF  407



>ref|XP_007137646.1| hypothetical protein PHAVU_009G143900g [Phaseolus vulgaris]
 gb|ESW09640.1| hypothetical protein PHAVU_009G143900g [Phaseolus vulgaris]
Length=261

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -3

Query  472  VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQR  293
            +G+S+WLR  VK+ +YVVMKA AEVVE+M++  +I LVDELFLECK        G  N  
Sbjct  178  IGISDWLRKNVKEEEYVVMKANAEVVEDMMKSNSIGLVDELFLECKCNLGRSRRG--NNS  235

Query  292  QRAYWQCLELHGRLREEGVAVHQWWS  215
             RAYW+CL L+G+LR+EGVAVHQWW+
Sbjct  236  GRAYWECLALYGQLRDEGVAVHQWWN  261



>ref|XP_009381478.1| PREDICTED: uncharacterized protein LOC103969619 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = -3

Query  517  VKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLEC  338
            +K++   E K    + G++ WL   +K+ +YVVMKAEAEVVEEMVRE    LVDELFLEC
Sbjct  334  IKLDVVGEVKYASVASGIAGWLSKNLKEEEYVVMKAEAEVVEEMVREGATGLVDELFLEC  393

Query  337  KSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            K+QW +        R+RAYW+CL L+G+LR+EG+AVHQWW 
Sbjct  394  KTQWHKQG----KGRRRAYWECLALYGKLRDEGIAVHQWWG  430



>gb|KDP41466.1| hypothetical protein JCGZ_15873 [Jatropha curcas]
Length=427

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 6/104 (6%)
 Frame = -3

Query  514  KVEDSEETKTGEE-----SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDEL  350
            K+E   E+  G+E      +G+S WLR  VK+ DYVVMKAEAEVVEEM++ + I LVDEL
Sbjct  324  KIETLPESWPGKELPQVEEIGMSGWLRKNVKEEDYVVMKAEAEVVEEMMKSKAIRLVDEL  383

Query  349  FLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            F+ECK +   G+G     R RAYW+CL L+GRLR+EG+ VHQWW
Sbjct  384  FMECKPRGHGGKGNNCGGR-RAYWECLALYGRLRDEGIGVHQWW  426



>gb|KDP26665.1| hypothetical protein JCGZ_17823 [Jatropha curcas]
Length=407

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = -3

Query  493  TKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeege  314
            +K     + +SNWL   VK+ ++VVMKAEAEVVEEM++ RTI LVDELFLEC++QWE   
Sbjct  321  SKMVSPGIDVSNWLMKNVKEDEFVVMKAEAEVVEEMMQRRTINLVDELFLECQNQWEG--  378

Query  313  ggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                 + +RAYW+CL L+GRLR++G+AVHQWW
Sbjct  379  ----KKSKRAYWECLALYGRLRDKGIAVHQWW  406



>gb|AFK37639.1| unknown [Medicago truncatula]
Length=389

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 7/103 (7%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N+ V  E+    +T      +S WL   VK  +Y VMKAEA+VVEEM+R++TICLVDELF
Sbjct  293  NLQVAPEEPNVPQTD-----VSAWLSKHVKADEYAVMKAEADVVEEMMRKKTICLVDELF  347

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            L+C +QW +       +  RAYWQCL+L+GRLR+EGVAVHQWW
Sbjct  348  LQCNNQWWQTGTR--KKSGRAYWQCLDLYGRLRDEGVAVHQWW  388



>ref|XP_008390578.1| PREDICTED: uncharacterized protein LOC103452820 [Malus domestica]
Length=404

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = -3

Query  520  DVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            +++VE  E + T E  V  S+WL++ V++ DYVVMKAEAEVV +MVR+RTICLVDELFLE
Sbjct  306  NLEVEPEEASSTPENDV--SDWLKDNVREEDYVVMKAEAEVVVDMVRKRTICLVDELFLE  363

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            C + W +        + RAYW+C+ L+GRLR+ GVAVHQW+
Sbjct  364  CSNGWWQXGRRNGGSK-RAYWECIALYGRLRDLGVAVHQWF  403



>ref|XP_002514025.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48608.1| conserved hypothetical protein [Ricinus communis]
Length=422

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 8/104 (8%)
 Frame = -3

Query  514  KVEDSEETKTGEE-----SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDEL  350
            K+E   E  +G+E      +G+S WL   VK+ +YVVMKAEAEVVEEM+  R+I LVDEL
Sbjct  321  KIETVTEVSSGKEVPQVEEIGMSGWLSKNVKEEEYVVMKAEAEVVEEMIESRSIRLVDEL  380

Query  349  FLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            F++CK +   G+G   N  +RAYW+CL L+GRLR+EG+AVHQWW
Sbjct  381  FMDCKPRGHGGKG---NGSRRAYWECLALYGRLRDEGIAVHQWW  421



>ref|XP_011092449.1| PREDICTED: uncharacterized protein LOC105172627 [Sesamum indicum]
Length=408

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQR  287
            + NWL   V+  DYVVMKAEA++VEEM++ + +CLVDELFLEC +QW++G+    N  +R
Sbjct  325  VPNWLMKKVRREDYVVMKAEAQLVEEMLKNKALCLVDELFLECDNQWQDGDEE--NGSKR  382

Query  286  AYWQCLELHGRLREEGVAVHQWWS  215
            AYWQCL L+G++R+EG+AVHQWW+
Sbjct  383  AYWQCLALYGKVRDEGIAVHQWWN  406



>gb|AES98227.2| transmembrane protein, putative [Medicago truncatula]
Length=419

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFL  344
            I+  VE S  T+     V +S+WL   VKD +YVVMKAEAEVVEEM+R ++I LVDELFL
Sbjct  324  IETVVEGSPTTQ-----VEMSDWLMKNVKDEEYVVMKAEAEVVEEMMRSKSIMLVDELFL  378

Query  343  ECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            ECK Q    + G   + +RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  379  ECKPQGLNLKRG--TRGRRAYWECLALYGKLRDEGVAVHQWW  418



>ref|XP_003608416.1| hypothetical protein MTR_4g093860 [Medicago truncatula]
 gb|AES90613.1| transmembrane protein, putative [Medicago truncatula]
Length=389

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 7/103 (7%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N+ V  E+    +T      +S WL   VK  +YVVMKAEA+VVEEM+R++TICLVDELF
Sbjct  293  NLQVAPEEPNVPQTD-----VSAWLSKHVKADEYVVMKAEADVVEEMMRKKTICLVDELF  347

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            L+C +QW +       +  RAYWQCL+L+GRLR+EGVAVHQWW
Sbjct  348  LQCNNQWWQTGTR--KKSGRAYWQCLDLYGRLRDEGVAVHQWW  388



>ref|XP_011462229.1| PREDICTED: uncharacterized protein LOC105350910 [Fragaria vesca 
subsp. vesca]
Length=403

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQR  287
            +S WL+  VK+ DYVVMKAEAEVV +M+++ TICLVDELFLEC ++W +      ++ +R
Sbjct  322  VSGWLKENVKEEDYVVMKAEAEVVVDMMQKSTICLVDELFLECNNEWWQNGNS--DKSKR  379

Query  286  AYWQCLELHGRLREEGVAVHQWW  218
            AYW+C+ LHGRLR+ GVAVHQW+
Sbjct  380  AYWECVALHGRLRDIGVAVHQWF  402



>gb|KDP27984.1| hypothetical protein JCGZ_19064 [Jatropha curcas]
Length=424

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 6/104 (6%)
 Frame = -3

Query  514  KVEDSEETKTGEE-----SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDEL  350
            K+E   E+ +G+E      +G+S WLR  VK+ +YVVMKAEAEVVEEM+  + I LVDEL
Sbjct  321  KIETFTESWSGKEVPQVVDIGISGWLRKNVKEEEYVVMKAEAEVVEEMMESKAIRLVDEL  380

Query  349  FLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            F+ECK +    +G   N  +RAYW+CL L+GRLR+EG+AVHQWW
Sbjct  381  FMECKLRGHGAKGNN-NAGRRAYWECLALYGRLRDEGIAVHQWW  423



>ref|XP_002301090.2| hypothetical protein POPTR_0002s10470g [Populus trichocarpa]
 gb|EEE80363.2| hypothetical protein POPTR_0002s10470g [Populus trichocarpa]
Length=384

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 11/105 (10%)
 Frame = -3

Query  514  KVEDSEETKTGEE-----SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDEL  350
            K+E   E  +G+E      VG+S+WL++ VK  +YVVMKAEAEVVEEMV+ + I LVDEL
Sbjct  286  KIETVTEQSSGKEVPQVEEVGMSDWLKHNVKGEEYVVMKAEAEVVEEMVKSKAIRLVDEL  345

Query  349  FLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            FLECK +         N  ++ YW+CL L+G+LR+EGVAVHQWW 
Sbjct  346  FLECKPR------RNGNGSKKTYWECLALYGKLRDEGVAVHQWWG  384



>ref|XP_009588038.1| PREDICTED: uncharacterized protein LOC104085654 [Nicotiana tomentosiformis]
Length=427

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 5/96 (5%)
 Frame = -3

Query  496  ETKTGEES---VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQW  326
            ET T E S   +G+S+WL+  VK+ +YVVMKAEAEVVEEMVR + I LVDELFLECK Q 
Sbjct  333  ETVTKESSAQLIGMSDWLKKNVKENEYVVMKAEAEVVEEMVRNKAIRLVDELFLECKHQG  392

Query  325  eegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
             +       + +RAYW+CL L+G LR+EGVAVHQWW
Sbjct  393  IKKGDK--KKSRRAYWECLSLYGMLRDEGVAVHQWW  426



>ref|XP_004252809.1| PREDICTED: uncharacterized protein LOC101251865 [Solanum lycopersicum]
Length=433

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (72%), Gaps = 7/103 (7%)
 Frame = -3

Query  514  KVEDSEETKTGEE----SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            K+E   E  +G+E    S+ +S+WL+  VK+ +YVVMKAEA+VVEEMV  R+I L+DELF
Sbjct  333  KIETMNEESSGKEIPLSSINMSDWLQKNVKENEYVVMKAEADVVEEMVNNRSIKLIDELF  392

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            LECK Q  +       + +RAYW+CL L+G LR+EG+AVHQWW
Sbjct  393  LECKHQGIKKSDK---KNRRAYWECLSLYGLLRDEGIAVHQWW  432



>emb|CDY39912.1| BnaA09g14940D [Brassica napus]
Length=419

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -3

Query  499  EETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWee  320
            +E     E++G++ WL+  VKD +YVVMKAEAEVVEEM+R ++I +VDELFLECK +   
Sbjct  323  DEMSIESENMGITEWLKENVKDEEYVVMKAEAEVVEEMMRNKSIKMVDELFLECKPKGLA  382

Query  319  geggeENQRQ--RAYWQCLELHGRLREEGVAVHQWW  218
              G  + Q +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  383  LRGRRKMQSKSGRAYWECLALYGKLRDEGVAVHQWW  418



>gb|AEM45875.1| hypothetical protein [Brassica rapa subsp. oleifera]
Length=419

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = -3

Query  502  SEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWe  323
            ++E     E++G++ WL+  VKD +YVVMKAEAEVVEEM+R ++I +VDELFLECK +  
Sbjct  322  NDEMSIESENMGITEWLKENVKDEEYVVMKAEAEVVEEMMRNKSIKMVDELFLECKPKGL  381

Query  322  egeggeENQRQ--RAYWQCLELHGRLREEGVAVHQWW  218
               G  + Q +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  382  ALRGRRKMQSKSGRAYWECLALYGKLRDEGVAVHQWW  418



>ref|XP_009113331.1| PREDICTED: uncharacterized protein LOC103838632 [Brassica rapa]
Length=418

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -3

Query  499  EETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWee  320
            +E     E++G++ WL+  VKD +YVVMKAEAEVVEEM+R ++I +VDELFLECK +   
Sbjct  322  DEMSIESENMGITEWLKENVKDEEYVVMKAEAEVVEEMMRNKSIKMVDELFLECKPKGLA  381

Query  319  geggeENQRQ--RAYWQCLELHGRLREEGVAVHQWW  218
              G  + Q +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  382  LRGRRKMQSKSGRAYWECLALYGKLRDEGVAVHQWW  417



>gb|KJB29354.1| hypothetical protein B456_005G0963001, partial [Gossypium raimondii]
Length=293

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = -3

Query  499  EETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWee  320
            E  +T  E+ G+S WLR  V++ +YVVMKAEAEVVE+MV+ + I LVDELFLECK +   
Sbjct  203  EVPQTAAET-GMSGWLRKNVQEEEYVVMKAEAEVVEDMVKSKAIRLVDELFLECKPKGLG  261

Query  319  geggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            G     N   RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  262  GRK---NMSGRAYWECLALYGKLRDEGVAVHQWW  292



>ref|XP_003615269.1| hypothetical protein MTR_5g065970 [Medicago truncatula]
Length=478

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 72/102 (71%), Gaps = 7/102 (7%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFL  344
            I+  VE S  T+     V +S+WL   VKD +YVVMKAEAEVVEEM+R ++I LVDELFL
Sbjct  354  IETVVEGSPTTQ-----VEMSDWLMKNVKDEEYVVMKAEAEVVEEMMRSKSIMLVDELFL  408

Query  343  ECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            ECK Q          + +RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  409  ECKPQ--GLNLKRGTRGRRAYWECLALYGKLRDEGVAVHQWW  448



