BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050P23

Length=559
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611065.1|  PREDICTED: guanine nucleotide-binding protei...    221   1e-67   Nicotiana tomentosiformis
ref|XP_006341557.1|  PREDICTED: guanine nucleotide-binding protei...    219   7e-67   
ref|XP_009780116.1|  PREDICTED: guanine nucleotide-binding protei...    218   2e-66   Nicotiana sylvestris
gb|EYU40229.1|  hypothetical protein MIMGU_mgv1a008949mg                218   6e-66   Erythranthe guttata [common monkey flower]
ref|XP_009776114.1|  PREDICTED: guanine nucleotide-binding protei...    216   7e-66   Nicotiana sylvestris
emb|CAA96528.1|  G protein beta-subunit-like protein                    216   7e-66   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABB02625.1|  G protein beta subunit-like protein                     214   1e-65   Solanum tuberosum [potatoes]
ref|XP_004252270.1|  PREDICTED: guanine nucleotide-binding protei...    216   1e-65   Solanum lycopersicum
ref|XP_006353816.1|  PREDICTED: guanine nucleotide-binding protei...    216   1e-65   Solanum tuberosum [potatoes]
ref|XP_009600162.1|  PREDICTED: guanine nucleotide-binding protei...    216   1e-65   Nicotiana tomentosiformis
gb|ABB86277.1|  ArcA2 protein-like                                      216   2e-65   Solanum tuberosum [potatoes]
gb|EYU17645.1|  hypothetical protein MIMGU_mgv1a009858mg                215   2e-65   Erythranthe guttata [common monkey flower]
emb|CDO98381.1|  unnamed protein product                                228   3e-65   Coffea canephora [robusta coffee]
ref|NP_001233881.1|  ArcA2 protein                                      214   4e-65   
ref|XP_009624187.1|  PREDICTED: guanine nucleotide-binding protei...    214   4e-65   Nicotiana tomentosiformis
gb|AJE63428.1|  transcription factor ArcA1                              214   6e-65   Capsicum annuum
ref|XP_009778426.1|  PREDICTED: guanine nucleotide-binding protei...    213   2e-64   Nicotiana sylvestris
gb|ACR77528.1|  heterotrimeric G protein beta 1 subunit                 211   5e-64   Nicotiana benthamiana
sp|P49026.1|GBLP_TOBAC  RecName: Full=Guanine nucleotide-binding ...    211   5e-64   Nicotiana tabacum [American tobacco]
ref|XP_011072970.1|  PREDICTED: guanine nucleotide-binding protei...    211   6e-64   Sesamum indicum [beniseed]
sp|P93340.1|GBLP_NICPL  RecName: Full=Guanine nucleotide-binding ...    211   7e-64   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|EPS70887.1|  hypothetical protein M569_03871                         211   1e-63   Genlisea aurea
ref|XP_006365404.1|  PREDICTED: guanine nucleotide-binding protei...    210   2e-63   Solanum tuberosum [potatoes]
ref|NP_001233876.1|  ArcA1 protein                                      209   4e-63   
ref|XP_003631071.1|  Guanine nucleotide-binding protein subunit b...    206   5e-62   Medicago truncatula
sp|O24076.1|GBLP_MEDSA  RecName: Full=Guanine nucleotide-binding ...    206   6e-62   Medicago sativa [alfalfa]
gb|KHN21658.1|  Guanine nucleotide-binding protein subunit beta-l...    202   9e-62   Glycine soja [wild soybean]
gb|KJB37175.1|  hypothetical protein B456_006G192600                    205   1e-61   Gossypium raimondii
ref|XP_010537487.1|  PREDICTED: guanine nucleotide-binding protei...    205   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_004299548.1|  PREDICTED: guanine nucleotide-binding protei...    205   2e-61   Fragaria vesca subsp. vesca
gb|KHG00880.1|  Guanine nucleotide-binding protein subunit beta-l...    205   2e-61   Gossypium arboreum [tree cotton]
ref|XP_010097592.1|  Guanine nucleotide-binding protein subunit b...    205   2e-61   Morus notabilis
gb|KHG17882.1|  Guanine nucleotide-binding protein subunit beta-l...    205   2e-61   Gossypium arboreum [tree cotton]
gb|KHN00175.1|  Guanine nucleotide-binding protein subunit beta-l...    201   2e-61   Glycine soja [wild soybean]
gb|KJB53022.1|  hypothetical protein B456_008G288800                    204   3e-61   Gossypium raimondii
ref|XP_002894122.1|  hypothetical protein ARALYDRAFT_474002             204   4e-61   
gb|AFK36580.1|  unknown                                                 204   5e-61   Medicago truncatula
ref|XP_007036696.1|  Transducin/WD40 repeat-like superfamily protein    204   6e-61   Theobroma cacao [chocolate]
ref|XP_004137327.1|  PREDICTED: guanine nucleotide-binding protei...    204   7e-61   Cucumis sativus [cucumbers]
ref|XP_008453452.1|  PREDICTED: guanine nucleotide-binding protei...    203   7e-61   Cucumis melo [Oriental melon]
ref|XP_010540016.1|  PREDICTED: guanine nucleotide-binding protei...    203   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_009117627.1|  PREDICTED: guanine nucleotide-binding protei...    203   1e-60   Brassica rapa
ref|NP_001241455.1|  uncharacterized protein LOC100778205               202   1e-60   Glycine max [soybeans]
ref|XP_009110365.1|  PREDICTED: guanine nucleotide-binding protei...    202   2e-60   Brassica rapa
ref|XP_010549077.1|  PREDICTED: guanine nucleotide-binding protei...    202   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_010549078.1|  PREDICTED: guanine nucleotide-binding protei...    202   2e-60   Tarenaya hassleriana [spider flower]
ref|NP_188441.1|  receptor for activated C kinase 1C                    202   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890259.1|  hypothetical protein ARALYDRAFT_889221             202   2e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_010506450.1|  PREDICTED: guanine nucleotide-binding protei...    202   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006393380.1|  hypothetical protein EUTSA_v10011646mg             202   3e-60   Eutrema salsugineum [saltwater cress]
gb|KFK39137.1|  guanine nucleotide-binding protein subunit beta-l...    202   3e-60   Arabis alpina [alpine rockcress]
ref|XP_006297909.1|  hypothetical protein CARUB_v10013951mg             203   3e-60   
ref|XP_006416642.1|  hypothetical protein EUTSA_v10008183mg             202   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_007160506.1|  hypothetical protein PHAVU_002G327500g             202   4e-60   Phaseolus vulgaris [French bean]
gb|ACJ24167.1|  Rack                                                    202   4e-60   Phaseolus vulgaris [French bean]
ref|XP_010465892.1|  PREDICTED: guanine nucleotide-binding protei...    201   4e-60   Camelina sativa [gold-of-pleasure]
gb|AGV54321.1|  RACK1                                                   201   5e-60   Phaseolus vulgaris [French bean]
ref|XP_009149259.1|  PREDICTED: guanine nucleotide-binding protei...    201   6e-60   Brassica rapa
gb|AAB82647.1|  WD-40 repeat protein                                    201   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305339.1|  hypothetical protein CARUB_v10009720mg             201   7e-60   Capsella rubella
emb|CDY64888.1|  BnaC06g40840D                                          200   7e-60   Brassica napus [oilseed rape]
ref|XP_002529557.1|  receptor for activated protein kinase C, put...    201   7e-60   Ricinus communis
ref|NP_173248.1|  guanine nucleotide-binding protein subunit beta...    201   7e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406649.1|  hypothetical protein EUTSA_v10021128mg             201   7e-60   Eutrema salsugineum [saltwater cress]
gb|KFK43977.1|  guanine nucleotide-binding protein subunit beta-l...    201   9e-60   Arabis alpina [alpine rockcress]
ref|XP_010487724.1|  PREDICTED: guanine nucleotide-binding protei...    200   2e-59   Camelina sativa [gold-of-pleasure]
gb|KHG29145.1|  Guanine nucleotide-binding protein subunit beta-l...    200   2e-59   Gossypium arboreum [tree cotton]
ref|XP_006305354.1|  hypothetical protein CARUB_v10009733mg             200   2e-59   Capsella rubella
ref|NP_001235369.1|  guanine nucleotide-binding protein subunit b...    200   2e-59   Glycine max [soybeans]
gb|KJB08186.1|  hypothetical protein B456_001G069800                    200   2e-59   Gossypium raimondii
ref|XP_002885240.1|  guanine nucleotide-binding family protein          200   2e-59   Arabidopsis lyrata subsp. lyrata
emb|CDY59680.1|  BnaA05g36460D                                          197   2e-59   Brassica napus [oilseed rape]
sp|Q39336.1|GBLP_BRANA  RecName: Full=Guanine nucleotide-binding ...    200   2e-59   Brassica napus [oilseed rape]
ref|XP_010032559.1|  PREDICTED: guanine nucleotide-binding protei...    199   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010498185.1|  PREDICTED: guanine nucleotide-binding protei...    199   3e-59   Camelina sativa [gold-of-pleasure]
ref|NP_175296.1|  receptor for activated C kinase 1B                    199   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476972.1|  PREDICTED: guanine nucleotide-binding protei...    199   4e-59   Camelina sativa [gold-of-pleasure]
gb|KDP37901.1|  hypothetical protein JCGZ_05340                         199   5e-59   Jatropha curcas
ref|XP_010551145.1|  PREDICTED: guanine nucleotide-binding protei...    198   7e-59   Tarenaya hassleriana [spider flower]
ref|XP_009147950.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    198   1e-58   Brassica rapa
ref|XP_002281279.1|  PREDICTED: guanine nucleotide-binding protei...    198   1e-58   Vitis vinifera
ref|XP_010036939.1|  PREDICTED: guanine nucleotide-binding protei...    197   1e-58   Eucalyptus grandis [rose gum]
ref|XP_006451669.1|  hypothetical protein CICLE_v10008909mg             197   1e-58   Citrus clementina [clementine]
emb|CDY71917.1|  BnaCnng75080D                                          195   2e-58   Brassica napus [oilseed rape]
gb|KDO62873.1|  hypothetical protein CISIN_1g048118mg                   197   2e-58   Citrus sinensis [apfelsine]
ref|XP_009145001.1|  PREDICTED: guanine nucleotide-binding protei...    197   2e-58   Brassica rapa
ref|XP_008374821.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    197   2e-58   Malus domestica [apple tree]
ref|XP_009360100.1|  PREDICTED: guanine nucleotide-binding protei...    197   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_008393404.1|  PREDICTED: guanine nucleotide-binding protei...    197   2e-58   Malus domestica [apple tree]
ref|XP_008240184.1|  PREDICTED: guanine nucleotide-binding protei...    197   3e-58   Prunus mume [ume]
gb|AAM65407.1|  guanine nucleotide-binding protein, putative            197   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209348.1|  hypothetical protein PRUPE_ppa008536mg             197   3e-58   Prunus persica
ref|XP_010678120.1|  PREDICTED: guanine nucleotide-binding protei...    197   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010500401.1|  PREDICTED: guanine nucleotide-binding protei...    197   3e-58   Camelina sativa [gold-of-pleasure]
emb|CDY18497.1|  BnaA01g26980D                                          196   5e-58   Brassica napus [oilseed rape]
ref|XP_009113515.1|  PREDICTED: guanine nucleotide-binding protei...    196   5e-58   Brassica rapa
emb|CDX95554.1|  BnaC01g34460D                                          196   5e-58   
ref|XP_010479287.1|  PREDICTED: guanine nucleotide-binding protei...    195   1e-57   Camelina sativa [gold-of-pleasure]
emb|CDY44104.1|  BnaA01g13120D                                          194   1e-57   Brassica napus [oilseed rape]
ref|XP_010461692.1|  PREDICTED: guanine nucleotide-binding protei...    195   1e-57   Camelina sativa [gold-of-pleasure]
pdb|3DM0|A  Chain A, Maltose Binding Protein Fusion With Rack1 Fr...    202   1e-57   Escherichia coli K-12
emb|CAA06154.1|  arcA 3                                                 194   2e-57   Nicotiana tabacum [American tobacco]
ref|XP_011039103.1|  PREDICTED: guanine nucleotide-binding protei...    194   3e-57   Populus euphratica
ref|XP_002318528.1|  GTP-binding protein beta chain                     194   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011039104.1|  PREDICTED: guanine nucleotide-binding protei...    194   5e-57   Populus euphratica
ref|XP_009145932.1|  PREDICTED: guanine nucleotide-binding protei...    193   6e-57   Brassica rapa
emb|CDX95784.1|  BnaC05g35350D                                          193   6e-57   
emb|CDX92200.1|  BnaA05g22070D                                          193   6e-57   
gb|KFK36075.1|  hypothetical protein AALP_AA4G074100                    188   3e-56   Arabis alpina [alpine rockcress]
ref|XP_011000479.1|  PREDICTED: guanine nucleotide-binding protei...    189   4e-55   Populus euphratica
ref|XP_002321505.1|  GTP-binding protein beta chain                     186   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_004503304.1|  PREDICTED: guanine nucleotide-binding protei...    183   3e-53   Cicer arietinum [garbanzo]
ref|XP_010256121.1|  PREDICTED: guanine nucleotide-binding protei...    180   4e-52   Nelumbo nucifera [Indian lotus]
emb|CAC09579.1|  gbf1 protein                                           179   7e-52   Fagus sylvatica
ref|XP_010243791.1|  PREDICTED: guanine nucleotide-binding protei...    180   7e-52   Nelumbo nucifera [Indian lotus]
ref|XP_011084467.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    179   2e-51   Sesamum indicum [beniseed]
ref|XP_010916329.1|  PREDICTED: guanine nucleotide-binding protei...    178   4e-51   Elaeis guineensis
ref|XP_006837182.1|  hypothetical protein AMTR_s00105p00058690          176   2e-50   Amborella trichopoda
ref|XP_010924141.1|  PREDICTED: guanine nucleotide-binding protei...    176   2e-50   Elaeis guineensis
dbj|BAF47116.1|  G protein beta-subunit-like protein                    171   2e-50   Nicotiana tabacum [American tobacco]
ref|XP_008803271.1|  PREDICTED: guanine nucleotide-binding protei...    176   4e-50   Phoenix dactylifera
ref|XP_010430893.1|  PREDICTED: guanine nucleotide-binding protei...    173   1e-49   
ref|XP_008812615.1|  PREDICTED: guanine nucleotide-binding protei...    174   2e-49   
ref|XP_010495439.1|  PREDICTED: guanine nucleotide-binding protei...    172   5e-49   
ref|XP_010923802.1|  PREDICTED: guanine nucleotide-binding protei...    173   5e-49   Elaeis guineensis
dbj|BAF47119.1|  G protein beta-subunit-like protein                    167   6e-49   Nicotiana tabacum [American tobacco]
ref|XP_009400497.1|  PREDICTED: guanine nucleotide-binding protei...    172   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001136800.1|  guanine nucleotide-binding protein beta subu...    172   1e-48   Zea mays [maize]
ref|XP_009405003.1|  PREDICTED: guanine nucleotide-binding protei...    171   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146976.1|  LOC100280585                                       172   2e-48   Zea mays [maize]
gb|ACL54313.1|  unknown                                                 171   2e-48   Zea mays [maize]
gb|ABK26798.1|  unknown                                                 171   3e-48   Picea sitchensis
ref|XP_009380503.1|  PREDICTED: guanine nucleotide-binding protei...    171   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002440202.1|  hypothetical protein SORBIDRAFT_09g027690          171   5e-48   Sorghum bicolor [broomcorn]
gb|ABR25943.1|  guanine nucleotide-binding protein beta subunit         164   6e-48   Oryza sativa Indica Group [Indian rice]
gb|ABK25010.1|  unknown                                                 169   9e-48   Picea sitchensis
gb|ACN41093.1|  unknown                                                 169   9e-48   Picea sitchensis
ref|XP_001698065.1|  receptor of activated protein kinase C 1           167   4e-47   Chlamydomonas reinhardtii
ref|XP_004961307.1|  PREDICTED: guanine nucleotide-binding protei...    166   2e-46   Setaria italica
gb|AFV60006.1|  heterotrimeric guanine nucleotide-binding protein...    166   2e-46   Eschscholzia californica
ref|XP_006644561.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    165   4e-46   Oryza brachyantha
gb|EMS52917.1|  Guanine nucleotide-binding protein subunit beta-l...    166   6e-46   Triticum urartu
ref|XP_002945887.1|  hypothetical protein VOLCADRAFT_78914              164   6e-46   Volvox carteri f. nagariensis
ref|XP_001754916.1|  predicted protein                                  164   8e-46   
ref|NP_001043910.1|  Os01g0686800                                       164   9e-46   
ref|XP_004969582.1|  PREDICTED: guanine nucleotide-binding protei...    164   1e-45   Setaria italica
ref|XP_001780288.1|  predicted protein                                  164   1e-45   
ref|XP_001779496.1|  predicted protein                                  164   1e-45   