>ref|XP_011016907.1| PREDICTED: uncharacterized protein LOC105120427 [Populus euphratica]
Length=420

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 73/104 (70%), Gaps = 11/104 (11%)
 Frame = -3

Query  514  KVEDSEETKTGEE-----SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDEL  350
            K+E   E  +G+E      VG+S+WL++ VK  +YVVMKAEAEVVEEMV+ + I LVDEL
Sbjct  322  KIETVTEQSSGKEVPQVEEVGMSDWLKHNVKGEEYVVMKAEAEVVEEMVKSKAIRLVDEL  381

Query  349  FLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            FLECK +         N  ++ YW+CL L+G+LR+EGVAVHQWW
Sbjct  382  FLECKPR------RNGNGSKKTYWECLALYGKLRDEGVAVHQWW  419



>emb|CDY29160.1| BnaC09g15570D [Brassica napus]
Length=422

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -3

Query  499  EETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWee  320
            +E     E++G++ WL+  VKD +YVVMKAEAEVVEEM+R ++I +VDELFLECK +   
Sbjct  326  DEMSIESENMGITEWLKENVKDEEYVVMKAEAEVVEEMMRNKSIKMVDELFLECKPKGLG  385

Query  319  geggeENQRQ--RAYWQCLELHGRLREEGVAVHQWW  218
              G    Q +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  386  LRGRRTMQSKSGRAYWECLALYGKLRDEGVAVHQWW  421



>ref|XP_009770120.1| PREDICTED: uncharacterized protein LOC104220858 [Nicotiana sylvestris]
Length=427

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 5/96 (5%)
 Frame = -3

Query  496  ETKTGEES---VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQW  326
            ET T E S   +G+S+WL+  VK  +YVVMKAEA VVEEMVR + I LVDELFLECK Q 
Sbjct  333  ETVTKESSAPLIGMSDWLKKNVKKNEYVVMKAEAGVVEEMVRNKAIRLVDELFLECKHQ-  391

Query  325  eegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
               + G++ + +RAYW+CL L+G LR+EGVAVHQWW
Sbjct  392  -GIKKGDKKKSRRAYWECLSLYGMLRDEGVAVHQWW  426



>ref|XP_009618057.1| PREDICTED: uncharacterized protein LOC104110298 [Nicotiana tomentosiformis]
Length=468

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 75/102 (74%), Gaps = 6/102 (6%)
 Frame = -3

Query  514  KVEDSEETKTGEES---VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFL  344
            K+E   +  +G+E    + +S+WL+N VK+++YVVMKAEA+VVEE+V+ + I L+DELFL
Sbjct  369  KIETVTKESSGKEIPMIISMSDWLKNNVKESEYVVMKAEADVVEELVKNKAIRLIDELFL  428

Query  343  ECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            ECK Q  +       + +RAYW+CL L+G LR+EG+AVHQWW
Sbjct  429  ECKHQGMKKGD---KKNRRAYWECLALYGLLRDEGIAVHQWW  467



>ref|XP_011023096.1| PREDICTED: uncharacterized protein LOC105124692 [Populus euphratica]
Length=406

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -3

Query  496  ETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeeg  317
            ++K       +SNWL   V++ ++VVMKAEAEV EEM++ +TI LVDELFLEC +QW+ G
Sbjct  316  DSKRVASPADVSNWLMKNVREDEFVVMKAEAEVAEEMMKRKTIGLVDELFLECNNQWKNG  375

Query  316  eggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            E     + +RAYW+C+ L+GRLR+EGVAVHQWW
Sbjct  376  ER---KKSKRAYWECVALYGRLRDEGVAVHQWW  405



>ref|XP_002323954.2| hypothetical protein POPTR_0017s07500g [Populus trichocarpa]
 gb|EEF04087.2| hypothetical protein POPTR_0017s07500g [Populus trichocarpa]
Length=406

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 68/83 (82%), Gaps = 3/83 (4%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQR  287
            +SNWL   V++ ++VVMKAEAEV EEM++ +TI LVDELFLEC +QW++G+     + +R
Sbjct  326  VSNWLMKNVREDEFVVMKAEAEVAEEMMKRKTIGLVDELFLECNNQWQKGQR---KKSRR  382

Query  286  AYWQCLELHGRLREEGVAVHQWW  218
            AYW+C+ L+GRLR+EGVAVHQWW
Sbjct  383  AYWECVALYGRLRDEGVAVHQWW  405



>ref|XP_010548868.1| PREDICTED: uncharacterized protein LOC104820197 [Tarenaya hassleriana]
Length=432

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = -3

Query  496  ETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeeg  317
            E  +  + +G+S W+R  VK+ +YVVMKAEAEVVEEMVR +TI +VDELFLECK +    
Sbjct  337  EIDSVPQRMGMSEWMRENVKEEEYVVMKAEAEVVEEMVRSKTIKMVDELFLECKPKGLGF  396

Query  316  --eggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                 + N   RAYW+CL L+G+LR+EG+AVHQWW
Sbjct  397  GGRKSQSNNGGRAYWECLALYGKLRDEGIAVHQWW  431



>ref|XP_002310494.2| hypothetical protein POPTR_0007s03500g [Populus trichocarpa]
 gb|EEE90944.2| hypothetical protein POPTR_0007s03500g [Populus trichocarpa]
Length=406

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = -3

Query  493  TKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeege  314
            +K       +SNWL   V++ ++VVMKAEAEV EEM++ +TI LVDELFLEC +QW+ GE
Sbjct  317  SKRVASPADVSNWLMKNVREDEFVVMKAEAEVAEEMMKRKTIGLVDELFLECNNQWKNGE  376

Query  313  ggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                 + +RAYW+C+ L+GRLR+EGVAVHQWW
Sbjct  377  R---KKSKRAYWECVALYGRLRDEGVAVHQWW  405



>ref|XP_004504833.1| PREDICTED: uncharacterized protein LOC101507733 [Cicer arietinum]
Length=388

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 7/103 (7%)
 Frame = -3

Query  526  NIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELF  347
            N+ V  E+S+  +T      +S WL   VK+ +YVVMKAEA+VVEEM+R++TICLVDELF
Sbjct  292  NLLVGPEESDVPRTD-----VSAWLSKHVKEDEYVVMKAEADVVEEMMRKKTICLVDELF  346

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            L+C ++W +       +  RAYW+CL L+GRLR+EGVAVHQWW
Sbjct  347  LQCDNEWWQTGKT--KKSGRAYWECLALYGRLRDEGVAVHQWW  387



>gb|KFK40909.1| hypothetical protein AALP_AA2G059000 [Arabis alpina]
Length=420

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E +G++ WLR  VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +     G +  
Sbjct  332  EQMGMTEWLRENVKEEEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQ  391

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  392  SKNGRAYWECLALYGKLRDEGVAVHQWW  419



>ref|XP_011043120.1| PREDICTED: uncharacterized protein LOC105138666 [Populus euphratica]
Length=406

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 68/83 (82%), Gaps = 3/83 (4%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQR  287
            +SNWL   V++ ++VVMKAEAEV EEM+R +TI LVDELFLEC +QW++G+     + +R
Sbjct  326  VSNWLMKNVREDEFVVMKAEAEVAEEMMRRKTIGLVDELFLECNNQWQKGQR---KKSRR  382

Query  286  AYWQCLELHGRLREEGVAVHQWW  218
            AYW+C+ L+GRLR+EGVAVHQWW
Sbjct  383  AYWECVALYGRLRDEGVAVHQWW  405



>emb|CDY23810.1| BnaA01g21610D [Brassica napus]
Length=274

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E++G++ WL+  VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +     G +  
Sbjct  186  ENMGMTEWLKENVKEEEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQ  245

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  +AYW+CL L+G+LR+EGVAVHQWW
Sbjct  246  SKSGKAYWECLALYGKLRDEGVAVHQWW  273



>emb|CDP11491.1| unnamed protein product [Coffea canephora]
Length=434

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 5/101 (5%)
 Frame = -3

Query  514  KVEDSEETKTGEE--SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            K+E   E  + EE   +G+S+WLR  +K  +YVVMKAEAEVVEE+VR + I LVDELFLE
Sbjct  336  KIETVNEGPSREEVAQIGMSDWLRKNLKGNEYVVMKAEAEVVEELVRSKAIKLVDELFLE  395

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK +  +       + +RAYW+CL L+G LR+EG+AVHQWW
Sbjct  396  CKHRGIKKSV---KRSRRAYWECLALYGSLRDEGIAVHQWW  433



>gb|AAG50763.1|AC079131_8 hypothetical protein [Arabidopsis thaliana]
Length=420

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E +G++ WL+  VK+ +YVVMKAEAE+VEEM+R ++I +VDELFLECK +     G +  
Sbjct  332  EKMGMTEWLKENVKEEEYVVMKAEAEMVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQ  391

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  392  SKSGRAYWECLALYGKLRDEGVAVHQWW  419



>ref|XP_006301429.1| hypothetical protein CARUB_v10021847mg [Capsella rubella]
 gb|EOA34327.1| hypothetical protein CARUB_v10021847mg [Capsella rubella]
Length=422

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -3

Query  502  SEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWe  323
            ++ET    E +G+  WL   VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +  
Sbjct  326  NDETSLESEKMGMPEWLNENVKEEEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGL  385

Query  322  egeggeENQRQ-RAYWQCLELHGRLREEGVAVHQWW  218
               G +   +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  386  GLRGRKMQSKSGRAYWECLALYGKLRDEGVAVHQWW  421



>ref|XP_010470285.1| PREDICTED: uncharacterized protein LOC104750217 isoform X1 [Camelina 
sativa]
Length=421

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E +G++ WL++ VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +     G    
Sbjct  333  EKMGMTEWLKDNVKEDEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRTMQ  392

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  393  SKNGRAYWECLALYGKLRDEGVAVHQWW  420



>ref|XP_002886704.1| hypothetical protein ARALYDRAFT_475423 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62963.1| hypothetical protein ARALYDRAFT_475423 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E +G++ WL+  VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +     G +  
Sbjct  332  EKMGMTEWLKENVKEEEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQ  391

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  392  SKSGRAYWECLALYGKLRDEGVAVHQWW  419



>ref|NP_176109.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50697.1|AC079604_4 hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43031.1| unknown protein [Arabidopsis thaliana]
 gb|ABE65720.1| unknown [Arabidopsis thaliana]
 gb|AEE33501.1| uncharacterized protein AT1G58120 [Arabidopsis thaliana]
Length=420

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E +G++ WL+  VK+ +YVVMKAEAE+VEEM+R ++I +VDELFLECK +     G +  
Sbjct  332  EKMGMTEWLKENVKEEEYVVMKAEAEMVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQ  391

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  392  SKSGRAYWECLALYGKLRDEGVAVHQWW  419



>ref|XP_006597360.1| PREDICTED: uncharacterized protein LOC102659744 [Glycine max]
 gb|KHN33553.1| hypothetical protein glysoja_005595 [Glycine soja]
Length=397

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -3

Query  520  DVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            + K E        E+   +S WL   VK+ +YVVMKAEA VVEEM++ RTI LVDELFLE
Sbjct  297  NTKFETHSVAVVPEDHFAVSAWLSKNVKEEEYVVMKAEAGVVEEMMKTRTIRLVDELFLE  356

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            CK++W +       + +R YW+CL L+GR+R+EGVAVHQWW
Sbjct  357  CKNEWWQRGKTM-KKNERTYWECLALYGRVRDEGVAVHQWW  396



>ref|XP_006392327.1| hypothetical protein EUTSA_v10023489mg [Eutrema salsugineum]
 gb|ESQ29613.1| hypothetical protein EUTSA_v10023489mg [Eutrema salsugineum]
Length=416

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E++G++ WL+  VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +       + +
Sbjct  330  ENMGMTEWLKENVKEEEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRKMQ-S  388

Query  298  QRQRAYWQCLELHGRLREEGVAVHQWW  218
            +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  389  KNGRAYWECLALYGKLRDEGVAVHQWW  415



>ref|XP_010511088.1| PREDICTED: uncharacterized protein LOC104787248 [Camelina sativa]
Length=421

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E +G++ WL++ VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK       G +  
Sbjct  333  EKMGMTEWLKDNVKEDEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPNALGLRGRKMQ  392

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  393  SKSGRAYWECLALYGKLRDEGVAVHQWW  420



>ref|XP_007223120.1| hypothetical protein PRUPE_ppa007125mg [Prunus persica]
 gb|EMJ24319.1| hypothetical protein PRUPE_ppa007125mg [Prunus persica]
Length=381

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 11/106 (10%)
 Frame = -3

Query  505  DSEETKTGEESVG----------LSNWLRNTVKDADYvvmkaeaevveemvreRTICLVD  356
            DS E  +G E             LS+WL+  V++ DYVVMKAEAE+V EM++++TICLVD
Sbjct  276  DSNEDNSGPEEASSTVVALPRNDLSDWLKENVREEDYVVMKAEAEMVVEMIKKKTICLVD  335

Query  355  ELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            ELFLEC + W +  G     + RAYW+C+ L+GR+R+ GVAVHQW+
Sbjct  336  ELFLECNNGWWQKNGKTYGSK-RAYWECIALYGRVRDLGVAVHQWF  380



>ref|XP_006338079.1| PREDICTED: uncharacterized protein LOC102584542 [Solanum tuberosum]
Length=402

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = -3

Query  472  VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQR  293
            +G+S+WL   VK+ +YVVMKAEAEVVEEMVR + I LVDELFLECK Q    + G++ + 
Sbjct  319  IGMSDWLEKNVKENEYVVMKAEAEVVEEMVRNKAIKLVDELFLECKHQ--GVKKGDKKKS  376

Query  292  QRAYWQCLELHGRLREEGVAVHQWW  218
            +RAYW+CL L+G LR+EGVAVHQWW
Sbjct  377  RRAYWECLSLYGMLRDEGVAVHQWW  401



>ref|XP_010414766.1| PREDICTED: uncharacterized protein LOC104700863 [Camelina sativa]
Length=408

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 12/95 (13%)
 Frame = -3

Query  502  SEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWe  323
            ++E     E +G++ WL++ VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK    
Sbjct  325  NDEMSLESEKMGMTEWLKDNVKEDEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKP---  381

Query  322  egeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                     + RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  382  ---------KGRAYWECLALYGKLRDEGVAVHQWW  407



>ref|XP_010470286.1| PREDICTED: uncharacterized protein LOC104750217 isoform X2 [Camelina 
sativa]
Length=408

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 12/87 (14%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E +G++ WL++ VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK            
Sbjct  333  EKMGMTEWLKDNVKEDEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKP-----------  381

Query  298  QRQRAYWQCLELHGRLREEGVAVHQWW  218
             + RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  382  -KGRAYWECLALYGKLRDEGVAVHQWW  407



>ref|XP_009774622.1| PREDICTED: uncharacterized protein LOC104224639 [Nicotiana sylvestris]
Length=463

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 66/85 (78%), Gaps = 3/85 (4%)
 Frame = -3

Query  472  VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQR  293
            + +S+WL+N VK+ +YVVMKAEA+VVEE+V+ + I LVDELFLECK Q  +       + 
Sbjct  381  ISMSDWLKNNVKENEYVVMKAEADVVEELVKNKAIKLVDELFLECKHQGIKKGD---KKN  437

Query  292  QRAYWQCLELHGRLREEGVAVHQWW  218
            +RAYW+CL L+G LR+EG+AVHQWW
Sbjct  438  RRAYWECLALYGLLRDEGIAVHQWW  462



>ref|XP_010272926.1| PREDICTED: uncharacterized protein LOC104608592 [Nelumbo nucifera]
Length=418

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFL  344
            ID+   D      G   + +S+WL   VK+ +YVVMKAEAEVVEEM++   I LVDELFL
Sbjct  319  IDMVTTDELSPDKGVPQMEMSDWLWKNVKEEEYVVMKAEAEVVEEMMKSNAISLVDELFL  378

Query  343  ECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            ECK Q   G     ++ +R YW+CL L+GRLR+EGVAVHQWW 
Sbjct  379  ECKHQGLCGRK---SKNRRPYWECLALYGRLRDEGVAVHQWWG  418



>ref|XP_004301360.1| PREDICTED: uncharacterized protein LOC101307700 [Fragaria vesca 
subsp. vesca]
Length=400

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFL  344
            I+  + D      G     +S WL   VK+ +YVVMKAEAEVVEEM++ + + LVDELFL
Sbjct  300  IETTLTDESAGSKGVLQTSMSGWLEKNVKEEEYVVMKAEAEVVEEMMQGKVMNLVDELFL  359

Query  343  ECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            ECK Q   G+G    +R  AYWQCL L+G+LR+EGVAVHQWW
Sbjct  360  ECKPQGHNGKGNVSTRR--AYWQCLALYGQLRDEGVAVHQWW  399



>ref|XP_009102651.1| PREDICTED: uncharacterized protein LOC103828765 [Brassica rapa]
Length=419

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E++G++ WL+  VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +     G +  
Sbjct  331  ENMGMTEWLKENVKEEEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQ  390

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  +AYW+CL L+G+LR+EGVAVHQWW
Sbjct  391  SKSGKAYWECLALYGKLRDEGVAVHQWW  418



>gb|EPS65863.1| hypothetical protein M569_08912, partial [Genlisea aurea]
Length=351

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 71/92 (77%), Gaps = 5/92 (5%)
 Frame = -3

Query  475  SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeg-----  311
            S G+S+WL   VK  DYVVMKAEAEVVEE++R++ + LVDELFLEC+++WE  +      
Sbjct  260  SGGVSSWLEKKVKTEDYVVMKAEAEVVEEVLRDQRMYLVDELFLECRNEWELEKKDNRLS  319

Query  310  geENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
               +  +RAYWQCLEL+G++R++G+AVHQWW+
Sbjct  320  NSSSSNKRAYWQCLELYGKVRDQGIAVHQWWN  351



>ref|XP_004490432.1| PREDICTED: uncharacterized protein LOC101499123 [Cicer arietinum]
Length=423

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = -3

Query  514  KVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECK  335
            K+E   E  T  + + +S+WL   VKD +YVVMKAEAEVVEEM+R + I LVDELFLECK
Sbjct  327  KIETVVEGSTTAQ-IEMSDWLTKNVKDEEYVVMKAEAEVVEEMMRSKAIMLVDELFLECK  385

Query  334  SQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                     +  + +RAYW+CL L+G+LR+EGVAVHQWW
Sbjct  386  PH--GLNLKQGTRGRRAYWECLALYGKLRDEGVAVHQWW  422



>emb|CDY46867.1| BnaC01g27710D [Brassica napus]
Length=449

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  299
            E++G++ WL+  VK+ +YVVMKAEAEVVEEM+R ++I +VDELFLECK +     G +  
Sbjct  361  ENMGMTEWLKENVKEEEYVVMKAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQ  420

Query  298  QRQ-RAYWQCLELHGRLREEGVAVHQWW  218
             +  +AYW+CL L+G+LR+EGVAVHQWW
Sbjct  421  SKTGKAYWECLALYGKLRDEGVAVHQWW  448



>gb|AFK34019.1| unknown [Lotus japonicus]
Length=257

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = -3

Query  520  DVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            D K E        E+   +S WL   VK+ +YVVMKAEAEVVEEM++ERTI LVDELFLE
Sbjct  157  DTKFEIHSLLFVPEDDNDVSAWLSKHVKEEEYVVMKAEAEVVEEMIKERTIYLVDELFLE  216

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            CK++W + +G    + +RAYW+CL L+GRLR+EGVAVHQWW 
Sbjct  217  CKNEWWQKKGKR-KKSRRAYWECLALYGRLRDEGVAVHQWWG  257



>ref|XP_010544075.1| PREDICTED: uncharacterized protein LOC104816801 [Tarenaya hassleriana]
Length=451

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = -3

Query  496  ETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeeg  317
            E  +  + +G+S W+R  VK+ +YVVMKAEAEVVEEMVR ++I +VDELFLECK +    
Sbjct  356  EIDSVPQRMGMSEWMRENVKEEEYVVMKAEAEVVEEMVRSKSIKVVDELFLECKPKGLGS  415

Query  316  --eggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                 + N   RAYW+CL L+G+LR++G+AVHQWW
Sbjct  416  GGRKSQSNNGGRAYWECLALYGKLRDQGIAVHQWW  450



>ref|XP_008340704.1| PREDICTED: uncharacterized protein LOC103403638 [Malus domestica]
Length=403

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 75/101 (74%), Gaps = 4/101 (4%)
 Frame = -3

Query  520  DVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLE  341
            +++VE  E T   +  V  S+WL++ V++ DYVVMKAEAEVV EM+R+RTI LVDELFLE
Sbjct  306  NLEVEPEEGTTAPKNDV--SDWLKDNVREEDYVVMKAEAEVVVEMMRKRTIRLVDELFLE  363

Query  340  CKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            C + W E      ++R  AYW+C+ L+GRLR++GVAVHQW+
Sbjct  364  CNNGWWESGRSGGSKR--AYWECIALYGRLRDQGVAVHQWF  402



>ref|XP_004237982.2| PREDICTED: uncharacterized protein LOC101250984 [Solanum lycopersicum]
Length=334

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 67/96 (70%), Gaps = 5/96 (5%)
 Frame = -3

Query  496  ETKTGEESVGL---SNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQW  326
            E  T E S  L   S+WL   VK+ +YVVMKAEAEVVEEMVR + I LVDELFLECK Q 
Sbjct  240  EAVTKESSAPLIEMSDWLEKNVKEDEYVVMKAEAEVVEEMVRNKAIKLVDELFLECKHQG  299

Query  325  eegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
             +       + +RAYW+CL L+G LR+EGVAVHQWW
Sbjct  300  VKKGDK--KKSRRAYWECLSLYGMLRDEGVAVHQWW  333



>ref|XP_009387165.1| PREDICTED: uncharacterized protein LOC103974130 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = -3

Query  508  EDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQ  329
            +D++E + G  S  L+ WL   VK+ +YVV+KAEA  VEE V E  I LVDELFLEC  Q
Sbjct  287  KDTDEAEKGA-SPSLAEWLERNVKEEEYVVVKAEASAVEEAVAEGAIGLVDELFLECDHQ  345

Query  328  -WeegeggeENQR--QRAYWQCLELHGRLREEGVAVHQWWS  215
             WE+ +  +   R  +RAYW+CL L+G+LR+ GVAVHQWWS
Sbjct  346  LWEDDDTKKGETRGGRRAYWECLALYGKLRDAGVAVHQWWS  386



>ref|XP_009413889.1| PREDICTED: uncharacterized protein LOC103995101 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 9/107 (8%)
 Frame = -3

Query  508  EDSEETKTGEE--SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECK  335
            +D +E    EE  +  L+ WL   VK+ +YVV+KAEA  VEE + E  I LVDELFLEC 
Sbjct  279  DDEDEAVKAEEGATASLAEWLERNVKEEEYVVVKAEATAVEEAMAEGAIGLVDELFLECD  338

Query  334  SQ-WeegeggeENQR------QRAYWQCLELHGRLREEGVAVHQWWS  215
             Q WE  E  E+ ++      QRAYWQCL L+G+LR+ GVAVHQWWS
Sbjct  339  HQSWEADEMREKVKKRATRGGQRAYWQCLALYGKLRDAGVAVHQWWS  385



>ref|XP_007042870.1| Nuclear transcription factor Y subunit C-4, putative [Theobroma 
cacao]
 gb|EOX98701.1| Nuclear transcription factor Y subunit C-4, putative [Theobroma 
cacao]
Length=407

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = -3

Query  496  ETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWe--  323
            E +     + +S+WL    ++ +YVVMKAEA+ VEEM+  R I LVDELFLEC +QW+  
Sbjct  312  EGRRVSPRIDVSDWLMKNAREEEYVVMKAEADAVEEMIARRAISLVDELFLECDNQWQDG  371

Query  322  egeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
              +  ++ + +RAYW+CL L+GRLR+EGVAVHQWW
Sbjct  372  GKKNKKKKKSKRAYWECLALYGRLRDEGVAVHQWW  406



>ref|XP_010675283.1| PREDICTED: uncharacterized protein LOC104891302 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = -3

Query  472  VGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQR  293
            +G+S+WL   VK  +YVVMKA+AEVVEEM++ + I LVDELFLECK        G+    
Sbjct  342  MGISDWLWRNVKAEEYVVMKADAEVVEEMLKSKAIALVDELFLECKP------FGKGGTS  395

Query  292  QRAYWQCLELHGRLREEGVAVHQWW  218
            +RAYW+CL L+GRLR+ GVAVHQWW
Sbjct  396  KRAYWECLALYGRLRDFGVAVHQWW  420



>gb|KJB32109.1| hypothetical protein B456_005G224700 [Gossypium raimondii]
Length=438

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 9/95 (9%)
 Frame = -3

Query  475  SVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWe---------  323
            S+ +S+WL   V++ DYVVMKAEAEVVE+M+  +TI LVDELF EC +QW+         
Sbjct  343  SIDVSDWLMMNVREEDYVVMKAEAEVVEKMIERKTIGLVDELFFECNNQWQDEVKKKKKR  402

Query  322  egeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            +    +  + +RAYW+C+ L+GRLR+EGVAVHQWW
Sbjct  403  KMGKKKRKKNKRAYWECVALYGRLRDEGVAVHQWW  437



>gb|KJB29352.1| hypothetical protein B456_005G0962001, partial [Gossypium raimondii]
Length=68

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 3/53 (6%)
 Frame = -3

Query  373  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
             I LVDELFLECK +   G GG +N  +RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  19   AIRLVDELFLECKPK---GLGGRKNMSRRAYWECLALYGKLRDEGVAVHQWWG  68



>ref|XP_010107693.1| hypothetical protein L484_007712 [Morus notabilis]
 gb|EXC16666.1| hypothetical protein L484_007712 [Morus notabilis]
Length=63

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -3

Query  373  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
             I LVDELFLECK             R+RAYW+CL L+GRLR+EGVAVHQWW 
Sbjct  16   AIRLVDELFLECKPD-----HKGGTVRRRAYWECLALYGRLRDEGVAVHQWWG  63



>gb|AFK46323.1| unknown [Lotus japonicus]
Length=67

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  373  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            TI LVDELFLECK++W + +G    + ++AYW+CL L+GRLR+EGVAVHQWW 
Sbjct  16   TIYLVDELFLECKNEWWQKKGKR-KKSRKAYWECLALYGRLRDEGVAVHQWWG  67



>gb|KDO43414.1| hypothetical protein CISIN_1g038765mg [Citrus sinensis]
Length=110

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  373  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQW  221
             +CLVDE+FLEC +QW++    + ++ QRAY +C+ L+ RL +EGV VHQW
Sbjct  60   AVCLVDEMFLECNNQWQDEGKKKNDKSQRAYLECMTLYERLGDEGVPVHQW  110