dbj|BAJ90663.1|  predicted protein                                      164   1e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005847990.1|  hypothetical protein CHLNCDRAFT_31033              164   1e-45   Chlorella variabilis
gb|AEF79971.1|  receptor of activated protein kinase C 1                163   3e-45   Dunaliella salina
gb|EMT00770.1|  hypothetical protein F775_19376                         167   4e-45   
ref|XP_003567944.1|  PREDICTED: guanine nucleotide-binding protei...    162   7e-45   Brachypodium distachyon [annual false brome]
gb|AEO44580.1|  receptor for activated C kinase 1                       160   2e-44   Dunaliella salina
gb|EEC79656.1|  hypothetical protein OsI_20897                          160   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_003569582.1|  PREDICTED: guanine nucleotide-binding protei...    160   3e-44   Brachypodium distachyon [annual false brome]
ref|XP_004252271.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-44   Solanum lycopersicum
ref|NP_001056254.1|  Os05g0552300                                       160   5e-44   
gb|KDD72035.1|  hypothetical protein H632_c3969p0                       157   1e-43   Helicosporidium sp. ATCC 50920
emb|CEG00110.1|  G-protein beta WD-40 repeat                            157   3e-43   Ostreococcus tauri
ref|XP_001421096.1|  Receptor of activated protein kinase C 1A, c...    157   3e-43   Ostreococcus lucimarinus CCE9901
ref|XP_006654750.1|  PREDICTED: guanine nucleotide-binding protei...    157   5e-43   Oryza brachyantha
dbj|BAJ98167.1|  predicted protein                                      157   7e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003082627.1|  GTP-binding regulatory protein beta chain ho...    159   1e-42   
emb|CDM83867.1|  unnamed protein product                                156   1e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002456166.1|  hypothetical protein SORBIDRAFT_03g031520          155   2e-42   Sorghum bicolor [broomcorn]
ref|XP_003060952.1|  predicted protein                                  154   8e-42   Micromonas pusilla CCMP1545
ref|XP_008811978.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    154   9e-42   Phoenix dactylifera
ref|XP_005711409.1|  receptor for activated protein kinase C            153   1e-41   Chondrus crispus [carageen]
ref|XP_002502835.1|  predicted protein                                  153   1e-41   Micromonas commoda
ref|XP_005652002.1|  WD40 repeat-like protein                           152   2e-41   Coccomyxa subellipsoidea C-169
gb|KIY98327.1|  Guanine nucleotide-binding protein subunit beta-l...    152   4e-41   Monoraphidium neglectum
ref|XP_002967499.1|  hypothetical protein SELMODRAFT_144795             151   7e-41   Selaginella moellendorffii
dbj|GAN11178.1|  hypothetical protein MAM1_0495d10736                   145   2e-40   Mucor ambiguus
ref|XP_002960209.1|  hypothetical protein SELMODRAFT_266532             147   1e-39   
emb|CEG76293.1|  Putative Guanine nucleotide-binding protein subu...    146   3e-39   Rhizopus microsporus
ref|XP_011397272.1|  Guanine nucleotide-binding protein subunit b...    147   4e-39   Auxenochlorella protothecoides
emb|CCI48432.1|  unnamed protein product                                147   4e-39   Albugo candida
dbj|GAN10996.1|  guanine nucleotide-binding protein                     145   5e-39   Mucor ambiguus
emb|CCA26420.1|  guanine nucleotidebinding protein subunit beta2l...    146   5e-39   Albugo laibachii Nc14
ref|XP_006679085.1|  hypothetical protein BATDEDRAFT_33248              145   9e-39   Batrachochytrium dendrobatidis JAM81
emb|CEG67117.1|  Putative Guanine nucleotide-binding protein subu...    145   1e-38   Rhizopus microsporus
gb|EIE78732.1|  guanine nucleotide-binding protein subunit beta-2...    145   1e-38   Rhizopus delemar RA 99-880
ref|XP_007508318.1|  predicted protein                                  145   1e-38   Bathycoccus prasinos
ref|XP_006875415.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-38   Chrysochloris asiatica
ref|XP_002903189.1|  guanine nucleotide-binding protein subunit b...    144   2e-38   Phytophthora infestans T30-4
ref|XP_004343796.1|  guanine nucleotide-binding protein                 144   3e-38   Capsaspora owczarzaki ATCC 30864
ref|XP_004696065.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    143   3e-38   
gb|ETM44908.1|  guanine nucleotide-binding protein subunit beta-l...    144   4e-38   Phytophthora parasitica
gb|EDL33790.1|  guanine nucleotide binding protein (G protein), b...    141   5e-38   Mus musculus [mouse]
gb|EPB90862.1|  guanine nucleotide-binding protein subunit beta-2...    144   5e-38   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009531042.1|  hypothetical protein PHYSODRAFT_355000             144   5e-38   Phytophthora sojae
ref|XP_007527211.1|  PREDICTED: guanine nucleotide-binding protei...    142   5e-38   Erinaceus europaeus [common hedgehog]
ref|XP_005977784.1|  PREDICTED: guanine nucleotide-binding protei...    142   5e-38   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005891160.1|  PREDICTED: guanine nucleotide-binding protei...    142   6e-38   Bos mutus
gb|AAR24619.1|  proliferation-inducing gene 21                          142   6e-38   Homo sapiens [man]
gb|EAW53697.1|  guanine nucleotide binding protein (G protein), b...    141   6e-38   Homo sapiens [man]
gb|ERE68979.1|  guanine nucleotide-binding protein subunit beta-2...    141   6e-38   Cricetulus griseus [Chinese hamsters]
ref|XP_009576203.1|  PREDICTED: guanine nucleotide-binding protei...    141   6e-38   Fulmarus glacialis
ref|XP_006746631.1|  PREDICTED: guanine nucleotide-binding protei...    142   6e-38   Leptonychotes weddellii
gb|KDO24030.1|  guanine nucleotide-binding protein subunit beta-2...    141   6e-38   Saprolegnia parasitica CBS 223.65
gb|ELK03178.1|  Guanine nucleotide-binding protein subunit beta-2...    142   6e-38   Pteropus alecto
gb|KFM07186.1|  Guanine nucleotide-binding protein subunit beta-2...    141   6e-38   Aptenodytes forsteri
ref|XP_009277073.1|  PREDICTED: guanine nucleotide-binding protei...    141   7e-38   
gb|EWM27643.1|  guanine nucleotide binding protein                      143   7e-38   Nannochloropsis gaditana
emb|CEP08121.1|  hypothetical protein                                   143   7e-38   Parasitella parasitica
gb|ABY75292.1|  putative guanine nucleotide binding protein beta ...    141   7e-38   Ovis aries [domestic sheep]
gb|EPQ05298.1|  Guanine nucleotide-binding protein subunit beta-2...    142   7e-38   Myotis brandtii
emb|CEP13972.1|  hypothetical protein                                   143   7e-38   Parasitella parasitica
ref|XP_004657524.1|  PREDICTED: guanine nucleotide-binding protei...    142   7e-38   Jaculus jaculus
dbj|BAE39095.1|  unnamed protein product                                141   8e-38   Mus musculus [mouse]
ref|XP_009037831.1|  hypothetical protein AURANDRAFT_37768              143   9e-38   Aureococcus anophagefferens
ref|XP_008063710.1|  PREDICTED: guanine nucleotide-binding protei...    142   9e-38   Carlito syrichta
ref|XP_009665514.1|  PREDICTED: guanine nucleotide-binding protei...    139   1e-37   Struthio camelus australis
dbj|BAG53102.1|  unnamed protein product                                142   1e-37   Homo sapiens [man]
ref|XP_002804718.1|  PREDICTED: guanine nucleotide-binding protei...    142   1e-37   
gb|EPB88453.1|  guanine nucleotide-binding protein subunit beta-2...    143   1e-37   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005989393.1|  PREDICTED: guanine nucleotide-binding protei...    142   1e-37   Latimeria chalumnae
gb|KHN44614.1|  Guanine nucleotide-binding protein subunit beta-l...    142   1e-37   Glycine soja [wild soybean]
gb|KFW73927.1|  Guanine nucleotide-binding protein subunit beta-2...    142   1e-37   Phalacrocorax carbo [common cormorant]
ref|XP_004586327.1|  PREDICTED: guanine nucleotide-binding protei...    142   1e-37   Ochotona princeps [southern American pika]
ref|XP_009805348.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    142   1e-37   Gavia stellata
ref|XP_003530054.1|  PREDICTED: guanine nucleotide-binding protei...    143   1e-37   Glycine max [soybeans]
ref|XP_006147504.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   
ref|XP_005062497.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   Ficedula albicollis
ref|XP_009080129.1|  PREDICTED: guanine nucleotide-binding protei...    140   2e-37   Acanthisitta chloris
ref|XP_009513424.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   Phalacrocorax carbo [common cormorant]
gb|KFP61115.1|  Guanine nucleotide-binding protein subunit beta-2...    142   2e-37   Cariama cristata
ref|XP_008325350.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002286095.1|  guanine nucleotide binding protein beta subu...    142   2e-37   Thalassiosira pseudonana CCMP1335
ref|XP_009922131.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   Haliaeetus albicilla
ref|XP_009701898.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   Cariama cristata
gb|KFQ96249.1|  Guanine nucleotide-binding protein subunit beta-2...    142   2e-37   Nipponia nippon
ref|XP_005795376.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   Xiphophorus maculatus
ref|XP_009462428.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   Nipponia nippon
ref|XP_005018374.1|  PREDICTED: guanine nucleotide-binding protei...    143   2e-37   
gb|KFQ66729.1|  Guanine nucleotide-binding protein subunit beta-2...    141   2e-37   Pelecanus crispus
ref|XP_010223334.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   Tinamus guttatus
gb|KFP96911.1|  Guanine nucleotide-binding protein subunit beta-2...    141   2e-37   Haliaeetus albicilla
ref|XP_009448630.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   
gb|KFQ89059.1|  Guanine nucleotide-binding protein subunit beta-2...    141   2e-37   Phoenicopterus ruber ruber
ref|XP_007070338.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   
gb|EDL33792.1|  guanine nucleotide binding protein (G protein), b...    141   2e-37   Mus musculus [mouse]
dbj|BAB28114.1|  unnamed protein product                                141   2e-37   Mus musculus [mouse]
gb|KGL84405.1|  Guanine nucleotide-binding protein subunit beta-2...    141   2e-37   Tinamus guttatus
ref|XP_005234127.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    142   2e-37   Falco peregrinus [peregrine]
gb|KFO08948.1|  Guanine nucleotide-binding protein subunit beta-2...    141   2e-37   Balearica regulorum gibbericeps
ref|XP_010296751.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   Balearica regulorum gibbericeps
ref|XP_009995617.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   Chaetura pelagica
gb|EAW53699.1|  guanine nucleotide binding protein (G protein), b...    143   2e-37   Homo sapiens [man]
gb|KFQ99079.1|  Guanine nucleotide-binding protein subunit beta-2...    141   2e-37   Opisthocomus hoazin [hoatzin]
ref|XP_009489930.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   Pelecanus crispus
ref|XP_009983622.1|  PREDICTED: guanine nucleotide-binding protei...    141   2e-37   Tauraco erythrolophus
gb|EHB05258.1|  Guanine nucleotide-binding protein subunit beta-2...    142   2e-37   Heterocephalus glaber [naked mole rat]
ref|XP_006037851.1|  PREDICTED: guanine nucleotide-binding protei...    142   2e-37   
gb|KFO20808.1|  Guanine nucleotide-binding protein subunit beta-2...    142   2e-37   Fukomys damarensis [Damara mole rat]
dbj|BAE40059.1|  unnamed protein product                                142   3e-37   Mus musculus [mouse]
gb|AAI02287.2|  GNB2L1 protein                                          142   3e-37   Bos taurus [bovine]
gb|KFP58388.1|  Guanine nucleotide-binding protein subunit beta-2...    141   3e-37   Cathartes aura
gb|AAP04406.1|  G-protein beta subunit like-protein                     142   3e-37   Oryctolagus cuniculus [domestic rabbit]
dbj|BAE40068.1|  unnamed protein product                                142   3e-37   Mus musculus [mouse]
ref|NP_006089.1|  guanine nucleotide-binding protein subunit beta...    142   3e-37   Homo sapiens [man]
ref|XP_006270088.1|  PREDICTED: guanine nucleotide-binding protei...    142   3e-37   
ref|XP_009329421.1|  PREDICTED: guanine nucleotide-binding protei...    141   3e-37   Pygoscelis adeliae
gb|AAP36938.1|  Homo sapiens guanine nucleotide binding protein (...    142   3e-37   synthetic construct
ref|XP_010291551.1|  PREDICTED: guanine nucleotide-binding protei...    142   3e-37   Phaethon lepturus
ref|XP_004387229.1|  PREDICTED: guanine nucleotide-binding protei...    142   3e-37   Trichechus manatus latirostris
gb|AAW82329.1|  guanine nucleotide binding 12.3                         142   3e-37   Gallus gallus [bantam]
ref|XP_005435183.1|  PREDICTED: guanine nucleotide-binding protei...    142   3e-37   Falco cherrug
ref|XP_007431363.1|  PREDICTED: guanine nucleotide-binding protei...    142   3e-37   Python bivittatus
ref|XP_005658294.1|  PREDICTED: guanine nucleotide binding protei...    142   3e-37   
gb|KFQ81036.1|  Guanine nucleotide-binding protein subunit beta-2...    141   3e-37   Phaethon lepturus
ref|XP_004073369.1|  PREDICTED: guanine nucleotide-binding protei...    142   3e-37   Oryzias latipes [Japanese rice fish]
ref|XP_009931788.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    142   3e-37   Opisthocomus hoazin [hoatzin]
ref|NP_571519.1|  guanine nucleotide-binding protein subunit beta...    142   3e-37   Danio rerio [leopard danio]
ref|XP_009836542.1|  guanine nucleotide-binding protein subunit b...    142   3e-37   Aphanomyces astaci
ref|XP_004540947.1|  PREDICTED: guanine nucleotide-binding protei...    142   3e-37   Maylandia zebra
gb|EPY85923.1|  guanine nucleotide binding protein, beta polypept...    142   3e-37   Camelus ferus
ref|XP_010391434.1|  PREDICTED: guanine nucleotide-binding protei...    140   3e-37   
ref|NP_001266445.1|  guanine nucleotide-binding protein subunit b...    142   4e-37   
pdb|4AOW|A  Chain A, Crystal Structure Of The Human Rack1 Protein...    142   4e-37   
gb|EJT47727.1|  G protein beta subunit-like protein Rkp1                141   4e-37   
gb|EIE91439.1|  guanine nucleotide-binding protein subunit beta-l...    141   4e-37   
gb|KFO58265.1|  Guanine nucleotide-binding protein subunit beta-2...    140   4e-37   
gb|KFO76552.1|  Guanine nucleotide-binding protein subunit beta-2...    142   4e-37   
gb|KFW72146.1|  Guanine nucleotide-binding protein subunit beta-2...    141   4e-37   
ref|NP_001004946.1|  guanine nucleotide binding protein (G protei...    141   4e-37   
ref|NP_001086465.1|  uncharacterized protein LOC446289                  141   4e-37   
ref|XP_008630825.1|  PREDICTED: guanine nucleotide-binding protei...    140   4e-37   
gb|AAD42045.1|AF105259_1  activated protein kinase C receptor           141   4e-37   
ref|XP_005534099.1|  PREDICTED: guanine nucleotide-binding protei...    141   4e-37   
ref|XP_004468645.1|  PREDICTED: guanine nucleotide-binding protei...    142   4e-37   
gb|AAA18951.1|  protein kinase C receptor                               141   4e-37   
gb|EAW53696.1|  guanine nucleotide binding protein (G protein), b...    142   4e-37   
gb|AAO21313.1|  lung cancer oncogene 7                                  142   4e-37   
gb|ESA03866.1|  hypothetical protein GLOINDRAFT_336518                  141   5e-37   
gb|AAP40018.1|  activated protein kinase C                              136   5e-37   
gb|KDO19117.1|  guanine nucleotide-binding protein subunit beta-2...    141   5e-37   
ref|XP_008608530.1|  guanine nucleotide-binding protein subunit b...    141   5e-37   
ref|XP_008156879.1|  PREDICTED: guanine nucleotide-binding protei...    142   5e-37   
ref|XP_006105825.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    142   5e-37   
gb|EIE76651.1|  guanine nucleotide-binding protein subunit beta-2...    141   5e-37   
ref|XP_008681951.1|  PREDICTED: guanine nucleotide-binding protei...    142   5e-37   
ref|XP_006631768.1|  PREDICTED: guanine nucleotide-binding protei...    141   5e-37   
ref|XP_005862397.1|  PREDICTED: guanine nucleotide-binding protei...    142   5e-37   
gb|ACQ83470.1|  receptor of activated protein kinase C                  141   5e-37   
ref|XP_007244608.1|  PREDICTED: guanine nucleotide-binding protei...    141   6e-37   
gb|ADO27998.1|  guanine nucleotide-binding protein subunit beta-2...    141   6e-37   
ref|XP_006766909.1|  PREDICTED: guanine nucleotide-binding protei...    142   6e-37   