>ref|XP_009389561.1| PREDICTED: uncharacterized protein LOC103976099 [Musa acuminata 
subsp. malaccensis]
Length=383

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQW------eegegge  305
            L+ WL   V++ +YVV+KAEA  VEE V E  I LVDELFL+C  Q       ++ E   
Sbjct  293  LAEWLERNVREEEYVVVKAEAGAVEEAVAEGVIGLVDELFLQCDHQLWEEDERKKKEKET  352

Query  304  ENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
                +RAYW+CL L+G+LR+ GVAVHQWWS
Sbjct  353  TRSGRRAYWECLALYGKLRDAGVAVHQWWS  382



>ref|XP_009404440.1| PREDICTED: uncharacterized protein LOC103987768 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 8/110 (7%)
 Frame = -3

Query  523  IDVKVEDSE----ETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVD  356
            I V+VE+ +    E K G  S  L+ WL+  V++ +YVV+KAE   VEE++ E  I LVD
Sbjct  259  IRVEVEEGDDEVSEAKEGTSS-SLAEWLQRNVREEEYVVVKAEVGAVEEVMAEGAIGLVD  317

Query  355  ELFLECKSQW---eegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            ELFLEC  Q    +E E G    R+RAYW+CL L+G+LR+ GVAVHQWWS
Sbjct  318  ELFLECDHQLWDEDEKEKGARRGRRRAYWECLVLYGKLRDAGVAVHQWWS  367



>ref|XP_010916833.1| PREDICTED: uncharacterized protein LOC105041590 [Elaeis guineensis]
Length=421

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  457  WLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYW  278
            WL   V++ +YVVMKAEAEVVEE+V+ R I LVDELFLEC   WE+ +G +E + +RAY 
Sbjct  341  WLEENVREEEYVVMKAEAEVVEEVVKGRAIRLVDELFLECDHLWEKKKGRKEMRSRRAYR  400

Query  277  QCLELHGRLREEGVAVHQWW  218
            +CL L+G+LR++GVAVHQW+
Sbjct  401  ECLALYGKLRDQGVAVHQWF  420



>gb|KJB77076.1| hypothetical protein B456_012G119400 [Gossypium raimondii]
Length=553

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 59/94 (63%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  317
            + +  + WL+NTV ++D+VVMK + E  E      + +   ICL+DE+FLEC  ++W+  
Sbjct  460  QGIDFAEWLKNTVTESDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRC  519

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              G+ + + ++ Y QCL+L   LRE GV VHQWW
Sbjct  520  CPGQRSAKYEKTYGQCLQLFTSLRESGVLVHQWW  553



>ref|XP_006657971.1| PREDICTED: uncharacterized protein LOC102715955 [Oryza brachyantha]
Length=374

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -3

Query  469  GLSNWLRNTVKDADYvvmkaeaevve-emvreRTICLVDELFLECKSQWeegeggeENQR  293
            G++ WL   V++ DYVV+KA AE VE  + +   +  VDELFL+C +        E +  
Sbjct  287  GIAEWLEGNVREEDYVVVKAGAEAVEEILRKRAAVRRVDELFLDCDAA--SAGADESSSA  344

Query  292  QRAYWQCLELHGRLREEGVAVHQWW  218
            +R YW+CL L+GRLR+ GVAVHQWW
Sbjct  345  RRPYWECLALYGRLRDHGVAVHQWW  369



>ref|XP_006433845.1| hypothetical protein CICLE_v10003130mg [Citrus clementina]
 gb|ESR47085.1| hypothetical protein CICLE_v10003130mg [Citrus clementina]
Length=269

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 6/52 (12%)
 Frame = -3

Query  373  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            TI LVDEL LECK + +       N+  RAYW+CL L+ RLR+EGVA HQWW
Sbjct  223  TIRLVDELSLECKPRGKG------NRSIRAYWECLSLYRRLRDEGVAAHQWW  268



>gb|KDO81145.1| hypothetical protein CISIN_1g016299mg [Citrus sinensis]
Length=392

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 6/52 (12%)
 Frame = -3

Query  373  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            TI LVDEL LECK +      G+ N+  RAYW+CL L+ RLR+EGVA HQWW
Sbjct  346  TIRLVDELSLECKPR------GKGNRSIRAYWECLSLYRRLRDEGVAAHQWW  391



>ref|XP_006841211.1| hypothetical protein AMTR_s00135p00032540 [Amborella trichopoda]
 gb|ERN02886.1| hypothetical protein AMTR_s00135p00032540 [Amborella trichopoda]
Length=404

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (60%), Gaps = 6/52 (12%)
 Frame = -3

Query  373  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
             ICLVDELF +C           +    RAYW+C+ L+G LRE GVA HQWW
Sbjct  358  AICLVDELFFKCPHA------APQGAVGRAYWECISLYGLLRERGVAAHQWW  403



>ref|XP_008384718.1| PREDICTED: uncharacterized protein LOC103447298 [Malus domestica]
Length=491

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (63%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            E    + WL++ V + D+VV+K + E        +++    ICL+DE+FLEC  ++W++ 
Sbjct  398  EGFDFAEWLKSVVSERDFVVVKMDVEGAEFHLIPKLIESGAICLIDEIFLECHYNRWQKC  457

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              G+ + + ++ YWQCLEL  +LRE GV VHQWW
Sbjct  458  CPGQRSPKFKKTYWQCLELFTKLRESGVLVHQWW  491



>ref|XP_010423986.1| PREDICTED: uncharacterized protein LOC104709020 [Camelina sativa]
Length=515

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+N V+D D+VVMK + E         +++   ICL+DELFLEC  ++W+    G+
Sbjct  426  FADWLKNNVRDRDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  485

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  486  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  515



>ref|XP_010451944.1| PREDICTED: uncharacterized protein LOC104734132 [Camelina sativa]
Length=515

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+N V+D D+VVMK + E         +++   ICL+DELFLEC  ++W+    G+
Sbjct  426  FADWLKNNVRDRDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  485

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  486  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  515



>ref|XP_010093564.1| hypothetical protein L484_014002 [Morus notabilis]
 gb|EXB54271.1| hypothetical protein L484_014002 [Morus notabilis]
Length=258

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+NTV + D+VVMK + E         +     ICL+DE+FLEC   +W+    G+
Sbjct  169  FANWLKNTVLEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYKRWQRCCPGQ  228

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +++ ++ Y QCLEL   LR+ GV VHQWW
Sbjct  229  RSEKYEKTYGQCLELFTSLRQSGVLVHQWW  258



>ref|XP_006289569.1| hypothetical protein CARUB_v10003115mg [Capsella rubella]
 gb|EOA22467.1| hypothetical protein CARUB_v10003115mg [Capsella rubella]
Length=515

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 11/111 (10%)
 Frame = -3

Query  517  VKVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTIC  365
            VK   S +   GE    +    ++WL+N+V++ D+VVMK + E         +++   IC
Sbjct  405  VKRSTSSDDLAGEVNLIQGFDFADWLKNSVRERDFVVMKMDVEGTEFDLIPRLIKTGAIC  464

Query  364  LVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            L+DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  465  LIDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQRGVLVHQWW  515



>gb|KDO63279.1| hypothetical protein CISIN_1g010086mg [Citrus sinensis]
Length=518

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV D D+VVMK + E         +     ICL+DE+FLEC  ++W+    G+
Sbjct  429  FADWLKNTVTDKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGQ  488

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  489  RSPKYKKTYEQCLELFTSLRQNGVLVHQWW  518



>ref|XP_006481123.1| PREDICTED: uncharacterized protein LOC102608338 [Citrus sinensis]
Length=518

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV D D+VVMK + E         +     ICL+DE+FLEC  ++W+    G+
Sbjct  429  FADWLKNTVTDKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGQ  488

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  489  RSPKYEKTYEQCLELFTSLRQNGVLVHQWW  518



>gb|EEE67606.1| hypothetical protein OsJ_25158 [Oryza sativa Japonica Group]
Length=414

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevve-emvreRTICLVDELF  347
            + +   D+ E      + G++ WL   V++ DYVV+KA  E VE  + R   +  VDELF
Sbjct  276  VRLDAADATEPAASSSAAGIAEWLEGNVREEDYVVVKAGVEAVEEILRRRAAVRRVDELF  335

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            L+C ++         +  +  YW+CL L+GRLR+ GVAVHQWW
Sbjct  336  LDCDTR------ARAHAARSPYWECLALYGRLRDHGVAVHQWW  372



>ref|XP_002272461.1| PREDICTED: uncharacterized protein LOC100265673 [Vitis vinifera]
Length=503

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            + +  +NWL++TV + D+VVMK + E         ++    ICL+DE+FLEC  ++W+  
Sbjct  410  QGIDFANWLKSTVSERDFVVMKMDVEGTEFHLIPRLIETGAICLIDEIFLECHYNRWQRC  469

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              G+ + + Q+ Y QCL+L   LR+ GV VHQWW
Sbjct  470  CPGQRSSKFQKTYAQCLDLFSSLRKSGVLVHQWW  503



>ref|XP_006429503.1| hypothetical protein CICLE_v10011494mg [Citrus clementina]
 gb|ESR42743.1| hypothetical protein CICLE_v10011494mg [Citrus clementina]
Length=518

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV D D+VVMK + E         +     ICL+DE+FLEC  ++W+     +
Sbjct  429  FADWLKNTVTDKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPEQ  488

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  489  RSPKYEKTYEQCLELFTSLRQNGVLVHQWW  518



>gb|EYU41971.1| hypothetical protein MIMGU_mgv1a027046mg [Erythranthe guttata]
Length=521

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV + DYVVMK + E         +     ICL+DELFLEC  ++W++   GE
Sbjct  432  FADWLKNTVTERDYVVMKMDVEGTEFDLIPRLFETGAICLIDELFLECHYNRWQKCCPGE  491

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +++ ++ Y QCL+L   LR+ GV VHQWW
Sbjct  492  RSKKYEKTYGQCLDLFTSLRKSGVLVHQWW  521



>emb|CAN65583.1| hypothetical protein VITISV_019793 [Vitis vinifera]
Length=277

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            E    +NWL+N+V + D+VVMK + E         +     ICL+DE+FLEC  ++W+  
Sbjct  184  EGFDFANWLKNSVSERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRC  243

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + Q+ Y QCL+L   LR  GV VHQWW
Sbjct  244  CPGERSSKYQKTYDQCLDLFSNLRNSGVLVHQWW  277



>ref|XP_008231499.1| PREDICTED: uncharacterized protein LOC103330643 [Prunus mume]
Length=491

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            E    ++WL+NTV + D+VV+K + E         ++    ICL+DE+FLEC  ++W+  
Sbjct  398  EGFDFADWLKNTVSERDFVVVKMDVEGTEFHLIPRLIETGAICLIDEIFLECHYNRWQRC  457

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              G+ + + ++ Y QCL+L  +LR+ GV VHQWW
Sbjct  458  CPGQRSPKFKKTYGQCLDLFNKLRDAGVLVHQWW  491



>ref|XP_002264939.1| PREDICTED: uncharacterized protein LOC100263765 [Vitis vinifera]
Length=513

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            E    +NWL+N+V + D+VVMK + E         +     ICL+DE+FLEC  ++W+  
Sbjct  420  EGFDFANWLKNSVSERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRC  479

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + Q+ Y QCL+L   LR  GV VHQWW
Sbjct  480  CPGERSSKYQKTYDQCLDLFSNLRNSGVLVHQWW  513



>ref|XP_010490518.1| PREDICTED: uncharacterized protein LOC104768289 [Camelina sativa]
Length=514

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+N V++ D+VVMK + E         +++   ICL+DELFLEC  ++W+    G+
Sbjct  425  FADWLKNNVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  484

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  485  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  514



>ref|XP_011095084.1| PREDICTED: uncharacterized protein LOC105174622 [Sesamum indicum]
Length=521

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL NTV + DYVVMK + E         +     ICL+DELFLEC  ++W++   GE
Sbjct  432  FADWLMNTVSERDYVVMKMDVEGTEFDLIPRLFETGAICLIDELFLECHYNRWQKCCPGE  491

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
               + Q+ Y QCL L   LR+ GV VHQWW
Sbjct  492  RTAKYQKTYGQCLNLFTSLRKSGVLVHQWW  521



>tpg|DAA64242.1| TPA: hypothetical protein ZEAMMB73_693239 [Zea mays]
Length=113

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
             +   + WLR TV + DYVVMK + E         +     ICLVDELFLEC  ++W++ 
Sbjct  20   PAFDFAEWLRQTVTEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKC  79

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + +  Y +CL+L   LRE GV VHQWW
Sbjct  80   CPGERSPKYENTYEECLDLFSSLRESGVLVHQWW  113



>ref|XP_010543177.1| PREDICTED: uncharacterized protein LOC104816178 [Tarenaya hassleriana]
Length=519

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+NTV++ D+VVMK + E         +     ICL+DELFLEC  ++W+    G+
Sbjct  430  FAEWLKNTVRERDFVVMKMDVEGTEFELIPRLFETGAICLIDELFLECHYNRWQRCCPGQ  489

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + +  + Y QCLEL   LR+ GV VHQWW
Sbjct  490  RSSKYDKTYDQCLELFASLRQSGVLVHQWW  519



>ref|XP_010277645.1| PREDICTED: uncharacterized protein LOC104612037 [Nelumbo nucifera]
Length=516

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg-egg  308
             ++WL+N V + D+VVMK + E         +     ICL+DE+FLEC  ++W+    G 
Sbjct  427  FAHWLKNAVSENDFVVMKMDVEGTEFHLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  486

Query  307  eENQRQRAYWQCLELHGRLREEGVAVHQWW  218
              ++ Q+ Y QCLEL   LRE GV VHQWW
Sbjct  487  RTSKYQKTYSQCLELFTSLRESGVLVHQWW  516



>ref|XP_006398590.1| hypothetical protein EUTSA_v10015877mg [Eutrema salsugineum]
 gb|ESQ40043.1| hypothetical protein EUTSA_v10015877mg [Eutrema salsugineum]
Length=513

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = -3

Query  514  KVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICL  362
             V+ S  +  GE    +    ++WL+ +V++ D+VVMK + E         +++   ICL
Sbjct  404  PVKKSSSSLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICL  463

Query  361  VDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            +DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  464  IDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQSGVLVHQWW  513



>gb|KFK24641.1| hypothetical protein AALP_AA8G005900 [Arabis alpina]
Length=506

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+  V+D D+VVMK + E         +++   ICL+DELFLEC  ++W+    G+
Sbjct  417  FADWLKKNVRDRDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  476

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  477  RSQKYNKTYNQCLELFTSLRQTGVLVHQWW  506



>ref|XP_007208450.1| hypothetical protein PRUPE_ppa004250mg [Prunus persica]
 gb|EMJ09649.1| hypothetical protein PRUPE_ppa004250mg [Prunus persica]
Length=520

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+NT  + D+VVMK + E         +     ICL+DE+FLEC  ++W+    GE
Sbjct  431  FANWLKNTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  490

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  491  RSSKYEKTYGQCLDLFTSLRQSGVLVHQWW  520



>ref|XP_002526697.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35719.1| conserved hypothetical protein [Ricinus communis]
Length=488

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+NTV + D+VVMK + E         +     ICL+DE+FLEC  ++W+    G+
Sbjct  399  FAEWLKNTVTEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGQ  458

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LRE GV VHQWW
Sbjct  459  RSSKYEKTYGQCLDLFTSLRESGVLVHQWW  488



>ref|XP_010038433.1| PREDICTED: uncharacterized protein LOC104426933 [Eucalyptus grandis]
 gb|KCW88235.1| hypothetical protein EUGRSUZ_A00626 [Eucalyptus grandis]
Length=521

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = -3

Query  514  KVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICL  362
            +++  + +  GE    +    + WL+NTV + D+VVMK + E         ++    ICL
Sbjct  412  RIQPVQSSSDGEVAKIQGFDFAEWLKNTVSEKDFVVMKMDVEGTEFDLIPRLIETGAICL  471

Query  361  VDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            +DELFLEC  ++W+    GE + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  472  IDELFLECHYNRWQRCCPGERSSKYEKTYGQCLDLFTSLRQSGVLVHQWW  521



>ref|NP_195791.1| methyltransferase [Arabidopsis thaliana]
 emb|CAB82287.1| putative protein [Arabidopsis thaliana]
 gb|AAL07072.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13203.1| unknown protein [Arabidopsis thaliana]
 gb|AAN60352.1| unknown [Arabidopsis thaliana]
 gb|AED90380.1| methyltransferase [Arabidopsis thaliana]
Length=513

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+ +V++ D+VVMK + E         +++   ICL+DELFLEC  ++W+    G+
Sbjct  424  FADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  483

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  484  RSQKYNKTYNQCLELFNSLRQRGVLVHQWW  513



>ref|XP_010264515.1| PREDICTED: uncharacterized protein LOC104602499 [Nelumbo nucifera]
Length=516

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg-egg  308
             ++WL+NTV + D+VVMK + E         +     ICL+DE+FLEC  ++W++   G 
Sbjct  427  FAHWLKNTVSERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQKCCPGE  486

Query  307  eENQRQRAYWQCLELHGRLREEGVAVHQWW  218
              ++ Q  Y QCLEL   LR  GV VHQWW
Sbjct  487  RTSKYQNTYSQCLELFTSLRASGVLVHQWW  516



>emb|CDP19944.1| unnamed protein product [Coffea canephora]
Length=524

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmka-----eaevveemvreRTICLVDELFLECK-SQWeegegge  305
             + WL++TV + D+VVMK      E  ++  ++    ICL+DE+FLEC  ++W++   GE
Sbjct  435  FAAWLKDTVSERDFVVMKMDVEGTEFNLIPRLIETGAICLIDEVFLECHYNRWQKCCPGE  494

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCLEL+  LRE GV VHQWW
Sbjct  495  RSSKYEKTYGQCLELYTSLRESGVLVHQWW  524



>emb|CDX80754.1| BnaC03g00080D [Brassica napus]
Length=504

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = -3

Query  514  KVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICL  362
             V  S  +  GE    +    ++WL+ +V++ D+VVMK + E         +++   ICL
Sbjct  395  PVTKSSSSLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICL  454

Query  361  VDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            +DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  455  IDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQRGVLVHQWW  504



>ref|XP_004156629.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101205174 
[Cucumis sativus]
Length=508

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV + D+VVMK + E         + +   ICL+DELFLEC  ++W+    GE
Sbjct  419  FADWLKNTVTEKDFVVMKMDVEGTEFDLIPRLFKTGAICLIDELFLECHYNRWQRCCPGE  478

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + +  + Y QCL+L   LR  GV VHQWW
Sbjct  479  RSAKYDKTYGQCLDLFASLRRSGVLVHQWW  508



>ref|XP_004137689.1| PREDICTED: uncharacterized protein LOC101205174 [Cucumis sativus]
 gb|KGN58713.1| hypothetical protein Csa_3G730770 [Cucumis sativus]
Length=508

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV + D+VVMK + E         + +   ICL+DELFLEC  ++W+    GE
Sbjct  419  FADWLKNTVTEKDFVVMKMDVEGTEFDLIPRLFKTGAICLIDELFLECHYNRWQRCCPGE  478

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + +  + Y QCL+L   LR  GV VHQWW
Sbjct  479  RSAKYDKTYGQCLDLFASLRRSGVLVHQWW  508



>ref|XP_004148602.1| PREDICTED: uncharacterized protein LOC101209474 [Cucumis sativus]
 gb|KGN54421.1| hypothetical protein Csa_4G314480 [Cucumis sativus]
Length=520

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+NTV + D+VV+K + E         +     ICL+DE+FLEC  ++W+    G+
Sbjct  431  FANWLKNTVSEKDFVVLKMDVEGTEFELIPRLFETGAICLIDEMFLECHYNRWQRCCPGQ  490

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y +C++L   LR+ GV VHQWW
Sbjct  491  RSTKYEKTYSECIDLFASLRQSGVLVHQWW  520



>ref|XP_007208593.1| hypothetical protein PRUPE_ppa022624mg [Prunus persica]
 gb|EMJ09792.1| hypothetical protein PRUPE_ppa022624mg [Prunus persica]
Length=491

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            E    ++WL+NT  + D+VV+K + E         ++    ICL+DE+FLEC  ++W+  
Sbjct  398  EGFDFADWLKNTASERDFVVVKMDVEGTEFHLIPRLIETGAICLIDEIFLECHYNRWQRC  457

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              G+ + + ++ Y QCL+L  +LR+ GV VHQWW
Sbjct  458  CPGQRSPKFKKTYGQCLDLFNKLRDTGVLVHQWW  491



>ref|XP_002870902.1| hypothetical protein ARALYDRAFT_486898 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47161.1| hypothetical protein ARALYDRAFT_486898 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+ +V++ D+VVMK + E         +++   ICL+DELFLEC  ++W+    G+
Sbjct  424  FADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  483

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  484  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  513



>ref|XP_011080707.1| PREDICTED: uncharacterized protein LOC105163887 isoform X1 [Sesamum 
indicum]
Length=490

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 7/87 (8%)
 Frame = -3

Query  457  WLRNTVKDADYvvmka-----eaevveemvreRTICLVDELFLECK-SQWeegeggeENQ  296
            WL++TV + DYVV+K      E  ++  ++    ICL+DE+FLEC  ++W+    G+ + 
Sbjct  404  WLKSTVVERDYVVVKMDVEGTEFHLIPRLIETGAICLIDEMFLECHYNRWQRCCPGKRSP  463

Query  295  R-QRAYWQCLELHGRLREEGVAVHQWW  218
            + Q  Y QCLEL+  LR+ GV VHQWW
Sbjct  464  KYQNTYAQCLELYSSLRKSGVLVHQWW  490



>ref|XP_009125399.1| PREDICTED: uncharacterized protein LOC103850409 [Brassica rapa]
Length=488

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = -3

Query  514  KVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICL  362
             V+ S  +  GE    +    ++WL+ +V++ D+VVMK + E         +++   ICL
Sbjct  379  PVKKSSSSLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICL  438

Query  361  VDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            +DELFLEC  ++W+    G+ +Q+  + Y QCL+L   LR+ GV VHQWW
Sbjct  439  IDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLQLFTSLRQSGVLVHQWW  488



>ref|XP_006658171.1| PREDICTED: uncharacterized protein LOC102700724 [Oryza brachyantha]
Length=482

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL++TV + DYVVMK + E         +     ICL+DELFLEC  ++W++   GE
Sbjct  393  FAEWLKHTVSEQDYVVMKMDVEGTEFDLIPRLFDTGAICLIDELFLECHYNRWQKCCPGE  452

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + Q  Y +CLEL   LRE GV VHQWW
Sbjct  453  RSPKYQNTYDECLELFSSLRESGVLVHQWW  482



>ref|XP_008464242.1| PREDICTED: uncharacterized protein LOC103502172 [Cucumis melo]
Length=520

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV + D+VV+K + E         +     ICL+DE+FLEC  ++W+    G+
Sbjct  431  FADWLKNTVSEKDFVVLKMDVEGTEFELIPRLFETGAICLIDEMFLECHYNRWQRCCPGQ  490

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QC++L   LR+ GV VHQWW
Sbjct  491  RSTKYEKTYSQCIDLFASLRQSGVLVHQWW  520



>emb|CDY11183.1| BnaA03g00190D [Brassica napus]
Length=500

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+ +V++ D+VVMK + E         +++   ICL+DELFLEC  ++W+    G+
Sbjct  411  FADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  470

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  471  RSQKYNKTYNQCLELFTSLRQSGVLVHQWW  500



>ref|XP_004492512.1| PREDICTED: uncharacterized protein LOC101509260 [Cicer arietinum]
Length=521

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+NTV   D+VVMK + E         + +   ICL+DE+FLEC  ++W+    G+
Sbjct  432  FANWLKNTVSRNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  491

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ G+ VHQWW
Sbjct  492  RSSKYEKTYDQCLDLFNSLRQSGILVHQWW  521



>ref|XP_009781173.1| PREDICTED: uncharacterized protein LOC104230131 [Nicotiana sylvestris]
Length=499

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DELFLEC  S+W++   G+ + + ++ Y  CLEL   LRE GV VHQWW
Sbjct  444  AICLIDELFLECHYSRWQKCCPGKRSPKYEKTYAHCLELFSSLRERGVLVHQWW  497



>ref|XP_009342226.1| PREDICTED: uncharacterized protein LOC103934219 [Pyrus x bretschneideri]
Length=470

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            E    + WL++ V + D+VV+K + E        +++    ICL+DE+FLEC  ++W++ 
Sbjct  377  EGFDFAEWLKSVVSERDFVVVKMDGEGAEFHLIPKLIESGAICLIDEIFLECHYNRWQKC  436

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              G+ + + ++ Y QCLEL  +LRE GV VHQWW
Sbjct  437  CSGQRSPKFKKTYGQCLELFTKLRENGVLVHQWW  470



>gb|KDP22815.1| hypothetical protein JCGZ_00402 [Jatropha curcas]
Length=514

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+NTV + D+VVMK + E         + +   ICL+DE+FLEC  ++W+    G+
Sbjct  425  FAEWLKNTVTEKDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  484

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  485  RSPKYEKTYGQCLKLFTSLRDSGVLVHQWW  514



>ref|XP_008370209.1| PREDICTED: uncharacterized protein LOC103433716 [Malus domestica]
Length=523

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+ T  + D+VVMK + E         +     ICL+DE+FLEC  ++W+    GE
Sbjct  434  FANWLKKTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  493

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +++Y QCL+L   LR+ GV VHQWW
Sbjct  494  RSSKYEKSYGQCLDLFASLRQSGVLVHQWW  523



>gb|EEC82462.1| hypothetical protein OsI_26902 [Oryza sativa Indica Group]
Length=395

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevve-emvreRTICLVDELF  347
            + +   D+ E      + G++ WL   V++ DYVV+KA  E VE  + R   +  VDELF
Sbjct  276  VRLDAADATEPAASSSAAGIAEWLEGNVREEDYVVVKAGVEAVEEILRRRAAVRRVDELF  335

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            L+C +          +  +R YW+CL L+GRLR+ GVAVHQWW
Sbjct  336  LDCDAG------AGADAARRPYWECLALYGRLRDHGVAVHQWW  372



>ref|XP_004172269.1| PREDICTED: uncharacterized LOC101209474 [Cucumis sativus]
Length=520

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+NTV   D+VV+K + E         +     ICL+DE+FLEC  ++W+    G+
Sbjct  431  FANWLKNTVSQKDFVVLKMDVEGTEFELIPRLFETGAICLIDEMFLECHYNRWQRCCPGQ  490

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y +C++L   LR+ GV VHQWW
Sbjct  491  RSTKYEKTYSECIDLFASLRQSGVLVHQWW  520