gb|AAI50408.1|  Guanine nucleotide binding protein (G protein), b...    141   6e-37   
ref|XP_008013783.1|  PREDICTED: guanine nucleotide-binding protei...    142   6e-37   
gb|ABX90099.1|  receptor for activated C kinase 1                       141   7e-37   
ref|NP_001187435.1|  guanine nucleotide-binding protein subunit b...    141   7e-37   
gb|ETE60795.1|  Guanine nucleotide-binding protein subunit beta-2...    142   7e-37   
ref|XP_008955153.1|  PREDICTED: guanine nucleotide-binding protei...    142   7e-37   
gb|EAW53694.1|  guanine nucleotide binding protein (G protein), b...    142   7e-37   
ref|XP_008282647.1|  PREDICTED: guanine nucleotide-binding protei...    140   8e-37   
emb|CEG77190.1|  Putative Guanine nucleotide-binding protein subu...    137   9e-37   
ref|XP_007548404.1|  PREDICTED: guanine nucleotide-binding protei...    140   9e-37   
ref|NP_001279416.1|  guanine nucleotide-binding protein subunit b...    140   9e-37   
dbj|BAD96208.1|  guanine nucleotide binding protein (G protein), ...    140   9e-37   
ref|XP_001105066.1|  PREDICTED: guanine nucleotide-binding protei...    142   9e-37   
ref|XP_007899557.1|  PREDICTED: guanine nucleotide-binding protei...    140   9e-37   
ref|XP_003900707.2|  PREDICTED: guanine nucleotide-binding protei...    142   9e-37   
gb|EAW53698.1|  guanine nucleotide binding protein (G protein), b...    142   1e-36   
ref|XP_009884754.1|  PREDICTED: guanine nucleotide-binding protei...    139   1e-36   
gb|ACJ85349.1|  unknown                                                 139   1e-36   
gb|ETI45096.1|  guanine nucleotide-binding protein subunit beta-l...    142   1e-36   
gb|EAW53700.1|  guanine nucleotide binding protein (G protein), b...    142   1e-36   
emb|CDH49812.1|  guanine nucleotide binding protein beta subunit        140   1e-36   
ref|NP_001279371.1|  uncharacterized protein LOC103175775               140   1e-36   
gb|AEW43729.1|  activated protein kinase C receptor                     140   1e-36   
ref|XP_007229955.1|  PREDICTED: guanine nucleotide-binding protei...    140   1e-36   
gb|AAT35603.1|  receptor for activated protein kinase C                 140   1e-36   
ref|XP_007083117.1|  PREDICTED: guanine nucleotide-binding protei...    142   1e-36   
dbj|BAE35378.1|  unnamed protein product                                140   2e-36   
gb|AAX94566.1|  Gpa1 interacting G protein subunit                      137   2e-36   
ref|XP_002834824.3|  PREDICTED: guanine nucleotide-binding protei...    142   2e-36   
ref|XP_002735015.1|  PREDICTED: guanine nucleotide-binding protei...    140   2e-36   
gb|AAF22119.1|AF124742_1  guanine nucleotide-binding protein            139   2e-36   
gb|ACH70647.1|  guanine nucleotide binding protein (G protein) be...    139   2e-36   
gb|AAS49532.1|  guanine nucleotide binding protein beta polypepti...    139   2e-36   
gb|AHG98209.1|  guanine nucleotide-binding protein subunit beta-2...    139   2e-36   
gb|ACQ58047.1|  Guanine nucleotide-binding protein subunit beta-2...    139   2e-36   
ref|NP_001118140.1|  RACK1                                              139   2e-36   
dbj|BAA06185.1|  G protein beta subuit like                             139   2e-36   
gb|AHG98119.1|  guanine nucleotide-binding protein subunit beta-2...    139   2e-36   
gb|AHG98118.1|  guanine nucleotide-binding protein subunit beta-2...    139   2e-36   
gb|AHG98116.1|  guanine nucleotide-binding protein subunit beta-2...    139   2e-36   
ref|XP_008052288.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    139   2e-36   
gb|ABI26262.1|  receptor for activated protein kinase c                 139   3e-36   
ref|XP_006898235.1|  PREDICTED: guanine nucleotide-binding protei...    137   3e-36   
gb|EMP25897.1|  Guanine nucleotide-binding protein subunit beta-2...    144   3e-36   
gb|ACV53651.1|  guanine nucleotide-binding protein beta polypepti...    139   4e-36   
gb|ACJ06767.1|  receptor for activated C-kinase                         139   4e-36   
gb|EGV96576.1|  Guanine nucleotide-binding protein subunit beta-2...    137   5e-36   
ref|XP_005758143.1|  receptor of activated protein kinase C             138   5e-36   
dbj|BAE93065.1|  guanine nucleotide binding protein beta polypept...    138   5e-36   
ref|XP_572317.1|  cytoplasm protein                                     138   6e-36   
ref|NP_001291025.1|  guanine nucleotide binding protein (G protei...    138   6e-36   
gb|EFB24154.1|  hypothetical protein PANDA_021359                       141   6e-36   
ref|XP_007642752.1|  PREDICTED: guanine nucleotide-binding protei...    138   6e-36   
gb|AAM88904.1|  guanine nucleotide-binding protein                      138   6e-36   
emb|CAL48986.1|  Receptor of Activated Kinase C 1                       138   7e-36   
gb|AAS59422.1|  G-protein beta subunit like-protein                     135   7e-36   
gb|ACO09909.1|  Guanine nucleotide-binding protein subunit beta 2...    138   7e-36   
emb|CDX96736.1|  BnaA08g22790D                                          136   8e-36   
ref|XP_010480509.1|  PREDICTED: guanine nucleotide-binding protei...    136   8e-36   
gb|AFK73701.1|  receptor of activated kinase C                          138   8e-36   
gb|KHJ35931.1|  putative guanine nucleotide-binding protein subun...    138   8e-36   
emb|CCQ18636.1|  G protein beta subunit-like protein                    138   8e-36   
ref|XP_011445926.1|  PREDICTED: guanine nucleotide-binding protei...    138   9e-36   
ref|XP_010124278.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    135   9e-36   
gb|AGN75114.1|  receptor for activated C kinase 1                       138   9e-36   
gb|ACU33969.1|  receptor of activated kinase C                          137   1e-35   
emb|CDH49357.1|  guanine nucleotide binding protein beta subunit        137   1e-35   
gb|ELW66848.1|  Guanine nucleotide-binding protein subunit beta-2...    141   1e-35   
emb|CEF67486.1|  Guanine nucleotide-binding protein subunit beta-...    138   1e-35   
ref|XP_003197003.1|  G protein beta subunit-like protein Rkp1           137   1e-35   
emb|CCJ31305.1|  unnamed protein product                                133   1e-35   
ref|XP_010780163.1|  PREDICTED: guanine nucleotide-binding protei...    137   1e-35   
emb|CEJ02996.1|  Putative Guanine nucleotide-binding protein subu...    137   1e-35   
emb|CEG70024.1|  Putative Guanine nucleotide-binding protein subu...    137   1e-35   
gb|ETP42980.1|  guanine nucleotide-binding protein subunit beta-l...    139   1e-35   
ref|XP_007408997.1|  hypothetical protein MELLADRAFT_116221             137   1e-35   
emb|CDS03837.1|  Putative Guanine nucleotide-binding proteinFT su...    137   1e-35   
ref|XP_003333548.2|  guanine nucleotide-binding protein subunit b...    136   2e-35   
emb|CEG70023.1|  Putative Guanine nucleotide-binding protein subu...    137   2e-35   
gb|AAM88905.1|  guanine nucleotide-binding protein                      137   2e-35   
gb|KIR44237.1|  guanine nucleotide-binding protein subunit beta-l...    137   2e-35   
emb|CDY26186.1|  BnaA06g12310D                                          135   2e-35   
gb|KDQ57687.1|  hypothetical protein JAAARDRAFT_35372                   137   2e-35   
ref|NP_001274728.1|  guanine nucleotide-binding protein subunit b...    137   2e-35   
gb|KIW80333.1|  guanine nucleotide-binding protein subunit beta-l...    137   2e-35   
gb|KIW30011.1|  guanine nucleotide-binding protein subunit beta-l...    137   2e-35   
gb|KIW99040.1|  guanine nucleotide-binding protein subunit beta-l...    137   2e-35   
emb|CDY21720.1|  BnaA09g44710D                                          135   2e-35   
ref|XP_010733915.1|  PREDICTED: guanine nucleotide-binding protei...    137   3e-35   
ref|XP_007761319.1|  guanine nucleotide-binding protein subunit b...    136   3e-35   
gb|KIW62858.1|  guanine nucleotide-binding protein subunit beta-l...    136   3e-35   
gb|AFV81452.1|  receptor for activated protein kinase C                 136   3e-35   
emb|CDX81860.1|  BnaC08g37410D                                          134   4e-35   
gb|KIW10778.1|  guanine nucleotide-binding protein subunit beta-l...    136   5e-35   
ref|XP_007739518.1|  guanine nucleotide-binding protein subunit b...    135   5e-35   
ref|XP_007007889.1|  hypothetical protein TREMEDRAFT_45853              135   6e-35   
ref|XP_003970442.1|  PREDICTED: guanine nucleotide-binding protei...    135   7e-35   
emb|CAG01204.1|  unnamed protein product                                135   7e-35   
gb|KIV82161.1|  guanine nucleotide-binding protein subunit beta-l...    135   8e-35   
ref|XP_008873892.1|  guanine nucleotide-binding protein subunit b...    135   8e-35   
gb|KIW40911.1|  guanine nucleotide-binding protein subunit beta-l...    135   8e-35   
gb|AAM88903.1|  guanine nucleotide-binding protein                      135   9e-35   
ref|XP_005703361.1|  hypothetical protein Gasu_55280                    135   1e-34   
emb|CCX15458.1|  Similar to Guanine nucleotide-binding protein su...    135   1e-34   
ref|XP_007864562.1|  WD40 repeat-like protein                           135   1e-34   
ref|XP_007730120.1|  guanine nucleotide-binding protein subunit b...    135   1e-34   
ref|XP_002181732.1|  predicted protein                                  135   1e-34   
ref|XP_002850965.1|  G-protein complex beta subunit CpcB                135   1e-34   
ref|XP_007723621.1|  guanine nucleotide-binding protein subunit b...    135   1e-34   
gb|KIX03579.1|  guanine nucleotide-binding protein subunit beta-l...    135   1e-34   
ref|XP_010020213.1|  PREDICTED: guanine nucleotide-binding protei...    132   1e-34   
emb|CDX83869.1|  BnaC08g17760D                                          133   1e-34   
ref|XP_003176836.1|  G-protein comlpex beta subunit CpcB                134   2e-34   
emb|CDY60778.1|  BnaC05g50130D                                          133   2e-34   
ref|XP_006695086.1|  putative guanine nucleotide-binding protein        134   2e-34   
gb|KGB35723.1|  Guanine nucleotide-binding protein subunit beta-2...    134   2e-34   
ref|XP_009160336.1|  guanine nucleotide-binding protein subunit b...    135   2e-34   
ref|XP_006665983.1|  guanine nucleotide-binding protein beta subu...    134   2e-34   
gb|KIW59315.1|  guanine nucleotide-binding protein subunit beta-l...    134   2e-34   
ref|XP_003014052.1|  vegetative incompatibility WD repeat protein...    134   2e-34   
ref|XP_007873857.1|  hypothetical protein PNEG_01883                    134   3e-34   
ref|XP_008600266.1|  WD domain-containing protein                       134   3e-34   
ref|XP_005094913.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    134   4e-34   
gb|KEI37942.1|  hypothetical protein L969DRAFT_89179                    133   4e-34   
emb|CDO70596.1|  hypothetical protein BN946_scf184656.g11               133   4e-34   
gb|KGQ02984.1|  Guanine nucleotide-binding protein subunit beta-l...    137   4e-34   
ref|XP_001631784.1|  predicted protein                                  133   4e-34   
ref|XP_001212378.1|  hypothetical protein ATEG_03200                    132   5e-34   
dbj|BAH56896.1|  AT1G18080                                              132   5e-34   
dbj|GAE00026.1|  hypothetical protein PVAR5_8757                        133   5e-34   
gb|KFU89350.1|  Guanine nucleotide-binding protein subunit beta-2...    132   5e-34   
ref|XP_007397219.1|  hypothetical protein PHACADRAFT_258442             133   5e-34   
gb|AAY66933.1|  guanine nucleotide-binding protein                      133   5e-34   
gb|KIH90457.1|  guanine nucleotide-binding protein subunit beta-2...    132   6e-34   
ref|XP_008034536.1|  guanine nucleotide binding protein beta subunit    133   6e-34   
ref|XP_011112534.1|  hypothetical protein H072_6755                     133   6e-34   
ref|XP_661767.1|  GBLP_NEUCR Guanine nucleotide-binding protein b...    133   6e-34   
gb|EPZ34131.1|  Guanine nucleotide-binding protein subunit beta-2...    133   7e-34   
gb|ESZ90478.1|  g-protein beta subunit                                  134   7e-34   
ref|XP_001551314.1|  guanine nucleotide-binding protein beta subunit    133   7e-34   
ref|XP_004341795.1|  guanine nucleotide-binding protein beta subu...    133   7e-34   
ref|XP_008082093.1|  WD40 repeat-like protein                           133   7e-34   
gb|KIN05611.1|  hypothetical protein OIDMADRAFT_153920                  133   7e-34   
ref|XP_007800891.1|  Guanine nucleotide-binding protein subunit b...    133   7e-34   
gb|ERL86701.1|  hypothetical protein D910_04107                         128   8e-34   
ref|XP_001226350.1|  guanine nucleotide-binding protein beta subu...    132   8e-34   
ref|XP_001903663.1|  hypothetical protein                               132   8e-34   
gb|ERS97367.1|  guanine nucleotide-binding protein subunit beta-l...    132   9e-34   
ref|XP_003664641.1|  hypothetical protein MYCTH_2307651                 132   9e-34   
ref|XP_011126276.1|  hypothetical protein AOL_s00173g232                132   9e-34   
gb|KIJ49590.1|  hypothetical protein M422DRAFT_205027                   132   9e-34   
gb|ACY68646.1|  guanine nucleotide-binding protein beta subunit         129   1e-33   
gb|EWC48866.1|  guanine nucleotide-binding protein subunit beta-l...    132   1e-33   
ref|XP_003651077.1|  hypothetical protein THITE_2169762                 132   1e-33   
ref|XP_001537609.1|  hypothetical protein HCAG_07031                    132   1e-33   
ref|XP_008494697.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-33   
sp|Q01369.1|GBLP_NEUCR  RecName: Full=Guanine nucleotide-binding ...    132   1e-33   
gb|ABR23464.1|  G protein beta subunit-like protein                     132   1e-33   
ref|XP_007362000.1|  guanine nucleotide binding protein beta subunit    132   1e-33   
gb|EMS22902.1|  G-protein complex beta subunit                          132   1e-33   
ref|XP_960070.1|  guanine nucleotide-binding protein subunit beta...    132   1e-33   
ref|XP_002838384.1|  hypothetical protein                               132   1e-33   
gb|ACN93683.1|  RACK-like protein                                       126   1e-33   
gb|KIO09923.1|  hypothetical protein M404DRAFT_995909                   132   1e-33   
ref|XP_003051079.1|  predicted protein                                  132   1e-33   
ref|XP_001272169.1|  G-protein comlpex beta subunit CpcB                132   1e-33   
ref|XP_002613759.1|  hypothetical protein BRAFLDRAFT_84515              132   1e-33   
gb|KEF54434.1|  guanine nucleotide-binding protein subunit beta-l...    132   1e-33   
ref|XP_007799385.1|  putative guanine nucleotide-binding protein ...    132   1e-33   
ref|XP_002481861.1|  G-protein complex beta subunit CpcB                132   1e-33   
ref|XP_002147691.1|  G-protein comlpex beta subunit CpcB                132   2e-33   
gb|KFY27537.1|  hypothetical protein V493_03433                         132   2e-33   
dbj|BAK03551.1|  predicted protein                                      132   2e-33   
ref|XP_007308233.1|  guanine nucleotide binding protein beta subunit    132   2e-33   
emb|CCM01124.1|  predicted protein                                      132   2e-33   
gb|ACF35540.1|  guanine nucleotide-binding protein                      132   2e-33   
ref|XP_002791085.1|  G-protein comlpex beta subunit CpcB                132   2e-33   
ref|XP_010756949.1|  guanine nucleotide-binding protein subunit b...    132   2e-33   
gb|KIV92993.1|  guanine nucleotide-binding protein subunit beta-l...    132   2e-33   
ref|XP_001266728.1|  G-protein comlpex beta subunit CpcB                132   2e-33   
gb|ABA33785.1|  RACK1-like protein                                      132   2e-33   
emb|CAZ37256.1|  receptor for activated PKC, putative                   131   2e-33   
ref|XP_007292588.1|  putative Guanine nucleotide-binding protein ...    131   2e-33   
gb|ABS18779.1|  putative WD40 protein                                   131   2e-33   
ref|XP_751514.1|  G-protein complex beta subunit CpcB                   131   2e-33   
gb|AEE61583.1|  unknown                                                 131   2e-33   
ref|XP_001730694.1|  hypothetical protein MGL_2148                      131   3e-33   
emb|CAZ37255.1|  receptor for activated PKC, putative                   131   3e-33   
gb|EMD37863.1|  guanine nucleotide binding protein beta subunit         131   3e-33   
ref|XP_001816748.1|  guanine nucleotide-binding protein subunit b...    131   3e-33   
gb|AAL84173.1|AF422164_1  receptor for activated PKC                    131   3e-33   