>ref|NP_001060302.1| Os07g0620600 [Oryza sativa Japonica Group]
 dbj|BAC10179.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22216.1| Os07g0620600 [Oryza sativa Japonica Group]
Length=414

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevve-emvreRTICLVDELF  347
            + +   D+ E      + G++ WL   V++ DYVV+KA  E VE  + R   +  VDELF
Sbjct  276  VRLDAADATEPAASSSAAGIAEWLEGNVREEDYVVVKAGVEAVEEILRRRAAVRRVDELF  335

Query  346  LECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            L+C +          +  +R YW+CL L+GRLR+ GVAVHQWW
Sbjct  336  LDCDAG------AGADAARRPYWECLALYGRLRDHGVAVHQWW  372



>gb|EYU45992.1| hypothetical protein MIMGU_mgv1a025887mg [Erythranthe guttata]
Length=484

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmka-----eaevveemvreRTICLVDELFLECK-SQWeeg  317
            E    + WL++TV + DYVV+K      E  ++  ++    ICL+DE+F+EC  ++W+  
Sbjct  391  EGFDFTAWLKSTVVERDYVVVKMDVEGTEFHLIPRLIESGAICLIDEMFIECHYNRWQRC  450

Query  316  eggeENQRQR-AYWQCLELHGRLREEGVAVHQWW  218
              G+ + + R  Y QCLEL   LR+ GV VHQWW
Sbjct  451  CPGKRSPKYRKTYAQCLELFSSLRKRGVLVHQWW  484



>ref|NP_001175347.1| Os07g0692401 [Oryza sativa Japonica Group]
 gb|EEE67866.1| hypothetical protein OsJ_25678 [Oryza sativa Japonica Group]
 dbj|BAH94075.1| Os07g0692401 [Oryza sativa Japonica Group]
Length=484

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
             +   + WL+ TV + DYVVMK + E         +     ICL+DELFLEC  ++W++ 
Sbjct  391  PAFDFAEWLKRTVSEQDYVVMKMDVEGTEFDLIPRLFDTGAICLIDELFLECHYNRWQKC  450

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + Q  Y +CLEL   LRE GV VHQWW
Sbjct  451  CPGERSPKYQNTYDECLELFSSLRESGVLVHQWW  484



>dbj|BAC75560.1| hypothetical protein [Oryza sativa Japonica Group]
Length=480

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
             +   + WL+ TV + DYVVMK + E         +     ICL+DELFLEC  ++W++ 
Sbjct  387  PAFDFAEWLKRTVSEQDYVVMKMDVEGTEFDLIPRLFDTGAICLIDELFLECHYNRWQKC  446

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + Q  Y +CLEL   LRE GV VHQWW
Sbjct  447  CPGERSPKYQNTYDECLELFSSLRESGVLVHQWW  480



>ref|XP_009130631.1| PREDICTED: uncharacterized protein LOC103855402 [Brassica rapa]
Length=508

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 11/110 (10%)
 Frame = -3

Query  514  KVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICL  362
             V  S  +  GE    +    ++WL+  V++ D+VVMK + E         +++   ICL
Sbjct  399  PVTKSSSSLAGEVNLIQGFDFADWLKKRVRERDFVVMKMDVEGTEFDLIPRLIKTGAICL  458

Query  361  VDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            +DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  459  IDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQSGVLVHQWW  508



>gb|EPS62213.1| hypothetical protein M569_12578 [Genlisea aurea]
Length=511

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL++TV + D+VVMK + E         +    +ICL+DELFLEC  ++W++   G+
Sbjct  422  FAAWLKSTVSERDFVVMKMDVEGTEFDLIPRLFETESICLIDELFLECHYNRWQKCCPGQ  481

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + +  + Y QCL+L   LRE GV VHQWW
Sbjct  482  RSSKYDKTYGQCLDLFSSLRERGVHVHQWW  511



>ref|XP_001771643.1| predicted protein [Physcomitrella patens]
 gb|EDQ63557.1| predicted protein [Physcomitrella patens]
Length=480

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmk-----aeaevveemvreRTICLVDELFLECK-SQWeeg  317
            + + +S W+R+ V++ D++V+K     AE ++V +MV    ICLVDELFLEC  ++W+  
Sbjct  388  QGLDVSEWIRSMVREEDFLVVKMDVEGAETDLVPKMVDTGAICLVDELFLECHYNRWQRS  447

Query  316  eggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
                  +  R Y  C+ L   LR  GV VHQWW
Sbjct  448  SPHRSPKYNRTYQDCVSLFRSLRRRGVLVHQWW  480



>ref|XP_009373100.1| PREDICTED: uncharacterized protein LOC103962151 [Pyrus x bretschneideri]
Length=523

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 7/89 (8%)
 Frame = -3

Query  463  SNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegeggeE  302
            +NWL+ T  + D+VVMK + E         +     ICL+DE+FLEC  ++W+    GE 
Sbjct  435  ANWLKKTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGER  494

Query  301  NQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            + + +++Y QCL+L   LR+ GV VHQWW
Sbjct  495  SSKYEKSYGQCLDLFASLRQSGVLVHQWW  523



>tpg|DAA41831.1| TPA: hypothetical protein ZEAMMB73_867074 [Zea mays]
Length=704

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 7/89 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  305
            L+ WL+ TV + DY+VMK + E  E      +     ICLVDELFLEC  ++W++   GE
Sbjct  404  LAEWLKQTVTEQDYLVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  463

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQW  221
             + +    Y +CL+L   LRE GV VHQW
Sbjct  464  RSPKYDNTYEECLDLFSSLRENGVLVHQW  492



>ref|XP_011015027.1| PREDICTED: uncharacterized protein LOC105118715 [Populus euphratica]
Length=514

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 61/111 (55%), Gaps = 11/111 (10%)
 Frame = -3

Query  517  VKVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTIC  365
            VK   S  +  GE    E    + WL++TV + D+VVMK + E         +     IC
Sbjct  404  VKSSLSSRSFNGEVNEIEGFDFAEWLKSTVTEKDFVVMKMDVEGTEFDLIPRLFETGAIC  463

Query  364  LVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            L+DE+FLEC  ++W+    G+ + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  464  LIDEIFLECHYNRWQRCCPGQRSSKYEKTYGQCLDLFSSLRDRGVLVHQWW  514



>ref|XP_007026550.1| Methyltransferases [Theobroma cacao]
 gb|EOY07052.1| Methyltransferases [Theobroma cacao]
Length=518

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+NTV + D+VVMK + E         +     ICL+DE+FLEC  ++W+    G+
Sbjct  429  FAEWLKNTVTERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGQ  488

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  489  RSTKYEKNYGQCLELFTSLRKSGVLVHQWW  518



>ref|XP_009412633.1| PREDICTED: uncharacterized protein LOC103994078 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412634.1| PREDICTED: uncharacterized protein LOC103994078 [Musa acuminata 
subsp. malaccensis]
Length=514

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV + DYVVMK + E         +     ICL+DELFLEC  ++W++   G+
Sbjct  425  FAAWLKRTVTERDYVVMKMDVEGTEFDLVPRLFETGGICLIDELFLECHYNRWQKCCPGQ  484

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + Q  Y +CL+L  RLR+ GV VHQWW
Sbjct  485  RSPKYQNTYGECLKLFTRLRDGGVLVHQWW  514



>ref|XP_008442352.1| PREDICTED: uncharacterized protein LOC103486248 [Cucumis melo]
Length=508

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV + D+VVMK + E         + +   ICL+DE+FLEC  ++W+    GE
Sbjct  419  FADWLKNTVTEKDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGE  478

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + +  + Y QCL+L   LR  GV VHQWW
Sbjct  479  RSAKYDKTYGQCLDLFTSLRRSGVLVHQWW  508



>gb|AFW71483.1| hypothetical protein ZEAMMB73_430632 [Zea mays]
Length=381

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WLR TV + DYVVMK + E         +     ICLVDELFLEC  ++W++   GE
Sbjct  292  FAEWLRQTVTEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  351

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y +CL+L   LRE GV VHQWW
Sbjct  352  RSPKYENTYEECLDLFSSLRESGVLVHQWW  381



>ref|XP_008647032.1| PREDICTED: uncharacterized protein LOC103628641, partial [Zea 
mays]
Length=412

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WLR TV + DYVVMK + E         +     ICLVDELFLEC  ++W++   GE
Sbjct  323  FAEWLRQTVTEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  382

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y +CL+L   LRE GV VHQWW
Sbjct  383  RSPKYENTYEECLDLFSSLRESGVLVHQWW  412



>emb|CDP19032.1| unnamed protein product [Coffea canephora]
Length=481

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTI-----CLVDELFLECK-SQWeeg  317
            E++ L++WL  T    D+VVMK + E  E  +  R +     CL+DELFLEC   +W + 
Sbjct  388  EALDLADWLIRTFSKRDFVVMKMDIEGSEFDLMNRLVESGAFCLIDELFLECHYDRWIKC  447

Query  316  -eggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
              G + N+ +R+Y QC+ L+ +LR++G  VHQWW
Sbjct  448  CSGEKTNRHKRSYAQCMNLYAKLRKDGCFVHQWW  481



>ref|XP_007017010.1| Methyltransferase [Theobroma cacao]
 gb|EOY34629.1| Methyltransferase [Theobroma cacao]
Length=546

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 11/105 (10%)
 Frame = -3

Query  511  VEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELF  347
            VED ++     +   L+ WL+N V + D+VVMK + E  E      ++    ICL+DE+F
Sbjct  446  VEDVDKV----QGFDLAEWLKNVVSERDFVVMKMDVEGTEFHLMPRLIETGAICLIDEVF  501

Query  346  LECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
            LEC  ++W+    G+ + + Q  Y QC++L   LR  GV VHQWW
Sbjct  502  LECHYNRWQRCCPGQRSPKYQNTYDQCVDLFDSLRARGVLVHQWW  546



>ref|NP_001143103.1| hypothetical protein precursor [Zea mays]
 gb|ACG29006.1| hypothetical protein [Zea mays]
 gb|ACR37970.1| unknown [Zea mays]
 tpg|DAA64241.1| TPA: hypothetical protein ZEAMMB73_693239 [Zea mays]
Length=496

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WLR TV + DYVVMK + E         +     ICLVDELFLEC  ++W++   GE
Sbjct  407  FAEWLRQTVTEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  466

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y +CL+L   LRE GV VHQWW
Sbjct  467  RSPKYENTYEECLDLFSSLRESGVLVHQWW  496



>ref|XP_008244798.1| PREDICTED: uncharacterized protein LOC103342911 [Prunus mume]
Length=520

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+ T  + D+VVMK + E         +     ICL+DE+FLEC  ++W+    GE
Sbjct  431  FANWLKKTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  490

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  491  RSSKYEKTYGQCLDLFTSLRQSGVLVHQWW  520



>ref|XP_009774872.1| PREDICTED: uncharacterized protein LOC104224855 [Nicotiana sylvestris]
Length=515

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+++V + DYVVMK + E         +     ICL+DE+FLEC  ++W++   GE
Sbjct  426  FAEWLKSSVSERDYVVMKMDVEGTEFDLIPRLFETGAICLIDEVFLECHYNRWQKCCPGE  485

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y QCL+L   LRE GV VHQWW
Sbjct  486  RSSKYEHTYGQCLDLFASLRESGVLVHQWW  515



>ref|XP_004987042.1| PREDICTED: uncharacterized protein LOC101779612 [Setaria italica]
Length=495

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
            L+ WL+ TV + DYVVMK + E         M+    ICLVDELFLEC  ++W+    GE
Sbjct  406  LAEWLKRTVSEQDYVVMKMDVEGTEFDLIPRMIETGAICLVDELFLECHYNRWQRCCPGE  465

Query  304  ENQRQR-AYWQCLELHGRLREEGVAVHQWW  218
             + + R  Y +CL+L   LR  GV VHQWW
Sbjct  466  RSPKYRNTYGECLQLFTSLRNSGVLVHQWW  495



>ref|XP_011019055.1| PREDICTED: uncharacterized protein LOC105121895 [Populus euphratica]
Length=514

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            E    + WL++TV + D+VVMK + E         +     ICL+DE+FLEC  ++W+  
Sbjct  421  EGFDFAEWLKSTVTEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRC  480

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              G+ + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  481  CPGQRSSKYEKTYGQCLDLFTSLRDRGVLVHQWW  514



>emb|CDY04832.1| BnaAnng00140D [Brassica napus]
Length=881

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 11/108 (10%)
 Frame = -3

Query  511  VEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLV  359
            V+ S  +  GE    +    ++WL+ +V + D+VVMK + E  E      +++   ICL+
Sbjct  415  VKKSSSSLAGEVNLIQGFDFADWLKKSVIERDFVVMKMDVEGTEFDLIPRLIKTGAICLI  474

Query  358  DELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQW  221
            DELFLEC  ++W+    G+ +Q+  + Y QCL+L   LR+ GV VHQW
Sbjct  475  DELFLECHYNRWQRCCPGQRSQKYNKTYNQCLQLFTSLRQSGVLVHQW  522



>ref|XP_009606484.1| PREDICTED: uncharacterized protein LOC104100844 isoform X1 [Nicotiana 
tomentosiformis]
Length=497

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DELFLEC  ++W+    G+ + +  + Y +CLEL   LRE GV VHQWW
Sbjct  442  AICLIDELFLECHYNRWQRCCPGKRSPKYDKTYAECLELFSSLRERGVLVHQWW  495