>ref|XP_009611065.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=325

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 113/119 (95%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDLRVDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF GYTDG+IRVWGIGRY
Sbjct  268  VVDLRVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGGYTDGLIRVWGIGRY  325



>ref|XP_006341557.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=327

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRYWLCAATE+SIKIWDLESK+I
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRYWLCAATESSIKIWDLESKTI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDLRVDLK ESEM+A  + TA KNK+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VVDLRVDLKHESEMAANESGTAPKNKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  327



>ref|XP_009780116.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=325

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATESSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF GYTDG+IRVWGIGRY
Sbjct  268  VVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGGYTDGLIRVWGIGRY  325



>gb|EYU40229.1| hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata]
Length=357

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSII+ALCFSPNRYWLCAATEASIKIWDLESKS+
Sbjct  237  CASGGKDGVILLWDLAEGKRLYSLDAGSIINALCFSPNRYWLCAATEASIKIWDLESKSV  296

Query  378  VVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            VVDL+VDLK ESE++ EG   + AAKNK+I+CTSLSW+ADGSTLFSGYTDGV+RVWGIGR
Sbjct  297  VVDLKVDLKHESEIAPEGATQSAAAKNKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGR  356

Query  204  Y  202
            Y
Sbjct  357  Y  357



>ref|XP_009776114.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=328

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  209  CASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYTDGLIRVWGIGRY  328



>emb|CAA96528.1| G protein beta-subunit-like protein [Nicotiana plumbaginifolia]
Length=328

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  209  CASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYTDGLIRVWGIGRY  328



>gb|ABB02625.1| G protein beta subunit-like protein [Solanum tuberosum]
Length=261

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  141  CASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  200

Query  378  VVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            VVDLRVDLKQE+EM     +T+  AK K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGR
Sbjct  201  VVDLRVDLKQETEMFGNATSTSGNAKTKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGR  260

Query  204  Y  202
            Y
Sbjct  261  Y  261



>ref|XP_004252270.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            VVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGR
Sbjct  269  VVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGR  328

Query  204  Y  202
            Y
Sbjct  329  Y  329



>ref|XP_006353816.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=329

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTA--AKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            VVDLRVDLKQE+EMS    +T+  +K K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGR
Sbjct  269  VVDLRVDLKQETEMSGNATSTSGNSKTKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGR  328

Query  204  Y  202
            Y
Sbjct  329  Y  329



>ref|XP_009600162.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=328

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  209  CASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESEM+ EG   +A KNKI++CT LSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VVDLKVDLKQESEMATEGTTGSACKNKIMYCTCLSWSADGSTLFSGYTDGLIRVWGIGRY  328



>gb|ABB86277.1| ArcA2 protein-like [Solanum tuberosum]
Length=327

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDA SIIH LCFSPNRYWLCAATE+SIKIWDLESK+I
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDASSIIHTLCFSPNRYWLCAATESSIKIWDLESKTI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDLRVDLKQESEM+A  + T  KNK+I+CTSLSW+ADGSTL SGYTDG+IRVWGIGRY
Sbjct  269  VVDLRVDLKQESEMAATESGTGPKNKVIYCTSLSWSADGSTLSSGYTDGLIRVWGIGRY  327



>gb|EYU17645.1| hypothetical protein MIMGU_mgv1a009858mg [Erythranthe guttata]
Length=329

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSLDAGSI+HA+CFSPNRYWLCAATEA IKIWDLESKS+
Sbjct  209  CASGGKDGFILLWDLAEGKKLYSLDAGSIVHAVCFSPNRYWLCAATEAGIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGN--NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            VVDL+VDLKQESEM +EGN    A+KNKII+CT L+W+ADGSTLFSGYTDGV+RVWGIGR
Sbjct  269  VVDLKVDLKQESEMISEGNGQTAASKNKIIYCTCLNWSADGSTLFSGYTDGVVRVWGIGR  328

Query  204  Y  202
            Y
Sbjct  329  Y  329



>emb|CDO98381.1| unnamed protein product [Coffea canephora]
Length=1395

 Score =   228 bits (582),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 110/122 (90%), Positives = 115/122 (94%), Gaps = 3/122 (2%)
 Frame = -2

Query  558   CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
             CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI
Sbjct  1274  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  1333

Query  378   VVDLRVDLKQESEMSAEG---NNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
             VVDLRVDLKQESEM+AEG     T AKNK+I+CTSL+W+ADGSTLFSGYTDGVIRVWGI 
Sbjct  1334  VVDLRVDLKQESEMAAEGTTVQTTGAKNKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIM  1393

Query  207   RY  202
             RY
Sbjct  1394  RY  1395



>ref|NP_001233881.1| ArcA2 protein [Solanum lycopersicum]
 dbj|BAA76896.1| LeArcA2 protein [Solanum lycopersicum]
Length=326

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLK ESEM+ E + TA K K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VVDLKVDLKHESEMANE-SGTAPKTKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326



>ref|XP_009624187.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=326

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326



>gb|AJE63428.1| transcription factor ArcA1 [Capsicum annuum]
Length=330

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 3/122 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEM---SAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            VVDLRVDLKQESEM   + +G     KNKII+CTSLSW+ADGSTL+ GYTDG+IRVWGIG
Sbjct  269  VVDLRVDLKQESEMLAATPDGGAAPVKNKIIYCTSLSWSADGSTLYRGYTDGLIRVWGIG  328

Query  207  RY  202
            RY
Sbjct  329  RY  330



>ref|XP_009778426.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=326

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 113/119 (95%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK+I
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESSIKIWDLESKTI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRY  326



>gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana]
Length=326

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK+I
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESSIKIWDLESKTI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLKQE+EMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VDDLKVDLKQETEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRY  326



>sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tabacum]
 dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum]
Length=326

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 113/119 (95%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLKQESEMS+EG   + KNK+I+CTSLSW+ADGSTLFSGYTDG+IRVWGI RY
Sbjct  269  VDDLKVDLKQESEMSSEG-TASGKNKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIDRY  326



>ref|XP_011072970.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Sesamum indicum]
Length=329

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 113/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKS+
Sbjct  209  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAA--KNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            VVDL+VDLKQES+++ +G +  A  K K+I+CT L+W+ADGSTLFSGYTDGV+RVWGIGR
Sbjct  269  VVDLKVDLKQESDLAKDGTDQTAAVKTKVIYCTCLNWSADGSTLFSGYTDGVVRVWGIGR  328

Query  204  Y  202
            Y
Sbjct  329  Y  329



>sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana plumbaginifolia]
 emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=326

 Score =   211 bits (537),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL++GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK+I
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLESGSIIHSLCFSPNRYWLCAATESSIKIWDLESKTI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLKQESEMSAEG   + KNK+I+CTSL W+ADGSTLFSGYTDG+IRVWGIGR+
Sbjct  269  VDDLKVDLKQESEMSAEG-TASGKNKVIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRF  326



>gb|EPS70887.1| hypothetical protein M569_03871 [Genlisea aurea]
Length=326

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 112/119 (94%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS G+DGVILLWDLAEGK+LYSL+AGSI HALCFSPNRYWLCAATEASIKIWDLESKS+
Sbjct  209  CASAGRDGVILLWDLAEGKRLYSLEAGSITHALCFSPNRYWLCAATEASIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESE++AE    + K+K+IFCTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VVDLKVDLKQESELAAE-ETASRKHKVIFCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326



>ref|XP_006365404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=326

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGSIIH LCFSPNRYWLCAATE+SIKIWDLESKS+
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326



>ref|NP_001233876.1| ArcA1 protein [Solanum lycopersicum]
 dbj|BAA76895.1| LeArcA1 protein [Solanum lycopersicum]
Length=326

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGSIIH  CFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHTFCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESEM      T +K K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  269  VVDLKVDLKQESEMFGTA-ATDSKTKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326



>ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Medicago truncatula]
 gb|AET05547.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=325

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 111/119 (93%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325



>sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Medicago sativa]
 emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia]
Length=325

 Score =   206 bits (525),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 111/119 (93%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325



>gb|KHN21658.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  106  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  165

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  166  VEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  223



>gb|KJB37175.1| hypothetical protein B456_006G192600 [Gossypium raimondii]
Length=327

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  210  CASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_010537487.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AG++IHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  210  CASGGKDGVILLWDLAEGKKLYSLEAGAVIHALCFSPNRYWLCAATEQSIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     TA K K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKSDGAGATANKKKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  328



>ref|XP_004299548.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Fragaria vesca subsp. vesca]
Length=326

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E + E   TA K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR+
Sbjct  269  VEDLKVDLKTEAEKTKE-TGTANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRF  326



>gb|KHG00880.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  210  CASGGKDGVILLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSV  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E SA  +N A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAETSAATDN-ANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_010097592.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
Length=330

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  211  CASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATENSIKIWDLESKSI  270

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  271  VEDLKVDLKTEAEKTEDTHAATANKKKVIYCTSLSWSADGSTLFSGYTDGVIRVWGIGRY  330



>gb|KHG17882.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=326

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326



>gb|KHN00175.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  106  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  165

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +  G N   K K+I+CTSL+W++DGSTLFSGYTDGV+RVWGIGRY
Sbjct  166  VEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGSTLFSGYTDGVVRVWGIGRY  223



>gb|KJB53022.1| hypothetical protein B456_008G288800 [Gossypium raimondii]
Length=326

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S   +N A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDVTDN-ANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326



>ref|XP_002894122.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70381.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T  K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  268  VEDLKVDLKTEAEKSDVSTGTGNKTKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326



>gb|AFK36580.1| unknown [Medicago truncatula]
Length=325

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGFIIHALCFSPNRYWLCAATESSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +A G +T  K K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKTEAD-AAIGGDTTTKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325



>ref|XP_007036696.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=327

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  210  CASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S +  +TA K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR+
Sbjct  270  VEDLKVDLKAEAEKS-DVTDTANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRF  327



>ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 gb|KGN63851.1| hypothetical protein Csa_1G024830 [Cucumis sativus]
Length=327

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLF GYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADGSTLFGGYTDGVVRVWGIGRY  327



>ref|XP_008453452.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Cucumis melo]
Length=327

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E + + +  TA K K+I+CTSLSW+ADGSTLF GYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKTEAEKTDDTHAATANKIKVIYCTSLSWSADGSTLFGGYTDGVVRVWGIGRY  327



>ref|XP_010540016.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+AG++IH+LCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  210  CASGGKDGVVLLWDLAEGKKLYSLEAGAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S    + A K K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKSDGAGSAATKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  328



>ref|XP_009117627.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=327

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKS+
Sbjct  209  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSLSW+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLSWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max]
 gb|ACU23023.1| unknown [Glycine max]
Length=325

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +  G N   K K+I+CTSL+W++DGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKTEADATTGGGN-PNKKKVIYCTSLNWSSDGSTLFSGYTDGVVRVWGIGRY  325



>ref|XP_009110365.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brassica rapa]
Length=327

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKS+
Sbjct  209  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S        K K+I+CTSLSWNADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDGSGTAGNKKKVIYCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_010549077.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATEHGIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSLSW+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  269  VEDLKVDLKTEAEKSDGDTGAANKQKVIYCTSLSWSADGNTLFSGYTDGIIRVWGIGRY  327



>ref|XP_010549078.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAG++IH+LCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGAVIHSLCFSPNRYWLCAATEHGIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSLSW+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLSWSADGNTLFSGYTDGIIRVWGIGRY  327



>ref|NP_188441.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
 sp|Q9LV28.1|GPLPC_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein C; AltName: Full=Receptor for activated C kinase 
1C [Arabidopsis thaliana]
 dbj|BAB02025.1| guanine nucleotide-binding protein; activated protein kinase 
C receptor; RACK1 [Arabidopsis thaliana]
 gb|AAK91355.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AAM26650.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AEE76051.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
Length=326

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKSEAEKNEGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326



>ref|XP_002890259.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66518.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  209  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDNSGPAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_010506450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESK++
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIKIWDLESKTV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326



>ref|XP_006393380.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
 gb|ESQ30666.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
Length=327

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE+SI+IWDLESKS+
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATESSIRIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDGSAGTGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  327



>gb|KFK39137.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S  G     + K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDGGVGMGNQKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  327



>ref|XP_006297909.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
 gb|EOA30807.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
Length=380

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  262  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIKIWDLESKSV  321

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  322  VEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  380



>ref|XP_006416642.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
 gb|ESQ34995.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
Length=328

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  210  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328



>ref|XP_007160506.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
 gb|ACV72060.1| RACK1 [Phaseolus vulgaris]
 gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
Length=324

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 2/119 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  268  VEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  324



>gb|ACJ24167.1| Rack [Phaseolus vulgaris]
Length=324

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 2/119 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  268  VEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  324



>ref|XP_010465892.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESK++
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIKIWDLESKTV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326



>gb|AGV54321.1| RACK1 [Phaseolus vulgaris]
Length=324

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 2/119 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ +  GN    K K+I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  268  VEDLKVDLKTEADGTTGGNTN--KKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  324



>ref|XP_009149259.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=328

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKS+
Sbjct  210  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKSV  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328



>gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thaliana]
Length=327

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  209  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEHGIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_006305339.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
 gb|EOA38237.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
Length=328

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  210  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328



>emb|CDY64888.1| BnaC06g40840D [Brassica napus]
Length=299

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  181  CASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  240

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+EMS     T  K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GR+
Sbjct  241  VEDLKVDLKAEAEMSDASVGTGNKTKVIYCTSLNWSADGSTLFSGYTDGVIRVWGLGRF  299



>ref|XP_002529557.1| receptor for activated protein kinase C, putative [Ricinus communis]
 gb|EEF32826.1| receptor for activated protein kinase C, putative [Ricinus communis]
Length=328

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRYWLCAATENSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DL+VDLK E+E S  +   +T AK K I+CTSLSWNADGSTLFSGYTDGVIRVWGIGR
Sbjct  268  VEDLKVDLKAEAEKSDGSTVASTGAKKKNIYCTSLSWNADGSTLFSGYTDGVIRVWGIGR  327

Query  204  Y  202
            +
Sbjct  328  F  328



>ref|NP_173248.1| guanine nucleotide-binding protein subunit beta-like protein 
A [Arabidopsis thaliana]
 sp|O24456.2|GBLPA_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; AltName: Full=Receptor for activated C kinase 
1A; AltName: Full=WD-40 repeat auxin-dependent protein ARCA 
[Arabidopsis thaliana]
 gb|AAF78369.1|AC069551_2 T10O22.6 [Arabidopsis thaliana]
 gb|AAF97825.1|AC034107_8 Identical to WD-40 repeat protein (AtArcA) from Arabidopsis thaliana 
gb|U77381 and contains multiple WD (G-beta repeat) PF|00400 
domains. ESTs gb|Z17972, gb|AI099926, gb|T42961, gb|R30131, 
gb|AV541608, gb|AV532234, gb|AV543299, gb|AV440652 come 
from this gene [Arabidopsis thaliana]
 gb|AAK59512.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAL34190.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAM66016.1| WD-40 repeat protein [Arabidopsis thaliana]
 gb|AEE29673.1| WD-40 repeat ArcA-like protein [Arabidopsis thaliana]
Length=327

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  209  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEHGIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_006406649.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
 gb|ESQ48102.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
Length=327

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S  G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  327



>gb|KFK43977.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  209  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR+
Sbjct  269  VEDLKVDLKAEAEKSDGSGTAATKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRF  327



>ref|XP_010487724.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESK +
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIKIWDLESKLV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +  G  T  + K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKAEAEKADGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326



>gb|KHG29145.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  210  CASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQGIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_006305354.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
 gb|EOA38252.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
Length=326

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  268  VEDLKVDLKVEAEKSDGAVGTGNKTKVIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRY  326



>ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein 
[Glycine max]
 sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Glycine max]
 gb|AAB05941.1| G beta-like protein [Glycine max]
Length=325

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAGSIIHALCFSP+RYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGSIIHALCFSPSRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++ ++ G N A K K+I+CTSL+W+ADGSTLFSGYTDGV RVW IGRY
Sbjct  268  VEDLKVDLKTEADATSGGGN-ANKKKVIYCTSLNWSADGSTLFSGYTDGVARVWAIGRY  325



>gb|KJB08186.1| hypothetical protein B456_001G069800 [Gossypium raimondii]
Length=327

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAGS+IH+LCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  210  CASGGKDGVILLWDLAEGKKLYSLDAGSVIHSLCFSPNRYWLCAATEQGIKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S +  +   K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKS-DVTDIGNKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_002885240.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61499.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=327

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +  G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKTDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  327



>emb|CDY59680.1| BnaA05g36460D [Brassica napus]
Length=225

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  107  CASGGKDGAILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  166

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIG Y
Sbjct  167  VEDLKVDLKAEAEKSDVSAATGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGHY  225



>sp|Q39336.1|GBLP_BRANA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Brassica napus]
 emb|CAA83924.1| guanine nucleotide regulatory protein [Brassica napus]
Length=327

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCF+PNRYWLCAATE  IKIWDLESK++
Sbjct  209  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFTPNRYWLCAATEQGIKIWDLESKTV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VEDLKVDLKAEAEKSDGSGTAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>ref|XP_010032559.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW83972.1| hypothetical protein EUGRSUZ_B00856 [Eucalyptus grandis]
Length=327

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATENSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLRVDLK E++MS       + N K+I+CTSL+W+ADGSTLFSGY DGVIRVWGIGRY
Sbjct  268  VEDLRVDLKNEADMSDGTTGAMSSNKKVIYCTSLNWSADGSTLFSGYNDGVIRVWGIGRY  327



>ref|XP_010498185.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHA+CFSPNRYWLCAATE  IKIWDLESK+I
Sbjct  210  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHAVCFSPNRYWLCAATEQGIKIWDLESKTI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKADNSGPAATKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328



>ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
 sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; AltName: Full=Receptor for activated C kinase 
1B [Arabidopsis thaliana]
 gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
Length=326

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +        K K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  268  VEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  326



>ref|XP_010476972.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   199 bits (506),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAATE  IKIWDLESK+I
Sbjct  210  CASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKTI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  VEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328



>gb|KDP37901.1| hypothetical protein JCGZ_05340 [Jatropha curcas]
Length=329

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LY+LDAG++IHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKRLYNLDAGAVIHALCFSPNRYWLCAATEHSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMS--AEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DL+VDLK E+E S  +    T+ K K I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGR
Sbjct  269  VEDLKVDLKAEAEKSEGSTATGTSIKKKNIYCTSLNWSADGSTLFSGYTDGVVRVWGIGR  328

Query  204  Y  202
            Y
Sbjct  329  Y  329



>ref|XP_010551145.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG+ILLWDLAEGKKLYSLDAG +IH+LCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  209  CASGGKDGMILLWDLAEGKKLYSLDAGDVIHSLCFSPNRYWLCAATEQSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S      A K K+I+CTSL+W+ADG+TLFSGY+DG+IRVWGIGR+
Sbjct  269  VEDLKVDLKAEAEKSDGDTGAANKQKVIYCTSLNWSADGNTLFSGYSDGIIRVWGIGRF  327



>ref|XP_009147950.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein B [Brassica rapa]
Length=328

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  210  CASGGKDGAILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T  K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GR+
Sbjct  270  VEDLKVDLKAEAEKSDASVGTGNKTKVIYCTSLNWSADGSTLFSGYTDGVIRVWGLGRF  328



>ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Vitis vinifera]
 emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera]
Length=327

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAE-GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S +       K KII+CTSLSW+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VEDLKVDLKTEAEKSEDTTTTAKKKGKIIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY  327



>ref|XP_010036939.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW48591.1| hypothetical protein EUGRSUZ_K02261 [Eucalyptus grandis]
Length=326

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LY+L+AG+IIH+LCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYNLEAGAIIHSLCFSPNRYWLCAATENSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKN-KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLRVDLK E++ + +G  TAA N K+I+CTSL+W+ADGSTLFSGY DGVIRVWG GRY
Sbjct  268  VEDLRVDLKNEADKT-DGTTTAASNKKVIYCTSLNWSADGSTLFSGYNDGVIRVWGTGRY  326



>ref|XP_006451669.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
 ref|XP_006490737.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Citrus sinensis]
 gb|ESR64909.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
Length=327

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T   K K I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  268  VEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327



>emb|CDY71917.1| BnaCnng75080D [Brassica napus]
Length=244

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 3/119 (3%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLY L+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  129  CASGGKDGGILLWDLAEGKKLYCLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  188

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK ES++SA    T  K K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  189  VEDLKVDLKAESDVSA---GTGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  244



>gb|KDO62873.1| hypothetical protein CISIN_1g048118mg [Citrus sinensis]
Length=303

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG++IHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  184  CASGGKDGVILLWDLAEGKRLYSLDAGAVIHALCFSPNRYWLCAATEQSIKIWDLESKSI  243

Query  378  VVDLRVDLKQESEMSAEGNNTAA-KNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T   K K I+CTSL+W+ DGSTLFSGYTDGVIRVWGIGRY
Sbjct  244  VEDLKVDLKTEAEKSEATTATTTIKKKNIYCTSLNWSVDGSTLFSGYTDGVIRVWGIGRY  303



>ref|XP_009145001.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Brassica rapa]
Length=327

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  209  CASGGKDGAILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIG Y
Sbjct  269  VEDLKVDLKAEAEKSDVSAATGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGHY  327



>ref|XP_008374821.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Malus domestica]
 ref|XP_008364648.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
 ref|XP_009347770.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR
Sbjct  268  VEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGR  326



>ref|XP_009360100.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR
Sbjct  268  VEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGR  326



>ref|XP_008393404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
Length=326

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LY L+AGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGKRLYHLEAGSIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +L+VDLK E+E + + +  T+ K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR
Sbjct  268  VEELKVDLKTEAEKTEDTHAATSYKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGR  326



>ref|XP_008240184.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Prunus mume]
Length=327

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRYWLCAATE SIKIWDLESK I
Sbjct  208  CASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRYWLCAATEQSIKIWDLESKQI  267

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADGSTLFSGY+DGVIRVWGIGRY
Sbjct  268  VEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADGSTLFSGYSDGVIRVWGIGRY  327



>gb|AAM65407.1| guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
Length=326

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +        K K+I+CTSL+W+ADG+TLFSGYT GVIRVWGIGRY
Sbjct  268  VEDLKVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTHGVIRVWGIGRY  326



>ref|XP_007209348.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
Length=327

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK LYSL AG+IIHALCFSPNRYWLCAATE SIKIWDLESK I
Sbjct  208  CASGGKDGVILLWDLAEGKMLYSLGAGAIIHALCFSPNRYWLCAATEQSIKIWDLESKQI  267

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E + + +  TA K K+I+CTSL+W+ADGSTLFSGY+DGVIRVWGIGRY
Sbjct  268  VEDLKVDLKTEAEKTEDTHAATAYKKKVIYCTSLNWSADGSTLFSGYSDGVIRVWGIGRY  327



>ref|XP_010678120.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKD VILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE+ IKIWDLESKS+
Sbjct  208  CASGGKDSVILLWDLAEGKRLYSLDAGTIIHALCFSPNRYWLCAATESGIKIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E++       TA+K K+I+CTSLSW+ADG TLFSGYTDGV+RV+GI RY
Sbjct  268  VEDLKVDLKTEADHLEGSGTTASKKKVIYCTSLSWSADGQTLFSGYTDGVVRVYGIARY  326



>ref|XP_010500401.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE SI+IWDLESK++
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATENSIRIWDLESKTV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  268  VEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRY  326



>emb|CDY18497.1| BnaA01g26980D [Brassica napus]
Length=326

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESSIKIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326



>ref|XP_009113515.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=326

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESSIKIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326



>emb|CDX95554.1| BnaC01g34460D [Brassica napus]
Length=326

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESSIKIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326



>ref|XP_010479287.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE SI+IWDLESK++
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATENSIRIWDLESKTV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGR+
Sbjct  268  VEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRF  326



>emb|CDY44104.1| BnaA01g13120D [Brassica napus]
 emb|CDX93686.1| BnaA06g03620D [Brassica napus]
 emb|CDX86074.1| BnaC03g55890D [Brassica napus]
Length=298

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AG+IIH+LCFSPNRYWLCAATE SI+IWDLESKS+
Sbjct  180  CASGGKDGVILLWDLAEGKKLYSLEAGAIIHSLCFSPNRYWLCAATENSIRIWDLESKSV  239

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     T  K K+I CTSL+W+ADGSTLF GYTDGVIRVWG+GR+
Sbjct  240  VEDLKVDLKAEAEKSDASVGTGNKTKVICCTSLNWSADGSTLFGGYTDGVIRVWGLGRF  298



>ref|XP_010461692.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGS+IH+LCFSPNRYWLCAATE SI+IWDLESK +
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEAGSVIHSLCFSPNRYWLCAATENSIRIWDLESKIV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S        K K+I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  268  VEDLKVDLKVEAEKSDGAVGIGNKTKVIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRY  326



>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana
Length=694

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYSL+A S+IHALCFSPNRYWLCAATE  IKIWDLESKSI
Sbjct  576  CASGGKDGVVLLWDLAEGKKLYSLEANSVIHALCFSPNRYWLCAATEHGIKIWDLESKSI  635

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  636  VEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  694



>emb|CAA06154.1| arcA 3 [Nicotiana tabacum]
Length=290

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 2/119 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+AGSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  174  CASGGKDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATESSIKIWDLESKSI  233

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESEMSAEG   AAKNKII+CT LSW+ADGSTLF G T  V+  +G GRY
Sbjct  234  VVDLKVDLKQESEMSAEG-TAAAKNKIIYCTCLSWSADGSTLFGG-TQMVLIEYGDGRY  290



>ref|XP_011039103.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE SIKIWDLESK +
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATENSIKIWDLESKMV  268

Query  378  VVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GRY
Sbjct  269  VDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYTDGVIRVWGVGRY  328



>ref|XP_002318528.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|EEE96748.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE SIKIWDLESK +
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATENSIKIWDLESKMV  268

Query  378  VVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GRY
Sbjct  269  VDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYTDGVIRVWGVGRY  328



>ref|XP_011039104.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLDAG++I+ALCFSPNRYWLCAATE SIKIWDLESK +
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDAGAVINALCFSPNRYWLCAATENSIKIWDLESKLV  268

Query  378  VVDLRVDLKQESEMSAEGNNTA-AKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S     TA +  K I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GRY
Sbjct  269  VDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYTDGVIRVWGVGRY  328



>ref|XP_009145932.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=325

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK++
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESSIKIWDLESKTV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325



>emb|CDX95784.1| BnaC05g35350D [Brassica napus]
Length=325

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK++
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESSIKIWDLESKTV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325



>emb|CDX92200.1| BnaA05g22070D [Brassica napus]
Length=325

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL+ GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK++
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLEGGSIIHSLCFSPNRYWLCAATESSIKIWDLESKTV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V +L+VDLK E+E    G  T  + K+ +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  268  VDELKVDLKAEAEKDG-GAGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325



>gb|KFK36075.1| hypothetical protein AALP_AA4G074100 [Arabis alpina]
Length=210

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 111/140 (79%), Gaps = 7/140 (5%)
 Frame = -2

Query  552  SGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVV  373
            +GGKDGV+LLWDLAEGKKLYSL+AGS+IH++CFSPNRYWLCAATE+SI+IWDLESKS+V 
Sbjct  38   NGGKDGVVLLWDLAEGKKLYSLEAGSVIHSVCFSPNRYWLCAATESSIRIWDLESKSVVE  97

Query  372  DLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*ME  193
            DL+VDLK E+E S     T  K K+I+CTSL+W+ADG+TLFSGYTDGVIRVW +      
Sbjct  98   DLKVDLKAEAEKSDGAVGTGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWVL------  151

Query  192  EFRRSHMIIGHVCYLSHLEF  133
               R+H+ + H+    H  +
Sbjct  152  -LHRTHLSVEHILDGQHNHY  170



>ref|XP_011000479.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 3/121 (2%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRYWLCAATE SIKIWDLESK +
Sbjct  209  CASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRYWLCAATENSIKIWDLESKLV  268

Query  378  VVDLRVDLKQESEMSAEG--NNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DL+VDLK E+E S EG     A+  K I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR
Sbjct  269  VDDLKVDLKAEAEKS-EGTTATAASTTKKIYCTSLNWSADGSTLFSGYTDGVIRVWGIGR  327

Query  204  Y  202
            Y
Sbjct  328  Y  328



>ref|XP_002321505.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|ABK92879.1| unknown [Populus trichocarpa]
 gb|EEF05632.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG++I+ALCFSPNRYWLCAATE SIKIWDLESK +
Sbjct  209  CASGGKDGVILLWDLAEGKRLYSLDAGAVINALCFSPNRYWLCAATENSIKIWDLESKLV  268

Query  378  VVDLRVDLKQESEMS-AEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E S       A+  K I+CT L+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  269  VDDLKVDLKAEAEKSEGTTGTAASTTKKIYCTCLNWSADGSTLFSGYTDGVIRVWGIGRY  328



>ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cicer arietinum]
Length=317

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 100/119 (84%), Gaps = 9/119 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEG       AGSIIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  208  CASGGKDGVILLWDLAEGNY-----AGSIIHALCFSPNRYWLCAATETSIKIWDLESKSI  262

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+VDLK E+E  +E      K K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  263  VEDLKVDLKAEAESGSE----TTKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  317



>ref|XP_010256121.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 99/119 (83%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  208  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATQDSVKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ +  Q             KN++++CTSLSW++DGSTLF+GYTDG IRVWGIGRY
Sbjct  268  VQDLKPEATQ------------GKNQMLYCTSLSWSSDGSTLFTGYTDGSIRVWGIGRY  314



>emb|CAC09579.1| gbf1 protein [Fagus sylvatica]
Length=267

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAATE SIKIWDLESKSI
Sbjct  155  CASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQSIKIWDLESKSI  214

Query  378  VVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNADGSTLFSGYTDGV  229
            V DL+VDLK E+    +     + K K+I+CTSL+W+ADGSTLFSGYTDGV
Sbjct  215  VEDLKVDLKTEAADKDDATTINSTKKKVIYCTSLNWSADGSTLFSGYTDGV  265



>ref|XP_010243791.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   180 bits (456),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 99/119 (83%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  208  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQDSVKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ +  Q             KN++++CTSLSW++DGSTLF+GYTDG IRVWGIGRY
Sbjct  268  VQDLKPEATQ------------GKNQMLYCTSLSWSSDGSTLFTGYTDGAIRVWGIGRY  314



>ref|XP_011084467.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Sesamum indicum]
Length=318

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 11/120 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVI              DAGSII+ALCFSPNRYWLCAATE+SIKIWDLESKS+
Sbjct  209  CASGGKDGVIX----------XXXDAGSIINALCFSPNRYWLCAATESSIKIWDLESKSV  258

Query  378  VVDLRVDLKQESEMSAEGN-NTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            VVDL+VDLKQESE++ EG   T+ KNK+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  259  VVDLKVDLKQESELATEGTAPTSGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  318



>ref|XP_010916329.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=324

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 100/119 (84%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+II+ALCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  218  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIYALCFSPNRYWLCAATQDSVKIWDLESKSI  277

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V     DLK E+  S        KN+I++CTSL+W+ADGSTLF+GYTDGVIRVWGI RY
Sbjct  278  V----QDLKPETPTS--------KNQILYCTSLNWSADGSTLFTGYTDGVIRVWGISRY  324



>ref|XP_006837182.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
 gb|ERN00036.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
Length=314

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSL+AG IIHALCFSPNRYWLCAATE S+KIWDLESKSI
Sbjct  208  CASGGKDGVTLLWDLAEGKRLYSLEAGGIIHALCFSPNRYWLCAATEESVKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ D                KN++++CTSLSW+ DGSTLF+GYTDG IRVW +GRY
Sbjct  268  VQDLKTDAPTN------------KNQMLYCTSLSWSTDGSTLFTGYTDGAIRVWVVGRY  314