>gb|EMS66683.1| hypothetical protein TRIUR3_26284 [Triticum urartu]
Length=231

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            ++   + WL+ TV + DYVVMK + E         +     ICLVDE+FLEC  ++W+  
Sbjct  138  QAFDFAEWLKQTVSEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDEVFLECHYNRWQRC  197

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + Q  Y +CLEL   LRE GV VHQW+
Sbjct  198  CPGERSPKYQNTYEECLELFSSLRESGVLVHQWF  231



>ref|XP_009615562.1| PREDICTED: uncharacterized protein LOC104108275 [Nicotiana tomentosiformis]
Length=515

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+++V + DYVVMK + E         +     ICL+DE+FLEC  ++W++   GE
Sbjct  426  FAEWLKSSVSERDYVVMKMDVEGTEFDLIPRLFETGAICLIDEVFLECHYNRWQKCCPGE  485

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y QCL+L   LRE GV VHQWW
Sbjct  486  RSSKYEHTYGQCLDLFTSLRESGVLVHQWW  515



>ref|XP_002461266.1| hypothetical protein SORBIDRAFT_02g043860 [Sorghum bicolor]
 gb|EER97787.1| hypothetical protein SORBIDRAFT_02g043860 [Sorghum bicolor]
Length=495

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV + DYVVMK + E         +     ICLVDELFLEC  ++W++   GE
Sbjct  406  FAEWLKQTVTEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  465

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y +CL+L   LRE GV VHQWW
Sbjct  466  RSPKYENTYEECLDLFSSLRESGVLVHQWW  495



>ref|XP_008359661.1| PREDICTED: uncharacterized protein LOC103423371, partial [Malus 
domestica]
Length=248

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 13/108 (12%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea-----evveemvreRTICLV  359
            ++V ++   +   G+E      W + TV  AD+VV+K  A     + + E+     IC V
Sbjct  137  VNVPIDGITDPYVGDEGFDFLVWFKETVGFADFVVLKMNAGNVELKFLTELFESGAICFV  196

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            DELFL C  Q         +        C+++ G LR  GV VHQWW 
Sbjct  197  DELFLHCSGQ--------VDAGGEMPVDCMDIFGSLRSSGVFVHQWWG  236



>ref|XP_004302571.1| PREDICTED: uncharacterized protein LOC101290967 [Fragaria vesca 
subsp. vesca]
Length=511

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + W++NT  + D+VVMK + E         +     ICL+DE+FLEC  ++W+    GE
Sbjct  422  FAEWVKNTFTEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEVFLECHYNRWQRTLPGE  481

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  482  RSAKYEKTYGQCLDLFTSLRQSGVLVHQWW  511



>gb|EMT30745.1| hypothetical protein F775_21759 [Aegilops tauschii]
Length=308

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            ++   + WL+ TV + DYVVMK + E         +     ICLVDE+FLEC  ++W+  
Sbjct  215  QAFDFAEWLKQTVSEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDEVFLECHYNRWQRC  274

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + Q  Y +CLEL   LRE GV VHQW+
Sbjct  275  CPGERSPKYQNTYEECLELFSSLRESGVLVHQWF  308



>ref|XP_006828158.1| hypothetical protein AMTR_s00023p00093390 [Amborella trichopoda]
 gb|ERM95574.1| hypothetical protein AMTR_s00023p00093390 [Amborella trichopoda]
Length=495

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DE+FLEC  ++W++       + ++ Y  C+ L   LRE GV VHQWW
Sbjct  443  AICLIDEIFLECHYNRWQKCCPERSKKYKKTYGDCMNLFTSLRESGVLVHQWW  495



>ref|XP_002465406.1| hypothetical protein SORBIDRAFT_01g038110 [Sorghum bicolor]
 gb|EER92404.1| hypothetical protein SORBIDRAFT_01g038110 [Sorghum bicolor]
Length=491

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
            L+ WL+ TV + D+VVMK + E         ++    ICLVDELFLEC  ++W+    G 
Sbjct  402  LAEWLKRTVSEQDFVVMKMDVEGTEFDLIPRLIDTGAICLVDELFLECHYNRWQRCCPGV  461

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y +CLEL   LR+ GV VHQWW
Sbjct  462  RSPKYESTYGECLELFTSLRDSGVLVHQWW  491



>ref|NP_001169287.1| hypothetical protein [Zea mays]
 gb|ACN33289.1| unknown [Zea mays]
 tpg|DAA41832.1| TPA: hypothetical protein ZEAMMB73_867074 [Zea mays]
Length=493

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
            L+ WL+ TV + DY+VMK + E         +     ICLVDELFLEC  ++W++   GE
Sbjct  404  LAEWLKQTVTEQDYLVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  463

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + +    Y +CL+L   LRE GV VHQWW
Sbjct  464  RSPKYDNTYEECLDLFSSLRENGVLVHQWW  493



>gb|KHN33252.1| hypothetical protein glysoja_027939 [Glycine soja]
Length=293

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV + D+VVMK + E         +     ICLVDE+FLEC  ++W+    G+
Sbjct  204  FADWLKNTVSENDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  263

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  264  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  293



>ref|XP_004296044.1| PREDICTED: uncharacterized protein LOC101312240 [Fragaria vesca 
subsp. vesca]
Length=504

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DE+F+EC  ++W+    G+ + + +R+Y QCLEL  +LR  GV VHQWW
Sbjct  451  AICLIDEVFMECHYNRWQRCCRGQRSAKFKRSYDQCLELFNKLRAAGVLVHQWW  504



>ref|XP_003623416.1| hypothetical protein MTR_7g070530 [Medicago truncatula]
 gb|AES79634.1| methyltransferase domain protein [Medicago truncatula]
Length=509

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+ TV   D+VVMK + E         + +   ICL+DE+FLEC  ++W+    G+
Sbjct  420  FANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  479

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCLEL   LR+ G+ VHQW+
Sbjct  480  RSSKYEKTYDQCLELFNSLRQSGILVHQWF  509



>ref|XP_008369759.1| PREDICTED: uncharacterized protein LOC103433285 [Malus domestica]
Length=480

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 13/107 (12%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvr-----eRTICLV  359
            ++V ++   +   G+E      W + TV  AD++V+K  A   E            IC V
Sbjct  369  VNVTIDGDTDPYVGDEGFDFLVWFKETVGFADFMVLKMNAGSAELKFLTELFESGAICFV  428

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            DELFL C  Q + G     +        C+++ G LR  GV VHQWW
Sbjct  429  DELFLHCSGQVDAGGAMPVD--------CMDIFGSLRSSGVFVHQWW  467



>ref|XP_008809973.1| PREDICTED: uncharacterized protein LOC103721505 [Phoenix dactylifera]
Length=520

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV ++D+VVMK + E         +     ICL+DELFLEC  ++W+    GE
Sbjct  431  FAKWLKRTVSESDFVVMKMDVEGTEFDLIPRLFETGAICLIDELFLECHYNRWQRCCPGE  490

Query  304  ENQRQR-AYWQCLELHGRLREEGVAVHQWW  218
               + R  Y +CL+L   LR+ GV VHQWW
Sbjct  491  RTPKYRKTYGECLKLFTSLRKSGVLVHQWW  520



>ref|XP_004958788.1| PREDICTED: uncharacterized protein LOC101783448 [Setaria italica]
Length=488

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV + DYVVMK + E         +     ICLVDELFLEC  ++W++   GE
Sbjct  399  FAEWLKQTVTEEDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  458

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + +  Y +CL+L   LRE GV VHQWW
Sbjct  459  RSPKYENTYEECLDLFSSLRESGVLVHQWW  488



>ref|XP_010937964.1| PREDICTED: uncharacterized protein LOC105057170 [Elaeis guineensis]
Length=523

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 11/106 (10%)
 Frame = -3

Query  502  SEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDEL  350
            SE   +GE         + WL+ TV  +D+VVMK + E         + +   ICL+DEL
Sbjct  418  SEGVSSGEVHTIHGFDFAEWLKRTVTQSDFVVMKMDVEGTEFDLVPRLFKTGAICLIDEL  477

Query  349  FLECK-SQWeegeggeENQRQR-AYWQCLELHGRLREEGVAVHQWW  218
            FLEC  ++W+    GE   + R  Y +CL+L   LR+ GV VHQWW
Sbjct  478  FLECHYNRWQRCCPGERTPKYRNTYGECLKLFTSLRKSGVLVHQWW  523



>ref|XP_003516409.1| PREDICTED: uncharacterized protein LOC100811015 [Glycine max]
Length=488

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+NTV + D+VVMK + E         +     ICLVDE+FLEC  ++W+    G+
Sbjct  399  FAEWLKNTVSENDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  458

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  459  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  488



>dbj|BAJ97336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = -3

Query  478  ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeeg  317
            ++   + WL+ TV + DYVVMK + E         +     ICLVDE+FLEC  ++W++ 
Sbjct  398  QAFDFAEWLKQTVSEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDEVFLECHYNRWQKC  457

Query  316  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
              GE + + Q  Y +CLEL   LRE GV VHQW+
Sbjct  458  CPGERSPKYQNTYEECLELFSSLRESGVLVHQWF  491



>ref|XP_010683597.1| PREDICTED: uncharacterized protein LOC104898243 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    GE
Sbjct  437  FAQWLKETVTERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  496

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL L   LR  GV VHQWW
Sbjct  497  RSAKYEKTYDQCLNLFTSLRARGVLVHQWW  526



>ref|XP_007134628.1| hypothetical protein PHAVU_010G062900g [Phaseolus vulgaris]
 gb|ESW06622.1| hypothetical protein PHAVU_010G062900g [Phaseolus vulgaris]
Length=505

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV   D+VVMK + E         +     ICLVDE+FLEC  ++W+    G+
Sbjct  416  FADWLKNTVSKNDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  475

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  476  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  505



>gb|KHN02118.1| hypothetical protein glysoja_028321 [Glycine soja]
Length=72

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DELFLEC  ++W+    G+ N +  + Y QCL+L   LR  GV VHQWW
Sbjct  19   AICLIDELFLECHYNRWQRCCPGQRNAKYHKTYSQCLDLLTSLRNYGVLVHQWW  72



>ref|XP_011048563.1| PREDICTED: uncharacterized protein LOC105142571 [Populus euphratica]
Length=459

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 49/98 (50%), Gaps = 13/98 (13%)
 Frame = -3

Query  496  ETKTGEESVGLSNWLRNTVKDADYvvmkaea-----evveemvreRTICLVDELFLECKS  332
            +   G+E      W R TV+ AD+VV+K +A     + +  + +   IC +DELFL C  
Sbjct  368  DPSVGDEGFDFLAWFRETVQYADFVVLKMKAGEVELKFLSSLFKSGAICFIDELFLSCSD  427

Query  331  QWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            Q        + ++ R    C++L   LR  GV VHQWW
Sbjct  428  Q--------DGEKGRVKGDCMDLFKSLRNTGVYVHQWW  457



>gb|KHN44850.1| hypothetical protein glysoja_024421, partial [Glycine soja]
Length=390

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+NTV + D+VVMK + E         +     ICLVDE+FLEC  ++W+    G+
Sbjct  301  FAEWLKNTVSENDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  360

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  361  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  390



>ref|XP_010553127.1| PREDICTED: uncharacterized protein LOC104823307 [Tarenaya hassleriana]
Length=515

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL++ V++ D+VVMK + E         +V    ICL+DELFLEC  ++W+    G+
Sbjct  426  FAEWLKSVVRERDFVVMKMDVEGTEFDLIPRLVETGAICLIDELFLECHYNRWQRCCPGQ  485

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + +  + Y QCLEL   LR+ GV VHQWW
Sbjct  486  RSTKYDKTYDQCLELFTSLRQSGVLVHQWW  515



>ref|XP_004506826.1| PREDICTED: uncharacterized protein LOC101508795 [Cicer arietinum]
Length=511

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             ++WL+NTV   D+VVMK + E         +     ICLVDE+FLEC  ++W+    GE
Sbjct  422  FADWLKNTVTMNDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGE  481

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  482  RSPKYEKTYDQCLQLFNSLRQSGVLVHQWF  511



>ref|XP_006381463.1| hypothetical protein POPTR_0006s13070g [Populus trichocarpa]
 gb|ERP59260.1| hypothetical protein POPTR_0006s13070g [Populus trichocarpa]
Length=459

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 49/98 (50%), Gaps = 13/98 (13%)
 Frame = -3

Query  496  ETKTGEESVGLSNWLRNTVKDADYvvmkaea-----evveemvreRTICLVDELFLECKS  332
            +   G+E      W R TV+ AD+VV+K +A     + +  + +   IC +DELFL C  
Sbjct  368  DPSMGDEGFDFLAWFRETVQYADFVVLKMKAGEVELKFLSGLFKSGAICFIDELFLSCSD  427

Query  331  QWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            Q        + ++ R    C++L   LR  GV VHQWW
Sbjct  428  Q--------DGEKGRVKGDCMDLFKSLRNTGVYVHQWW  457



>ref|XP_008387644.1| PREDICTED: uncharacterized protein LOC103450101 [Malus domestica]
Length=491

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 13/108 (12%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea-----evveemvreRTICLV  359
            ++V ++   +   G+E      W + TV  AD+VV+K  A     + + E+     IC V
Sbjct  380  VNVPIDGITDPYVGDEGFDFLVWFKETVGFADFVVLKMNAGNVELKFLTELFESGAICFV  439

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            DELFL C  Q         +        C+++ G LR  GV VHQWW 
Sbjct  440  DELFLHCSGQ--------VDAGGEMPVDCMDIFGSLRSSGVFVHQWWG  479