>ref|XP_010924141.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 98/119 (82%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  217  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQESVKIWDLESKSI  276

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V     DLK E+  S        KN++++CTSLSW+ADGSTLF+GYTDG IRVW I RY
Sbjct  277  V----QDLKPETPTS--------KNQMLYCTSLSWSADGSTLFTGYTDGTIRVWEISRY  323



>dbj|BAF47116.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  46   CASGGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSV  105

Query  378  VVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNAD  265
            VVDL+VDLKQESEM+ EG    A KNKI++CT LSW AD
Sbjct  106  VVDLKVDLKQESEMATEGTTGPACKNKIMYCTCLSWCAD  144



>ref|XP_008803271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=323

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 99/119 (83%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  217  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQDSVKIWDLESKSI  276

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V     DLK E+ +S        KN++++CTSLSW+ADGSTLF+GYTDG IRVW I RY
Sbjct  277  V----QDLKPETPIS--------KNQMLYCTSLSWSADGSTLFTGYTDGTIRVWEITRY  323



>ref|XP_010430893.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=284

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAATE  IKIWDLESK+I
Sbjct  143  CASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKTI  202

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  235
            V DL+VDLK E+E +      A K K+I+CTSL+W+ADGSTLFSGYT+
Sbjct  203  VEDLKVDLKAEAEKADNSGPAATKRKVIYCTSLNWSADGSTLFSGYTE  250



>ref|XP_008812615.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=331

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG+ LLWDLAEGK+LYSLDAG+IIHALCFSPNRYWLCAAT+ S+KIWDLE+KSI
Sbjct  225  CASGGKDGITLLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATQDSVKIWDLENKSI  284

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V     DLK E+  S        KN++++CTSLSW+ADGSTLF+GYTDG IRVW + RY
Sbjct  285  V----QDLKPETPTS--------KNQMLYCTSLSWSADGSTLFTGYTDGTIRVWEVSRY  331



>ref|XP_010495439.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=308

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV+LLWDLAEGKKLYS +A S+IHALCFSPNRYWLCAATE  IKIWDLESK+I
Sbjct  167  CASGGKDGVVLLWDLAEGKKLYSFEANSVIHALCFSPNRYWLCAATEQGIKIWDLESKTI  226

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTD  235
            V DL+VDL+ E+E +      A K K+I+CTSL+W+ADGSTLFSGYT+
Sbjct  227  VEDLKVDLEAEAEKADHRGPAATKRKVIYCTSLNWSADGSTLFSGYTE  274



>ref|XP_010923802.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG+ LLWDLAEGK+LYSLDAG+II+ALCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  217  CASGGKDGITLLWDLAEGKRLYSLDAGAIIYALCFSPNRYWLCAATQDSVKIWDLESKSI  276

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V     DLK E+  S        KN++++CTSLSW+ADGSTLF+GYTDG IRVW + RY
Sbjct  277  V----QDLKPETPTS--------KNQMLYCTSLSWSADGSTLFTGYTDGTIRVWEVSRY  323



>dbj|BAF47119.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDG ILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATE SIKIWDLESKS+
Sbjct  46   CASRGKDGTILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATETSIKIWDLESKSV  105

Query  378  VVDLRVDLKQESEMSAEGNN-TAAKNKIIFCTSLSWNAD  265
            VVDL+VDL+QESEM+ EG   +A KNKI++CT LSW AD
Sbjct  106  VVDLKVDLEQESEMATEGTTGSACKNKIMYCTCLSWCAD  144



>ref|XP_009400497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 13/119 (11%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  219  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQESVKIWDLESKSI  278

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ +             T  KN++++CTSL+W+ADGSTLF+GYTDG IRVW I RY
Sbjct  279  VQDLKPE------------TTGTKNQMLYCTSLTWSADGSTLFTGYTDGTIRVWEI-RY  324



>ref|NP_001136800.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|ACF82664.1| unknown [Zea mays]
 gb|ACG34796.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW81011.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +
Sbjct  224  CASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHV  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ D++             +KN+I++CTSLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  284  VQDLKPDIQ------------VSKNQILYCTSLSWSADGSTLYTGYTDGSIRVWKISGY  330



>ref|XP_009405003.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 13/119 (11%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S+KIWDLESK+I
Sbjct  219  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQESVKIWDLESKTI  278

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ +             T  KN++++CTSL+W+ADGSTLF+GYTDG IRVW I RY
Sbjct  279  VQDLKPE------------TTTTKNQMLYCTSLTWSADGSTLFTGYTDGTIRVWEI-RY  324



>ref|NP_001146976.1| LOC100280585 [Zea mays]
 gb|ACG24854.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW79043.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +
Sbjct  224  CASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHV  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ D++             +KN+I++CTSLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  284  VQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYTGYTDGSIRVWKISGY  330



>gb|ACL54313.1| unknown [Zea mays]
Length=334

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +
Sbjct  224  CASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHV  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ D++             +KN+I++CTSLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  284  VQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYTGYTDGSIRVWKISGY  330



>gb|ABK26798.1| unknown [Picea sitchensis]
 gb|ACN40746.1| unknown [Picea sitchensis]
 gb|ACN40912.1| unknown [Picea sitchensis]
Length=316

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 92/118 (78%), Gaps = 11/118 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNRYWLCAAT+  +KIWDLESKSI
Sbjct  209  CASGGKDGVTMLWDLAEGKRLYSLDAGDIIYALCFSPNRYWLCAATQQCVKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DLR D                K +I +CTSLSW+ADGSTLFSGYTDG IRVWGIG 
Sbjct  269  VADLRPDFIPNK-----------KAQIPYCTSLSWSADGSTLFSGYTDGKIRVWGIGH  315



>ref|XP_009380503.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Musa acuminata subsp. malaccensis]
Length=323

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 98/119 (82%), Gaps = 13/119 (11%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  218  CASGGKDGVTLLWDLAEGKRLYSLDAGAIIHSLCFSPNRYWLCAATQESVKIWDLESKSI  277

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ ++            T  KN++++CTSL+W+A+GSTLF+GYTDG IRVW I RY
Sbjct  278  VQDLKPEI------------TTTKNQMLYCTSLTWSANGSTLFTGYTDGTIRVWEI-RY  323



>ref|XP_002440202.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
 gb|EES18632.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
Length=334

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +
Sbjct  224  CASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHV  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ D++             +KN+I++C+SLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  284  VQDLKPDIQ------------ISKNQILYCSSLSWSADGSTLYTGYTDGSIRVWKISAY  330



>gb|ABR25943.1| guanine nucleotide-binding protein beta subunit [Oryza sativa 
Indica Group]
Length=131

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK I
Sbjct  21   CASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHI  80

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ ++              +KN++++CTSL+W+ADGSTL++GYTDG IR++ I  +
Sbjct  81   VQDLKPEIP------------VSKNQMLYCTSLNWSADGSTLYAGYTDGTIRIYKISGF  127



>gb|ABK25010.1| unknown [Picea sitchensis]
 gb|ACN41136.1| unknown [Picea sitchensis]
Length=321

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 11/118 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRYWLCAAT+  +KIWDLESKS+
Sbjct  214  CASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRYWLCAATQQCVKIWDLESKSV  273

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +            N   K ++ FCTSL+W+ADGSTLFSGYTDGVIRVWG+GR
Sbjct  274  VEELRPNF-----------NPTKKGQVPFCTSLAWSADGSTLFSGYTDGVIRVWGVGR  320



>gb|ACN41093.1| unknown [Picea sitchensis]
Length=321

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 11/118 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLD+G II++LCFSPNRYWLCAAT+  +KIWDLESKS+
Sbjct  214  CASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLCFSPNRYWLCAATQQCVKIWDLESKSV  273

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +            N   K ++ FCTSL+W+ADGSTLFSGYTDGVIRVWG+GR
Sbjct  274  VEELRPNF-----------NPTKKGQVPFCTSLAWSADGSTLFSGYTDGVIRVWGVGR  320



>ref|XP_001698065.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
 sp|P25387.1|GBLP_CHLRE RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Chlamydomonas reinhardtii]
 emb|CAA37638.1| putative protein has homology to G protein beta subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99650.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
Length=318

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG+ +LWDLAEGK+LYSLDAG +IH LCFSPNRYWLCAAT++SIKIWDLESKSI
Sbjct  209  CASGGKDGIAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRYWLCAATQSSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DLR           E N T+ K ++ +C SL+W+ADGSTL+SGYTDG IRVW +G 
Sbjct  269  VDDLR----------PEFNITSKKAQVPYCVSLAWSADGSTLYSGYTDGQIRVWAVGH  316



>ref|XP_004961307.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  LLWDL EGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +
Sbjct  224  CASGGKDGYTLLWDLTEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHV  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ D++             +KN+I++CTSLSW+ADGSTL++GYTDG IRVW I  +
Sbjct  284  VQDLKPDIQ------------ISKNQILYCTSLSWSADGSTLYTGYTDGSIRVWKISGF  330



>gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta 
[Eschscholzia californica]
Length=313

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 12/118 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSL AG IIHALCFSPNRYWLCAAT+  I+IWDLESKS+
Sbjct  208  CASGGKDGVILLWDLAEGKKLYSLPAGHIIHALCFSPNRYWLCAATQGDIQIWDLESKSL  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +L+ ++ Q             KNK+ +CTSL+W++DGSTLF+G+TDG IRV+ + R
Sbjct  268  VQELKPEVTQ------------GKNKMFYCTSLNWSSDGSTLFTGFTDGTIRVYAVSR  313



>ref|XP_006644561.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A-like [Oryza brachyantha]
Length=334

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK I
Sbjct  224  CASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHI  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ ++              +KN++++CTSL+W+ADGSTL++GYTDG IR++ I  +
Sbjct  284  VQDLKPEIP------------VSKNQMLYCTSLNWSADGSTLYAGYTDGTIRIYKISGF  330



>gb|EMS52917.1| Guanine nucleotide-binding protein subunit beta-like protein 
B [Triticum urartu]
Length=359

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 95/116 (82%), Gaps = 12/116 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFSPNRYWLCAATE S+KIWDLESK +
Sbjct  248  CASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFSPNRYWLCAATEESVKIWDLESKHV  307

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V DL+ +++             +KN++++CTSLSW+ADGSTL++GYTDG IRV+ I
Sbjct  308  VQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYTGYTDGTIRVFKI  351



>ref|XP_002945887.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
 gb|EFJ52882.1| hypothetical protein VOLCADRAFT_78914 [Volvox carteri f. nagariensis]
Length=318

 Score =   164 bits (416),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG +IH LCFSPNRYWLCAAT+++IKIWDLESKS+
Sbjct  209  CASGGKDGVAMLWDLAEGKRLYSLDAGDVIHCLCFSPNRYWLCAATQSTIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DL+V+           N T+ K ++ +C SL+W+ADGSTL+SGYTDG IRVW +  
Sbjct  269  VDDLKVEF----------NITSKKAQVPYCVSLAWSADGSTLYSGYTDGQIRVWAVSH  316



>ref|XP_001754916.1| predicted protein [Physcomitrella patens]
 gb|EDQ80370.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 93/118 (79%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+  IKIWDLESKS+
Sbjct  208  CASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQTCIKIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +    S+          K +I +C SL+W+ADGSTLFSGYTDG IRVW +GR
Sbjct  268  VDELRPEFTFVSK----------KAQIPYCVSLNWSADGSTLFSGYTDGHIRVWAVGR  315



>ref|NP_001043910.1| Os01g0686800 [Oryza sativa Japonica Group]
 sp|P49027.1|GBLPA_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; Short=GPB-LR; AltName: Full=RWD; AltName: Full=Receptor 
for activated C kinase 1A [Oryza sativa Japonica 
Group]
 dbj|BAA07404.1| q group of receptor for activated C-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF05824.1| Os01g0686800 [Oryza sativa Japonica Group]
 gb|EAY75412.1| hypothetical protein OsI_03315 [Oryza sativa Indica Group]
 gb|EAZ13132.1| hypothetical protein OsJ_03054 [Oryza sativa Japonica Group]
 dbj|BAG93799.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87442.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAGSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK I
Sbjct  224  CASGGKDGVTLLWDLAEGKRLYSLDAGSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHI  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ ++              +KN++++CTSL+W+ADGSTL++GYTDG IR++ I  +
Sbjct  284  VQDLKPEIP------------VSKNQMLYCTSLNWSADGSTLYAGYTDGTIRIYKISGF  330



>ref|XP_004969582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKD V LLWDL EGK+LY+LDAGSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK I
Sbjct  224  CASGGKDNVTLLWDLTEGKRLYALDAGSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHI  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLR ++            +A KN+I++CTSLSW+ADGSTL++GYTDG IR++ I  +
Sbjct  284  VQDLRPEV------------SAGKNQILYCTSLSWSADGSTLYAGYTDGTIRIFKISGF  330



>ref|XP_001780288.1| predicted protein [Physcomitrella patens]
 gb|EDQ54847.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 94/118 (80%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT++ IKIWDLESKS+
Sbjct  208  CASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQSCIKIWDLESKSV  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +    S+          K ++ +C SL+W+ADGSTLFSGYTDG IRVW +GR
Sbjct  268  VDELRPEFTFVSK----------KAQVPYCVSLNWSADGSTLFSGYTDGHIRVWAVGR  315



>ref|XP_001779496.1| predicted protein [Physcomitrella patens]
 gb|EDQ55672.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL+EGK+LYSLDAG IIH+LCFSPNRYWLCAAT++ IKIWDLESKSI
Sbjct  208  CASGGKDGVAMLWDLSEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQSCIKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +    S+          K +I +C SL+W+ADGSTLFSGYTDG IRVW +GR
Sbjct  268  VDELRPEFTFVSK----------KAQIPYCVSLNWSADGSTLFSGYTDGHIRVWAVGR  315



>dbj|BAJ90663.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06408.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 95/116 (82%), Gaps = 12/116 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDL+EGK+LY L+AGSIIH+LCFSPNRYWLCAATE SIKIWDLESK +
Sbjct  224  CASGGKDGVTLLWDLSEGKRLYQLEAGSIIHSLCFSPNRYWLCAATEESIKIWDLESKHV  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V DL+ +++             +KN++++CTSLSW+ADGSTL++GYTDG IRV+ I
Sbjct  284  VQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYTGYTDGTIRVFKI  327



>ref|XP_005847990.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
 gb|EFN55888.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
Length=319

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL+EGK+LYSLDA  IIH+LCFSPNRYWLCAAT+ SIKIWDLESKS+
Sbjct  210  CASGGKDGVAMLWDLSEGKRLYSLDATDIIHSLCFSPNRYWLCAATQGSIKIWDLESKSL  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +L + S+          K ++ +C  L+W+ADGSTL+SGYTDG+IRVW +GR
Sbjct  270  VDELRPELPERSK----------KAQVPYCVCLAWSADGSTLYSGYTDGLIRVWQVGR  317



>gb|AEF79971.1| receptor of activated protein kinase C 1 [Dunaliella salina]
Length=318

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 9/116 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAAT +SIKIWDLESKS+
Sbjct  209  CASGGKDGVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRYWLCAATSSSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V DLR +  +E +  A          + +C SL+W+ADGSTL+SGYTDG+IRVW +
Sbjct  269  VDDLRPEWNKEFKKKAT---------VPYCVSLAWSADGSTLYSGYTDGMIRVWNV  315



>gb|EMT00770.1| hypothetical protein F775_19376 [Aegilops tauschii]
Length=599

 Score =   167 bits (423),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 77/116 (66%), Positives = 95/116 (82%), Gaps = 12/116 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDL+EGK+LY L+AGSIIHALCFSPNRYWLCAATE S+KIWDLESK +
Sbjct  155  CASGGKDGVTLLWDLSEGKRLYQLEAGSIIHALCFSPNRYWLCAATEESVKIWDLESKHV  214

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V DL+ +++             +KN++++CTSLSW+ADGSTL++GYTDG IRV+ I
Sbjct  215  VQDLKPEVQ------------VSKNQMLYCTSLSWSADGSTLYTGYTDGTIRVFKI  258



>ref|XP_003567944.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=333

 Score =   162 bits (410),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 93/116 (80%), Gaps = 12/116 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LY L+AGSIIH+LCFSPNRYWLCAATE S+KIWDLESK +
Sbjct  222  CASGGKDGVTLLWDLAEGKRLYQLEAGSIIHSLCFSPNRYWLCAATEDSVKIWDLESKHV  281

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V DL+ + +             +KN++++CTSL W+ADGSTL++GYTDG IRV+ I
Sbjct  282  VQDLKPEFQ------------VSKNQMLYCTSLCWSADGSTLYTGYTDGTIRVFKI  325



>gb|AEO44580.1| receptor for activated C kinase 1 [Dunaliella salina]
Length=318

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 9/116 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKD V +LWDLAEGK+LYSLDAG IIHALCFSPNRYWLCAAT +SIKIWDLESKS+
Sbjct  209  CASGGKDNVGMLWDLAEGKRLYSLDAGDIIHALCFSPNRYWLCAATSSSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V DLR +  +E +  A          + +C SL+W+ADGSTL+SGYTDG+IRVW +
Sbjct  269  VDDLRPEWNKEFKKKAT---------VPYCVSLAWSADGSTLYSGYTDGMIRVWNV  315



>gb|EEC79656.1| hypothetical protein OsI_20897 [Oryza sativa Indica Group]
Length=312

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 94/122 (77%), Gaps = 15/122 (12%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  LLWDL EGK LY LDAG+IIH+LCFSPNRYWLCAATE S+KIWDLESK +
Sbjct  201  CASGGKDGTTLLWDLTEGKMLYKLDAGAIIHSLCFSPNRYWLCAATEDSVKIWDLESKLV  260

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW---GIG  208
            + DL+ +++            A K+++++CTSLSW+ADGSTLF+GYTDG IRVW   G G
Sbjct  261  MQDLKPEVQ------------AFKSQMLYCTSLSWSADGSTLFAGYTDGTIRVWKVSGFG  308

Query  207  RY  202
             Y
Sbjct  309  GY  310



>ref|XP_003569582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=331

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAEGK+LYSLDAG+II++LCFSPNRYWLCAAT+ SIKIWDLESK +
Sbjct  221  CASGGKDGVTLLWDLAEGKRLYSLDAGAIINSLCFSPNRYWLCAATQDSIKIWDLESKHV  280

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLR ++              +KN++++CT LSW+ADGSTL++GYTDG IR++ I  +
Sbjct  281  VQDLRPEVP------------VSKNQMLYCTCLSWSADGSTLYAGYTDGTIRIYKISGF  327



>ref|XP_004252271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solanum lycopersicum]
Length=301

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGVILLWDLAEGKKLYSLD+GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSI
Sbjct  209  CASGGKDGVILLWDLAEGKKLYSLDSGSIIHALCFSPNRYWLCAATESSIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSL  280
            VVDLRVDLKQE+EMS    +T+  +K  F  S 
Sbjct  269  VVDLRVDLKQETEMSGNATSTSGNSKTKFLASF  301



>ref|NP_001056254.1| Os05g0552300 [Oryza sativa Japonica Group]
 sp|Q6L4F8.1|GBLPB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; Short=GPB-LR; AltName: Full=Receptor for activated 
C kinase 1B [Oryza sativa Japonica Group]
 gb|AAT39277.1| putative guanine nucleotide-binding protein beta subunit [Oryza 
sativa Japonica Group]
 gb|AAT85192.1| putative guanine nucleotide binding protein beta subunit [Oryza 
sativa Japonica Group]
 dbj|BAF18168.1| Os05g0552300 [Oryza sativa Japonica Group]
 dbj|BAG88240.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89443.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64615.1| hypothetical protein OsJ_19467 [Oryza sativa Japonica Group]
Length=336

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 94/122 (77%), Gaps = 15/122 (12%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  LLWDL EGK LY LDAG+IIH+LCFSPNRYWLCAATE S+KIWDLESK +
Sbjct  225  CASGGKDGTTLLWDLTEGKMLYKLDAGAIIHSLCFSPNRYWLCAATEDSVKIWDLESKLV  284

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW---GIG  208
            + DL+ +++            A K+++++CTSLSW+ADGSTLF+GYTDG IRVW   G G
Sbjct  285  MQDLKPEVQ------------AFKSQMLYCTSLSWSADGSTLFAGYTDGTIRVWKVSGFG  332

Query  207  RY  202
             Y
Sbjct  333  GY  334



>gb|KDD72035.1| hypothetical protein H632_c3969p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=262

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 93/118 (79%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDLAEGK+LY+L+AG +IH+L FSPNRYWLCAAT++ IKIWDLE KS+
Sbjct  154  CASGGKDGSAMLWDLAEGKQLYTLEAGDVIHSLVFSPNRYWLCAATQSGIKIWDLEFKSV  213

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DLR +L + S          AK ++ +  SL+W+ADGSTL++GYTDGVIRVW +GR
Sbjct  214  VDDLRPELPERS----------AKAQVPYPISLTWSADGSTLYAGYTDGVIRVWQVGR  261



>emb|CEG00110.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=319

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 89/117 (76%), Gaps = 10/117 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+ +KIWDLESKSI
Sbjct  208  CASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATESCVKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V +LR +                K++  +CTSL W+ADGSTL++GYTD VIRVW +G
Sbjct  268  VDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTDNVIRVWSVG  314



>ref|XP_001421096.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422858.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99389.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01217.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
Length=321

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 89/117 (76%), Gaps = 10/117 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+ +KIWDLESKSI
Sbjct  208  CASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATESCVKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V +LR +                K++  +CTSL W+ADGSTL++GYTD VIRVW +G
Sbjct  268  VDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTDNVIRVWSVG  314



>ref|XP_006654750.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B-like [Oryza brachyantha]
Length=336

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 94/122 (77%), Gaps = 15/122 (12%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDL EGK LY L+AG+IIH+LCFSPNRYWLCAATE S+KIWDLESK +
Sbjct  225  CASGGKDGVTLLWDLTEGKMLYKLEAGAIIHSLCFSPNRYWLCAATEDSVKIWDLESKLV  284

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW---GIG  208
            + DL+ +++            A K++++ CTSLSW+ADGSTL++GYTDG IRVW   G G
Sbjct  285  MQDLKPEVQ------------AFKSQMLHCTSLSWSADGSTLYTGYTDGTIRVWKVSGFG  332

Query  207  RY  202
             Y
Sbjct  333  GY  334



>dbj|BAJ98167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDL EGK+LYSLDAGSII++LCFSPNRYWLCAAT+ SIKIWDLESK I
Sbjct  222  CASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFSPNRYWLCAATQDSIKIWDLESKHI  281

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLR ++   S+            ++++CT LSW+ADGSTL++GYTDG IR++ I  +
Sbjct  282  VQDLRPEVPVSSK------------QMLYCTCLSWSADGSTLYAGYTDGTIRIYKISGF  328



>ref|XP_003082627.1| GTP-binding regulatory protein beta chain homolog-Ch (ISS) [Ostreococcus 
tauri]
Length=483

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 89/117 (76%), Gaps = 10/117 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL EGK+LYSLDAG II+ LCFSPNRYWLCAATE+ +KIWDLESKSI
Sbjct  372  CASGGKDGVAMLWDLGEGKRLYSLDAGDIIYGLCFSPNRYWLCAATESCVKIWDLESKSI  431

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V +LR +                K++  +CTSL W+ADGSTL++GYTD VIRVW +G
Sbjct  432  VDELRPEFPP----------VGKKSQQPYCTSLQWSADGSTLYTGYTDNVIRVWSVG  478



>emb|CDM83867.1| unnamed protein product [Triticum aestivum]
Length=332

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDL EGK+LYSLDAGSII++LCFSPNRYWLCAAT+ SIKIWDLESK I
Sbjct  222  CASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLCFSPNRYWLCAATQDSIKIWDLESKHI  281

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLR ++              +  ++++CT LSW+ADGSTL++GYTDG IR++ I  +
Sbjct  282  VQDLRPEVP------------VSTKQMLYCTCLSWSADGSTLYAGYTDGTIRIYKISGF  328



>ref|XP_002456166.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
 gb|EES01286.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
Length=332

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 12/119 (10%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKD V LLWDL EGK+LY+LDAG IIH+LCFSPNRYWLCAAT+ SIKIWDLESK +
Sbjct  224  CASGGKDHVTLLWDLTEGKRLYALDAGDIIHSLCFSPNRYWLCAATQESIKIWDLESKHV  283

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DL+ ++            ++ K+++++CT LSW+ADGSTL++GYTDG IR++ I  Y
Sbjct  284  VQDLKPEV------------SSTKDQMLYCTCLSWSADGSTLYAGYTDGSIRIYKISAY  330



>ref|XP_003060952.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54602.1| predicted protein [Micromonas pusilla CCMP1545]
Length=325

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LY+LDAG II+ALCFSPNRYWLCAAT++ +KIWDLESKSI
Sbjct  208  CASGGKDGVAMLWDLAEGKRLYTLDAGDIIYALCFSPNRYWLCAATQSCVKIWDLESKSI  267

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V           E+  E      K+   FCTSL+W+ADG TLF+GYTD +IRVW + R
Sbjct  268  V----------DELHPEFPPVGKKSIPPFCTSLNWSADGGTLFTGYTDCLIRVWTVNR  315



>ref|XP_008811978.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A [Phoenix dactylifera]
Length=316

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 89/119 (75%), Gaps = 20/119 (17%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV LLWDLAE K     D G   H+LCFSPNRYWLCAAT+ S+KIWDLESKSI
Sbjct  218  CASGGKDGVTLLWDLAEEK-----DXG---HSLCFSPNRYWLCAATQDSVKIWDLESKSI  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLR +               +KN+I++CTSLSW+ADGSTLF+GYTDGVIRVWGI RY
Sbjct  270  VQDLRPE------------TPTSKNQILYCTSLSWSADGSTLFTGYTDGVIRVWGISRY  316



>ref|XP_005711409.1| receptor for activated protein kinase C [Chondrus crispus]
 emb|CDF41115.1| receptor for activated protein kinase C [Chondrus crispus]
Length=320

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 87/117 (74%), Gaps = 9/117 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL EGK LYSL+A  IIHALCFSPNRYWLCAAT + IKIWDLESK++
Sbjct  210  CASGGKDGVAMLWDLQEGKHLYSLEANDIIHALCFSPNRYWLCAATNSCIKIWDLESKTV  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V +LR D         +  +   K     C SL+W+ADGSTLFSGYTD VIRVWG+G
Sbjct  270  VDELRDD---------QAESIGKKAAQPACISLTWSADGSTLFSGYTDNVIRVWGVG  317



>ref|XP_002502835.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64093.1| predicted protein [Micromonas sp. RCC299]
Length=324

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG II+ALCFSPNRYWLCAAT++ +KIWDLESKSI
Sbjct  209  CASGGKDGVAMLWDLAEGKRLYSLDAGDIIYALCFSPNRYWLCAATQSCVKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V           E+  E      K+   FCTSL W++DG+TLF+GYTD  IRVW + R
Sbjct  269  V----------DELHPEFPPVGKKSIPPFCTSLQWSSDGATLFTGYTDCQIRVWTVSR  316



>ref|XP_005652002.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27458.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LY+L+AG IIHALCFSPNRYWLCAAT   IKIWDLESKSI
Sbjct  209  CASGGKDGVAMLWDLAEGKRLYNLEAGEIIHALCFSPNRYWLCAATTNCIKIWDLESKSI  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V +L+ D  +             K ++ +C SL+W+ADG+TL+SGYT+G I VWG+
Sbjct  269  VDELKPDFGE----------LGKKAQVPYCVSLAWSADGATLYSGYTNGKIEVWGV  314



>gb|KIY98327.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Monoraphidium neglectum]
Length=319

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 9/114 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG IIH+L FSPNRYWLCAAT+ SIKIWDLESKS+
Sbjct  209  CASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLVFSPNRYWLCAATQTSIKIWDLESKSV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  217
            V DLR +  +             K  I +C SL+W+ADGSTL++GY+DG IRV+
Sbjct  269  VDDLRPEFSK---------TFGKKATIPYCVSLAWSADGSTLYAGYSDGDIRVF  313



>ref|XP_002967499.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
 gb|EFJ32098.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
Length=315

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 13/118 (11%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+  +KIWDLESK+I
Sbjct  211  CASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQQCVKIWDLESKNI  270

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +++ +               +K +  +CT+L+W+ DGS LF+GYTDGVIRV  +G 
Sbjct  271  VEEIKPE-------------QVSKKEPTYCTTLNWSMDGSKLFAGYTDGVIRVHSVGH  315



>dbj|GAN11178.1| hypothetical protein MAM1_0495d10736 [Mucor ambiguus]
Length=136

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT   IKIWDLESKS+
Sbjct  26   CASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATANGIKIWDLESKSV  85

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DLR +  Q  +          KN    C S+ W+ADG+TLFSGY+D VIRVW + R
Sbjct  86   VDDLRPEFPQLGKR---------KNPDPDCLSVCWSADGATLFSGYSDNVIRVWQVTR  134



>ref|XP_002960209.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
 gb|EFJ37748.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
Length=310

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 18/118 (15%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG IIH+LCFSPNRYWLCAAT+  +KIWDLESK+I
Sbjct  211  CASGGKDGVAMLWDLAEGKRLYSLDAGDIIHSLCFSPNRYWLCAATQQCVKIWDLESKNI  270

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +++ +                  +  +CT+L+W+ DGS LF+GYTDGVIRV  +G 
Sbjct  271  VEEIKPE------------------QPTYCTTLNWSMDGSKLFAGYTDGVIRVHSVGH  310



>emb|CEG76293.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=278

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 86/118 (73%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT   IKIWDLE+KSI
Sbjct  168  CASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATANGIKIWDLETKSI  227

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D +IRVW + R
Sbjct  228  VDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSDNIIRVWQVTR  276



>ref|XP_011397272.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
 gb|KFM24384.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
Length=317

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 11/118 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL+ GK LYSLDAG++I+AL FSPNRYWLCAAT+  IKIWDLE KS+
Sbjct  210  CASGGKDGVAMLWDLSVGKHLYSLDAGNVINALVFSPNRYWLCAATDRGIKIWDLEYKSV  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DL   L        EG   A + K +   SL+W+ADG+TL+SGYTDGVIRVW +GR
Sbjct  270  VDDLDAPL--------EGVEAAKQPKPV---SLAWSADGATLYSGYTDGVIRVWAVGR  316



>emb|CCI48432.1| unnamed protein product [Albugo candida]
Length=318

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 9/117 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + IKIWDLESK++
Sbjct  210  CASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATSSGIKIWDLESKAV  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V +L  DL+      A         ++  C SL+W+ADGS LFSGYTDG++RVW +G
Sbjct  270  VHELNPDLEPPKGKYA---------RVPHCVSLAWSADGSILFSGYTDGIVRVWAVG  317



>dbj|GAN10996.1| guanine nucleotide-binding protein [Mucor ambiguus]
Length=259

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT   IKIWDLESKS+
Sbjct  149  CASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATANGIKIWDLESKSV  208

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DLR +  Q  +          KN    C S+ W+ADG+TLFSGY+D VIRVW + R
Sbjct  209  VDDLRPEFPQLGKR---------KNPDPDCLSVCWSADGATLFSGYSDNVIRVWQVTR  257



>emb|CCA26420.1| guanine nucleotidebinding protein subunit beta2like protein putative 
[Albugo laibachii Nc14]
Length=318

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 9/117 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + IKIWDLESK++
Sbjct  210  CASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATSSGIKIWDLESKAV  269

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V +L  DL+      A         ++  C SL+W+ADGS LFSGYTDG++RVW +G
Sbjct  270  VHELNPDLEPPKGKYA---------RVPHCVSLAWSADGSILFSGYTDGIVRVWAVG  317



>ref|XP_006679085.1| hypothetical protein BATDEDRAFT_33248 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80461.1| hypothetical protein BATDEDRAFT_33248 [Batrachochytrium dendrobatidis 
JAM81]
Length=315

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL +GK LYSL+AG II AL FSPNRYWLCAA+ + IKIWDLESKS+
Sbjct  207  CASGGKDGVTMLWDLNDGKHLYSLEAGDIISALVFSPNRYWLCAASGSGIKIWDLESKSV  266

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V DL+ D   + +          K+ +  C SL+W+ADG TLFSG+TD VIRVW + R
Sbjct  267  VADLKPDFAPQGK----------KSTVPQCISLAWSADGQTLFSGHTDNVIRVWQVTR  314



>emb|CEG67117.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI95133.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI93908.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=316

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 86/118 (73%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT   IKIWDLE+KSI
Sbjct  206  CASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATANGIKIWDLETKSI  265

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D +IRVW + R
Sbjct  266  VDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSDNIIRVWQVTR  314



>gb|EIE78732.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Rhizopus 
delemar RA 99-880]
Length=311

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 86/118 (73%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSLDAGS++HAL FSPNRYWLCAAT   IKIWDLE+KSI
Sbjct  201  CASAGKDGVVMLWDLNDAKHLYSLDAGSVVHALTFSPNRYWLCAATANGIKIWDLETKSI  260