>ref|XP_008366676.1| PREDICTED: uncharacterized protein LOC103430317 [Malus domestica]
Length=491

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 13/108 (12%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea-----evveemvreRTICLV  359
            ++V ++   +   G+E      W + TV  AD+VV+K  A     + + E+     IC V
Sbjct  380  VNVPIDGITDPYVGDEGFDFLVWFKETVGFADFVVLKMNAGNVELKFLTELFESGAICFV  439

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            DELFL C  Q         +        C+++ G LR  GV VHQWW 
Sbjct  440  DELFLHCSGQ--------VDAGGEMPVDCMDIFGSLRSSGVFVHQWWG  479



>ref|XP_009349043.1| PREDICTED: uncharacterized protein LOC103940618 [Pyrus x bretschneideri]
Length=492

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 49/107 (46%), Gaps = 13/107 (12%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvre-----RTICLV  359
            ++V ++   +   G+E      W + TV  AD+VV+K  A  VE            IC V
Sbjct  381  VNVTIDGDADPYVGDEGFDFLVWFKETVGFADFVVLKMNAGSVELKFLTELFESGAICFV  440

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            DELFL C  Q        E+        C+++ G LR  GV VHQWW
Sbjct  441  DELFLHCSGQ--------EDAGGAMPVDCMDIFGSLRSSGVFVHQWW  479



>ref|XP_004246304.1| PREDICTED: uncharacterized protein LOC101267731 [Solanum lycopersicum]
Length=510

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DE+FLEC  ++W++   GE + +    Y QCL+L   LRE GV VHQWW
Sbjct  457  AICLIDEVFLECHYNRWQKCCPGERSSKYPNTYSQCLDLFTSLRESGVLVHQWW  510



>ref|XP_010233621.1| PREDICTED: uncharacterized protein LOC104583389 [Brachypodium 
distachyon]
Length=506

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV   DYVVMK + E         +     ICLVDELFLEC  ++W++   GE
Sbjct  417  FAEWLKQTVSQQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  476

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + Q  Y +CLEL   LR+ GV VHQW+
Sbjct  477  RSPKYQNTYEECLELFSSLRDSGVLVHQWF  506



>ref|XP_004500447.1| PREDICTED: uncharacterized protein LOC101506752 [Cicer arietinum]
Length=492

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DELFLEC  ++W+    G+ + + Q+ Y +CL+L   LR+ GV VHQWW
Sbjct  439  AICLIDELFLECHYNRWQRCCPGQRSAKFQKTYSECLDLFTSLRDIGVLVHQWW  492



>ref|XP_006360824.1| PREDICTED: uncharacterized protein LOC102590367 [Solanum tuberosum]
Length=510

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DE+FLEC  ++W++   GE + +    Y QCL+L   LRE GV VHQWW
Sbjct  457  AICLIDEVFLECHYNRWQKCCPGERSSKYPNTYSQCLDLFTSLRESGVLVHQWW  510



>gb|KCW49402.1| hypothetical protein EUGRSUZ_K02942 [Eucalyptus grandis]
Length=479

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV   D+VVMK + E         + +   ICL+DE+FLEC  ++W+    GE
Sbjct  390  FAEWLKRTVSAKDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGE  449

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ G+ VHQWW
Sbjct  450  RSSKYEKTYRQCLDLFNSLRQSGILVHQWW  479



>ref|XP_007205122.1| hypothetical protein PRUPE_ppa004877mg [Prunus persica]
 gb|EMJ06321.1| hypothetical protein PRUPE_ppa004877mg [Prunus persica]
Length=487

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 13/107 (12%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea-----evveemvreRTICLV  359
            ++V  +   E   G+E      W + TV+ AD+VV+K  A     + + E+     IC V
Sbjct  380  VNVTTDGETEPYVGDEGFDFHAWFKETVQFADFVVLKMNAGNVELKFLTELFESGAICFV  439

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            DELFL C    + G     +        C+++ G LR  GV VHQWW
Sbjct  440  DELFLHCSGSVDAGGAMPVD--------CMDIFGSLRSSGVFVHQWW  478



>ref|XP_006603554.1| PREDICTED: uncharacterized protein LOC102670512 [Glycine max]
Length=409

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+ TV   D+VVMK + E         +++   ICL+DE+FLEC  ++W+    G+
Sbjct  320  FANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLIKTGAICLIDEIFLECHYNRWQRCCPGQ  379

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  380  RSAKYEKTYDQCLQLFKSLRQSGVLVHQWF  409



>ref|XP_007140185.1| hypothetical protein PHAVU_008G091100g [Phaseolus vulgaris]
 gb|ESW12179.1| hypothetical protein PHAVU_008G091100g [Phaseolus vulgaris]
Length=508

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV   D+VVMK + E         + +   ICL+DE+FLEC  ++W+    G+
Sbjct  419  FAEWLKKTVTKNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  478

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  479  RSSKYEKTYDQCLQLFNSLRQSGVLVHQWW  508



>gb|KHN40685.1| hypothetical protein glysoja_001183 [Glycine soja]
Length=277

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+ TV   D+VVMK + E         +++   ICL+DE+FLEC  ++W+    G+
Sbjct  188  FANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLIKTGAICLIDEIFLECHYNRWQRCCPGQ  247

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  248  RSAKYEKTYDQCLQLFKSLRQSGVLVHQWF  277



>ref|XP_010921054.1| PREDICTED: uncharacterized protein LOC105044755 [Elaeis guineensis]
Length=523

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 11/107 (10%)
 Frame = -3

Query  505  DSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDE  353
             SE   +GE         + WL+++V + D+VVMK + E         +     ICL+DE
Sbjct  417  PSEGVSSGEVHTIHGFDFAEWLKSSVSEKDFVVMKMDVEGTEFDLVPRLFETGAICLIDE  476

Query  352  LFLECK-SQWeegeggeENQRQR-AYWQCLELHGRLREEGVAVHQWW  218
            LFLEC  ++W+    G    + R  Y +CL L   LR+ GV VHQWW
Sbjct  477  LFLECHYNRWQRCCPGVRTPKYRNTYGECLNLFTSLRKSGVLVHQWW  523



>gb|AGV54215.1| hypothetical protein [Phaseolus vulgaris]
Length=504

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             + WL+ TV   D+VVMK + E         + +   ICL+DE+FLEC  ++W+    G+
Sbjct  415  FAEWLKKTVTKNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  474

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  475  RSSKYEKTYDQCLQLFNSLRQSGVLVHQWW  504



>ref|XP_003537325.1| PREDICTED: uncharacterized protein LOC100788611 [Glycine max]
Length=493

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DELFLEC  ++W+    G+ + +  + Y QCL+L   LR  GV VHQWW
Sbjct  440  AICLIDELFLECHYNRWQRCCPGQRSAKYHKTYSQCLDLFTSLRNYGVLVHQWW  493



>gb|KHN22782.1| hypothetical protein glysoja_026750, partial [Glycine soja]
Length=328

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DELFLEC  ++W+    G+ + +  + Y QCL+L   LR  GV VHQWW
Sbjct  275  AICLIDELFLECHYNRWQRCCPGQRSAKYHKTYSQCLDLFTSLRNYGVLVHQWW  328



>gb|KHN41361.1| hypothetical protein glysoja_047806 [Glycine soja]
Length=201

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+ TV   D+VVMK + E         +++   ICL+D++FLEC  ++W+    G+
Sbjct  112  FANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLIKTGAICLIDDIFLECHYNRWQRCCPGQ  171

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  172  RSAKYEKTYDQCLQLFKSLRQSGVLVHQWF  201



>ref|XP_009606489.1| PREDICTED: uncharacterized protein LOC104100844 isoform X2 [Nicotiana 
tomentosiformis]
Length=494

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQW  221
             ICL+DELFLEC  ++W+    G+ + +  + Y +CLEL   LRE GV VHQW
Sbjct  442  AICLIDELFLECHYNRWQRCCPGKRSPKYDKTYAECLELFSSLRERGVLVHQW  494



>ref|XP_006376546.1| hypothetical protein POPTR_0013s14950g [Populus trichocarpa]
 gb|ERP54343.1| hypothetical protein POPTR_0013s14950g [Populus trichocarpa]
Length=471

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DELFLEC  ++W+    G+   + Q+ Y QCL+L   LR+ GV VHQWW
Sbjct  418  AICLIDELFLECHYNRWQRCCPGQRGVKYQKTYDQCLQLLNSLRKIGVLVHQWW  471



>ref|XP_008804157.1| PREDICTED: uncharacterized protein LOC103717510 [Phoenix dactylifera]
 ref|XP_008804158.1| PREDICTED: uncharacterized protein LOC103717510 [Phoenix dactylifera]
Length=523

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 11/107 (10%)
 Frame = -3

Query  505  DSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDE  353
             SE   +GE         + WL+ TV D D+VVMK + E         +     I L+DE
Sbjct  417  PSEGVSSGELHTIHGFDFAEWLKRTVSDKDFVVMKMDVEGTEFDLVPRLFETGVISLIDE  476

Query  352  LFLECK-SQWeegeggeENQRQR-AYWQCLELHGRLREEGVAVHQWW  218
            LFLEC  ++W+    GE   + R  Y +CL L   LR+ GV VHQWW
Sbjct  477  LFLECHYNRWQRCCPGERTPKYRNTYGECLRLFTSLRKSGVLVHQWW  523



>ref|XP_004497494.1| PREDICTED: uncharacterized protein LOC101500848 [Cicer arietinum]
Length=479

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 52/108 (48%), Gaps = 16/108 (15%)
 Frame = -3

Query  520  DVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvr------eRTICLV  359
            D K ED E    GEE   L  W + TV++AD+VV+K       EM           IC +
Sbjct  376  DFKHEDIEHY-MGEEDFDLVAWFKETVENADFVVLKMNIAGKVEMKFLRDIYESGVICFI  434

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  215
            DELFL C            ++R R    C++++  LR  GV VHQWW+
Sbjct  435  DELFLGCSESGGAE-----SERGR----CMDIYKGLRSNGVFVHQWWN  473



>ref|XP_010099438.1| hypothetical protein L484_011136 [Morus notabilis]
 gb|EXB78513.1| hypothetical protein L484_011136 [Morus notabilis]
Length=502

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevveemvreRTI-----CLVDELFLECKSQWeegeggeE  302
             ++WL+ TV  +D+VV+K + E  E  +  R I     CLVDELFLEC   +   +    
Sbjct  413  FADWLKKTVSRSDFVVVKMDVEGTEFHLIPRLIKTGAMCLVDELFLEC--HYNRMQRCCP  470

Query  301  NQR----QRAYWQCLELHGRLREEGVAVHQWW  218
             +R    ++ Y QCL+L   +RE GV VHQWW
Sbjct  471  GERSVKYEKTYDQCLDLLKLIRESGVLVHQWW  502



>gb|KEH28818.1| methyltransferase domain protein [Medicago truncatula]
Length=509

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICLVDE+FLEC  ++W+    G+ + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  456  AICLVDEIFLECHYNRWQRCCPGQRSPKYEKTYDQCLQLFNSLRQSGVLVHQWF  509



>gb|KHN19114.1| hypothetical protein glysoja_036230 [Glycine soja]
Length=134

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+ TV   D+VVMK + E         +++   ICL+D++FLEC  ++W+    G+
Sbjct  45   FANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLIKTGAICLIDDIFLECHYNRWQRCCPGQ  104

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y  CL+L   LR+ GV VHQW+
Sbjct  105  RSAKYEKTYDPCLQLFKSLRQSGVLVHQWF  134



>gb|KJB78695.1| hypothetical protein B456_013G013000 [Gossypium raimondii]
Length=489

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             ICL+DE+FLEC  ++W+    G+ + + ++ Y  CLEL   LR+ GV VHQWW
Sbjct  436  AICLIDEIFLECHYNRWQRCCPGQRSTKYKKHYRHCLELFTSLRKNGVLVHQWW  489



>gb|KHN29556.1| hypothetical protein glysoja_005280 [Glycine soja]
Length=278

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  466  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECK-SQWeegegge  305
             +NWL+  V   D+VVMK + E         +++   ICL+DE+FLEC  ++W+    G+
Sbjct  189  FANWLKKMVSKNDFVVMKMDVEGTEFDLIPRLIKTGAICLIDEIFLECHYNRWQRCCPGQ  248

Query  304  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  249  RSSKYEKTYDQCLQLFNSLRQSGVLVHQWF  278



>ref|XP_010686186.1| PREDICTED: uncharacterized protein LOC104900468 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  373  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  218
             +CL+DE+FLEC  ++W++   G  + +  + Y QCL L   LRE GV VHQWW
Sbjct  431  ALCLIDEIFLECHYNRWQKCCPGVRSPKYDKTYDQCLNLLSSLRERGVVVHQWW  484



>ref|XP_008243928.1| PREDICTED: uncharacterized protein LOC103342124 [Prunus mume]
Length=487

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 13/107 (12%)
 Frame = -3

Query  523  IDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea-----evveemvreRTICLV  359
            ++V  +   E   G+E      W + TV+ AD+VV+K  A     + + E+     IC V
Sbjct  380  VNVTTDGETEPYVGDEGFDFHAWFKETVQFADFVVLKMNAGNVELKFLAELFESGAICFV  439

Query  358  DELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  218
            DELFL C S  + G     +        C+++   LR  GV VHQWW
Sbjct  440  DELFLHCSSSVDAGGAMPVD--------CMDIFRSLRSSGVFVHQWW  478



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400