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +  Q  +          KN    C S++W+ADG+TLFSGY+D +IRVW + R
Sbjct  261  VDELRPEFAQLGKR---------KNPDPECLSVAWSADGATLFSGYSDNIIRVWQVTR  309



>ref|XP_007508318.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20422.1| predicted protein [Bathycoccus prasinos]
Length=318

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 10/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDLAEGK+LYSLDAG II+++CFSPNRYWLCAAT++ +KIWDLESKSI
Sbjct  207  CASGGKDGVAMLWDLAEGKRLYSLDAGDIIYSMCFSPNRYWLCAATQSCVKIWDLESKSI  266

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V           E+  E      K+    CTSL W+ADG TL++GY+D  +RV+ + R
Sbjct  267  V----------DELHPEFPPVGKKSMPPHCTSLQWSADGQTLYTGYSDNKVRVYVVSR  314



>ref|XP_006875415.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Chrysochloris asiatica]
Length=187

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  77   CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  135

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  136  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLMRVWQV  182



>ref|XP_002903189.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 ref|XP_008893306.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|EEY55613.1| guanine nucleotide-binding protein subunit beta-2-like protein 
[Phytophthora infestans T30-4]
 gb|ETK85071.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL38496.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETL91623.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica]
 gb|ETN21521.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica INRA-310]
 gb|ETO73708.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica P1976]
 gb|ETP14913.1| guanine nucleotide-binding protein subunit beta-like protein 
[Phytophthora parasitica CJ01A1]
Length=317

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 9/117 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + IKIWDLESK +
Sbjct  209  CASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTSGIKIWDLESKIV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTDG++RVW +G
Sbjct  269  VHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTDGIVRVWAVG  316



>ref|XP_004343796.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE96804.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
Length=316

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 88/119 (74%), Gaps = 10/119 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL EGK LY+L+AG  I+AL FSPNRYWLCAA+ ASIKIWDLESK++
Sbjct  207  CASGGKDGVAMLWDLNEGKHLYTLEAGDEINALVFSPNRYWLCAASGASIKIWDLESKNL  266

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  202
            V DLR           E  +   K+++  C SL+W+ADG TLF+GYTD VIRVW + R+
Sbjct  267  VDDLR----------PEFLSVGKKSQLPQCISLAWSADGQTLFAGYTDNVIRVWQVTRH  315



>ref|XP_004696065.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide binding protein 
(G protein), beta polypeptide 2-like 1 [Condylura cristata]
Length=271

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  161  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  219

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  220  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266



>gb|ETM44908.1| guanine nucleotide-binding protein subunit beta-like protein, 
partial [Phytophthora parasitica]
Length=334

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 9/117 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + IKIWDLESK +
Sbjct  226  CASGGKDGTANLWDLNEGKRLYSLVAGDVIHALIFSPNRYWLCAATTSGIKIWDLESKIV  285

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V DL+ ++++     A+  +         C SL+W+ADGS LFSGYTDG++RVW +G
Sbjct  286  VHDLQPEIEEPKGKYAQPPH---------CISLAWSADGSVLFSGYTDGIVRVWAVG  333



>gb|EDL33790.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_a [Mus musculus]
 gb|EDM04194.1| rCG34190, isoform CRA_b [Rattus norvegicus]
Length=228

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  118  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  176

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  177  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  223



>gb|EPB90862.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=311

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT   IKIWDLESKSI
Sbjct  201  CASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATANGIKIWDLESKSI  260

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +  Q  +          KN    C S+ W+ADG+TLFSGY+D VIRVW + R
Sbjct  261  VDELRPEFAQLGKR---------KNPDPDCLSVCWSADGATLFSGYSDNVIRVWQVTR  309



>ref|XP_009531042.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
 gb|EGZ13613.1| hypothetical protein PHYSODRAFT_355000 [Phytophthora sojae]
Length=317

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 9/117 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG   LWDL EGK+LYSL AG +IHAL FSPNRYWLCAAT + IKIWDLESK +
Sbjct  209  CASGGKDGTANLWDLNEGKRLYSLVAGDVIHALVFSPNRYWLCAATTSGIKIWDLESKIV  268

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V DL+ ++++     A+  +         C SL+W+ADG+ LFSGYTDG++RVW +G
Sbjct  269  VHDLQPEVEEPKGKYAQPPH---------CISLAWSADGTVLFSGYTDGIVRVWAVG  316



>ref|XP_007527211.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Erinaceus europaeus]
Length=271

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  161  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  219

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  220  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266



>ref|XP_005977784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like isoform X2 [Pantholops hodgsonii]
Length=271

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  161  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  219

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  220  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266



>ref|XP_005891160.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Bos mutus]
Length=271

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  161  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  219

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  220  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266



>gb|AAR24619.1| proliferation-inducing gene 21 [Homo sapiens]
Length=271

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  161  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  219

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  220  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266



>gb|EAW53697.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_f [Homo sapiens]
Length=228

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  118  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  176

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  177  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  223



>gb|ERE68979.1| guanine nucleotide-binding protein subunit beta-2-like 1-like 
protein [Cricetulus griseus]
Length=235

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  125  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  183

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  184  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  230



>ref|XP_009576203.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Fulmarus glacialis]
Length=223

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  113  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  171

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  172  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  218



>ref|XP_006746631.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Leptonychotes weddellii]
Length=271

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  161  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  219

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  220  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266



>gb|KDO24030.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
parasitica CBS 223.65]
Length=230

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 10/117 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDGV +LWDL EGK+LY+L+AG IIHAL FSPNRYWLCAAT + IKIWDLESK +
Sbjct  122  CASGGKDGVAMLWDLNEGKRLYTLEAGDIIHALVFSPNRYWLCAATSSGIKIWDLESK-V  180

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            VVD         E+  E      K+    C SL W+ADG++LF+GYTDG++RV+ +G
Sbjct  181  VVD---------EIVPEFEAVGKKSLPPHCVSLCWSADGASLFAGYTDGIVRVYAVG  228



>gb|ELK03178.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Pteropus 
alecto]
Length=251

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  141  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  199

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  200  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  246



>gb|KFM07186.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Aptenodytes forsteri]
 gb|KFW05064.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Fulmarus glacialis]
Length=224

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  114  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  172

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  173  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  219



>ref|XP_009277073.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Aptenodytes forsteri]
Length=240

 Score =   141 bits (356),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  130  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  188

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  189  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  235



>gb|EWM27643.1| guanine nucleotide binding protein [Nannochloropsis gaditana]
Length=314

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNRYWLCAAT   IKIWDLESK +
Sbjct  206  CASGGKDGTAMLWDLNEGKRLYSLDAGDIIHSLVFSPNRYWLCAATSQGIKIWDLESKDM  265

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V  L      + +   +G ++ +     +CTSL+W+ADG TLFSGYTDG IR W +
Sbjct  266  VDHL------QPKWPVQGKHSLSPQP--YCTSLAWSADGQTLFSGYTDGKIRCWSV  313



>emb|CEP08121.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL E K LYSL+AGS++HAL FSPNRYWLCAAT   IKIWDLESKS+
Sbjct  206  CASAGKDGVVMLWDLNEAKHLYSLEAGSLVHALTFSPNRYWLCAATATGIKIWDLESKSL  265

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +  Q  +          KN    C S+ W++DG+TLFSGY+D +IRVW + R
Sbjct  266  VDELRPEFPQLGKR---------KNPDPDCLSVCWSSDGATLFSGYSDNIIRVWQVTR  314



>gb|ABY75292.1| putative guanine nucleotide binding protein beta polypeptide 
2-like 1 protein [Ovis aries]
Length=227

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  117  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  175

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  176  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  222



>gb|EPQ05298.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Myotis 
brandtii]
Length=256

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  146  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  204

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  205  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  251



>emb|CEP13972.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 85/118 (72%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT   IKIWDLESKSI
Sbjct  206  CASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATANGIKIWDLESKSI  265

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +  Q  +          KN    C S+ W+ADG+TLFSGY+D +IRVW + R
Sbjct  266  VDELRPEFPQLGKR---------KNPDPDCLSVCWSADGATLFSGYSDNIIRVWQVTR  314



>ref|XP_004657524.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Jaculus jaculus]
Length=267

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  157  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  215

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  216  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  262



>dbj|BAE39095.1| unnamed protein product [Mus musculus]
Length=232

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  122  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  180

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  181  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  227



>ref|XP_009037831.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
 gb|EGB07194.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
Length=319

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 10/117 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK+LYSLDAG +IH+L FSPNRYWLCAAT   +KIWDLESK +
Sbjct  212  CASGGKDGTAMLWDLNEGKRLYSLDAGDVIHSLVFSPNRYWLCAATTLGVKIWDLESKVV  271

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  208
            V +L+       E  A G N        +CT + W+ADG+ LFSGYTDG+IR W +G
Sbjct  272  VDELK------PEFPAMGKNATPP----YCTCICWSADGAVLFSGYTDGLIRAWHVG  318



>ref|XP_008063710.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tarsius syrichta]
Length=262

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  152  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  210

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  211  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  257



>ref|XP_009665514.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Struthio camelus australis]
 gb|KFV77245.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Struthio camelus australis]
Length=168

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LW+L EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  58   CASGGKDGQAMLWELNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  116

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  117  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  163



>dbj|BAG53102.1| unnamed protein product [Homo sapiens]
Length=275

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  165  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  223

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  224  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  270



>ref|XP_002804718.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Macaca mulatta]
Length=279

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  169  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  227

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  228  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  274



>gb|EPB88453.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=328

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 85/118 (72%), Gaps = 9/118 (8%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CAS GKDGV++LWDL + K LYSL+AGS++HAL FSPNRYWLCAAT   IKIWDLESKSI
Sbjct  218  CASAGKDGVVMLWDLNDAKHLYSLEAGSLVHALTFSPNRYWLCAATANGIKIWDLESKSI  277

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  205
            V +LR +  Q  +          KN    C S+ W+ADG+TLFSGY+D +IRVW + R
Sbjct  278  VDELRPEFAQLGKR---------KNPDPDCLSVCWSADGATLFSGYSDNIIRVWQVTR  326



>ref|XP_005989393.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Latimeria chalumnae]
Length=317

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  207  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKII  266

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V +LR           E  +T++K +   CTSL+W+ADG TLF+GYTD +IRVW +
Sbjct  267  VDELR----------QEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVWQV  312



>gb|KHN44614.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=309

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -2

Query  555  ASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIV  376
            ASGGKDGV+LLWD+A G K+Y  + GS++H L FSPNRYW+C AT+ S+++WDLES SI+
Sbjct  192  ASGGKDGVVLLWDMAGGVKIYEFEVGSVVHGLWFSPNRYWMCIATDESVRVWDLESNSII  251

Query  375  VDLRVDLKQESEMSAE-GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
             DL V+   +       G    A NK I+CTS++W+ADG+TLF GYTDG+IR+W +
Sbjct  252  KDLNVNGNNDHYNYINGGTEITANNKDIYCTSMNWDADGNTLFCGYTDGLIRIWEV  307



>gb|KFW73927.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Phalacrocorax carbo]
Length=280

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  170  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  228

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  229  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  275



>ref|XP_004586327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ochotona princeps]
Length=307

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  197  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  255

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  256  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  302



>ref|XP_009805348.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-2-like 1, partial [Gavia stellata]
Length=283

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  173  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  231

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  232  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  278



>ref|XP_003530054.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B-like [Glycine max]
Length=340

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -2

Query  555  ASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIV  376
            ASGGKDGV+LLWD+A G K+Y  + GS++H L FSPNRYW+C AT+ S+++WDLES SI+
Sbjct  223  ASGGKDGVVLLWDMAGGVKIYEFEVGSVVHGLWFSPNRYWMCIATDESVRVWDLESNSII  282

Query  375  VDLRVDLKQESEMSAE-GNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
             DL V+   +       G    A NK I+CTS++W+ADG+TLF GYTDG+IR+W +
Sbjct  283  KDLNVNGNNDHYNYVNGGTEITANNKDIYCTSMNWDADGNTLFCGYTDGLIRIWEV  338



>ref|XP_006147504.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tupaia chinensis]
Length=262

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  152  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  210

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  211  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  257



>ref|XP_005062497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ficedula albicollis]
Length=289

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G +I+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  179  CASGGKDGQAMLWDLNEGKHLYTLDGGDVINALCFSPNRYWLCAATGPSIKIWDLEGK-I  237

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  238  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  284



>ref|XP_009080129.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Acanthisitta chloris]
Length=236

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  126  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  184

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  185  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  231



>ref|XP_009513424.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Phalacrocorax carbo]
Length=292

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  182  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  240

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  241  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  287



>gb|KFP61115.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Cariama cristata]
Length=300

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  190  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  248

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  249  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  295



>ref|XP_008325350.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Cynoglossus semilaevis]
Length=317

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD+G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  207  CASGGKDGQAMLWDLNEGKHLYTLDSGDIINALCFSPNRYWLCAATGPSIKIWDLEGKII  266

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +IRVW +
Sbjct  267  VDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVWQV  312



>ref|XP_002286095.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
 gb|EED95736.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
Length=326

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK+LYSLDAG IIH+L FSPNRYWLCAAT+  IKIWDLESK +
Sbjct  213  CASGGKDGTAMLWDLNEGKRLYSLDAGEIIHSLVFSPNRYWLCAATDECIKIWDLESKVV  272

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVW  217
            V  LR    +E ++  E     A+     CTSL+W+ADGSTLF+GY+D VIRV+
Sbjct  273  VDTLR---PEEFDLGNEEGTGHARAP--HCTSLAWSADGSTLFAGYSDKVIRVY  321



>ref|XP_009922131.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Haliaeetus albicilla]
Length=291

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  181  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  239

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  240  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  286



>ref|XP_009701898.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Cariama cristata]
Length=301

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  191  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  249

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  250  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  296



>gb|KFQ96249.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Nipponia nippon]
Length=291

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  181  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  239

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  240  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  286



>ref|XP_005795376.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Xiphophorus maculatus]
Length=317

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD+G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  207  CASGGKDGQAMLWDLNEGKHLYTLDSGDIINALCFSPNRYWLCAATGPSIKIWDLEGKII  266

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            V +LR           E  +T +K +   CTSL+W+ADG TLF+GYTD +IRVW +
Sbjct  267  VDELR----------QEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVWQV  312



>ref|XP_009462428.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Nipponia nippon]
Length=307

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  197  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  255

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  256  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  302



>ref|XP_005018374.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Anas platyrhynchos]
Length=351

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  241  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  299

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  300  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  346



>gb|KFQ66729.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Pelecanus crispus]
Length=291

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  181  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  239

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  240  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  286



>ref|XP_010223334.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Tinamus guttatus]
Length=276

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  166  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  224

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  225  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  271



>gb|KFP96911.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Haliaeetus albicilla]
Length=287

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  177  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  235

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  236  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  282



>ref|XP_009448630.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X3 [Pan troglodytes]
 gb|EAW53695.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_d [Homo sapiens]
 gb|EOB02165.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Anas 
platyrhynchos]
Length=276

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  166  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  224

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  225  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  271



>gb|KFQ89059.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Phoenicopterus ruber ruber]
Length=290

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  180  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  238

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  239  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  285



>ref|XP_007070338.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Chelonia mydas]
Length=282

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  172  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  230

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  231  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  277



>gb|EDL33792.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_c [Mus musculus]
Length=264

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  154  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  212

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  213  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  259



>dbj|BAB28114.1| unnamed protein product [Mus musculus]
Length=280

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  170  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  228

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  229  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  275



>gb|KGL84405.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Tinamus guttatus]
Length=279

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  169  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  227

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  228  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  274



>ref|XP_005234127.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-2-like 1 [Falco peregrinus]
Length=310

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  200  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  258

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  259  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  305



>gb|KFO08948.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Balearica regulorum gibbericeps]
Length=291

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  181  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  239

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  240  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  286



>ref|XP_010296751.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Balearica regulorum gibbericeps]
Length=286

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  176  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  234

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  235  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  281



>ref|XP_009995617.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Chaetura pelagica]
Length=291

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  181  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  239

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD         E+  E  +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  240  IVD---------ELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  286



>gb|EAW53699.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_h [Homo sapiens]
Length=365

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = -2

Query  558  CASGGKDGVILLWDLAEGKKLYSLDAGSIIHALCFSPNRYWLCAATEASIKIWDLESKSI  379
            CASGGKDG  +LWDL EGK LY+LD G II+ALCFSPNRYWLCAAT  SIKIWDLE K I
Sbjct  255  CASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGK-I  313

Query  378  VVDLRVDLKQESEMSAEGNNTAAKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGI  211
            +VD   +LKQE        +T++K +   CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  314  IVD---ELKQEVI------STSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840