BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050P13

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB30572.1|  hypothetical protein B456_005G149900                  95.9    3e-20   Gossypium raimondii
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                          97.8    3e-20   
emb|CDM86692.1|  unnamed protein product                              96.7    5e-20   Triticum aestivum [Canadian hard winter wheat]
emb|CDM86696.1|  unnamed protein product                              96.7    5e-20   Triticum aestivum [Canadian hard winter wheat]
gb|KJB30571.1|  hypothetical protein B456_005G149900                  96.7    6e-20   Gossypium raimondii
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                          95.1    6e-20   
gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                92.4    6e-20   Citrus sinensis [apfelsine]
emb|CDM86687.1|  unnamed protein product                              95.9    9e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.9    1e-19   Oryza brachyantha
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                          94.7    2e-19   Triticum urartu
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12          95.1    2e-19   Glycine max [soybeans]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  94.7    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    4e-19   Cicer arietinum [garbanzo]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                     93.6    6e-19   
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12          94.0    6e-19   Phoenix dactylifera
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg           94.0    6e-19   Citrus clementina [clementine]
gb|AAR00628.1|  putative MATE family protein                          92.4    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2  93.6    7e-19   
ref|XP_007026054.1|  MATE efflux family protein isoform 1             93.6    7e-19   
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.6    7e-19   Populus euphratica
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.2    9e-19   Populus euphratica
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.8    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC75604.1|  hypothetical protein OsI_12313                        92.8    1e-18   Oryza sativa Indica Group [Indian rice]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                 92.8    1e-18   Citrus sinensis [apfelsine]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg           92.8    1e-18   Citrus clementina [clementine]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  92.8    1e-18   Pyrus x bretschneideri [bai li]
ref|NP_001050520.1|  Os03g0570800                                     92.8    1e-18   
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.8    1e-18   Citrus sinensis [apfelsine]
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.4    1e-18   Fragaria vesca subsp. vesca
emb|CBI28940.3|  unnamed protein product                              87.0    1e-18   Vitis vinifera
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g           89.4    1e-18   
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like  89.0    2e-18   
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  91.3    2e-18   Populus euphratica
ref|XP_007045633.1|  MATE efflux family protein isoform 1             92.0    2e-18   
emb|CDM86680.1|  unnamed protein product                              90.9    2e-18   Triticum aestivum [Canadian hard winter wheat]
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein            92.0    2e-18   Gossypium arboreum [tree cotton]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12          92.0    2e-18   Solanum lycopersicum
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  90.9    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.0    3e-18   
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    3e-18   Cicer arietinum [garbanzo]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026056.1|  MATE efflux family protein                       91.7    3e-18   
gb|AFW68307.1|  putative MATE efflux family protein                   90.5    4e-18   
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  91.3    4e-18   Populus euphratica
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  91.3    4e-18   Brachypodium distachyon [annual false brome]
emb|CDP11780.1|  unnamed protein product                              91.3    5e-18   Coffea canephora [robusta coffee]
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                          90.1    5e-18   
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                          90.1    5e-18   Triticum urartu
ref|NP_001148084.1|  transparent testa 12 protein                     91.3    5e-18   Zea mays [maize]
gb|KJB69293.1|  hypothetical protein B456_011G014800                  91.3    5e-18   Gossypium raimondii
gb|ACF85423.1|  unknown                                               90.9    5e-18   Zea mays [maize]
gb|ACZ55932.1|  MATE transporter 2                                    90.9    5e-18   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                    90.9    6e-18   Zea mays [maize]
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12          90.5    9e-18   Solanum lycopersicum
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.5    9e-18   Elaeis guineensis
ref|XP_003596992.1|  Transparent testa 12 protein                     90.5    9e-18   Medicago truncatula
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g           90.1    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g           90.1    1e-17   
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12          90.1    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    1e-17   Populus euphratica
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                          89.7    1e-17   
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.1    1e-17   Elaeis guineensis
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  89.7    1e-17   Vitis vinifera
emb|CDM86677.1|  unnamed protein product                              89.7    1e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12          89.7    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.7    2e-17   Setaria italica
ref|XP_002883313.1|  mate efflux family protein                       89.4    2e-17   
ref|NP_188806.1|  MATE efflux family protein                          89.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140        89.4    2e-17   Sorghum bicolor [broomcorn]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12          89.4    2e-17   Vitis vinifera
gb|AAM20595.1|  integral membrane protein, putative                   89.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.4    2e-17   Pyrus x bretschneideri [bai li]
emb|CBI28938.3|  unnamed protein product                              88.6    2e-17   Vitis vinifera
ref|XP_002518492.1|  multidrug resistance pump, putative              89.4    2e-17   Ricinus communis
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g           89.4    2e-17   Phaseolus vulgaris [French bean]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    2e-17   
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.4    2e-17   Solanum tuberosum [potatoes]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12          89.0    2e-17   Vitis vinifera
emb|CDP11781.1|  unnamed protein product                              88.6    2e-17   Coffea canephora [robusta coffee]
emb|CAN73203.1|  hypothetical protein VITISV_008169                   86.7    3e-17   Vitis vinifera
gb|ACL53378.1|  unknown                                               88.6    3e-17   Zea mays [maize]
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  89.0    3e-17   
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                          89.0    3e-17   Glycine soja [wild soybean]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    3e-17   Glycine max [soybeans]
emb|CBI28937.3|  unnamed protein product                              89.0    3e-17   Vitis vinifera
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    3e-17   Nicotiana sylvestris
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g           88.6    3e-17   
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.6    4e-17   Sesamum indicum [beniseed]
gb|KJB57729.1|  hypothetical protein B456_009G178100                  86.7    5e-17   Gossypium raimondii
emb|CDX94061.1|  BnaC07g36950D                                        88.2    5e-17   
emb|CDX98711.1|  BnaA03g44960D                                        88.2    5e-17   
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410        87.8    5e-17   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    5e-17   Brassica rapa
gb|ACF85024.1|  unknown                                               85.1    5e-17   Zea mays [maize]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    5e-17   Setaria italica
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                          88.2    6e-17   Triticum urartu
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    6e-17   Cucumis melo [Oriental melon]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.8    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002886501.1|  mate efflux family protein                       87.8    7e-17   
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg              87.8    7e-17   Erythranthe guttata [common monkey flower]
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    1e-16   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    1e-16   Nicotiana sylvestris
gb|KDP20758.1|  hypothetical protein JCGZ_21229                       87.4    1e-16   Jatropha curcas
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                          87.4    1e-16   Glycine soja [wild soybean]
dbj|BAH20308.1|  AT1G61890                                            85.1    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    1e-16   Malus domestica [apple tree]
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    1e-16   Brassica rapa
emb|CDX76391.1|  BnaA08g10090D                                        87.4    1e-16   
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.4    1e-16   Cicer arietinum [garbanzo]
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    1e-16   Camelina sativa [gold-of-pleasure]
emb|CDY34833.1|  BnaA09g47590D                                        86.7    1e-16   Brassica napus [oilseed rape]
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.0    1e-16   
gb|KJB57728.1|  hypothetical protein B456_009G178100                  87.0    1e-16   Gossypium raimondii
gb|KJB57730.1|  hypothetical protein B456_009G178100                  87.0    1e-16   Gossypium raimondii
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.0    1e-16   Cicer arietinum [garbanzo]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein         87.0    1e-16   Nicotiana tabacum [American tobacco]
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  86.7    1e-16   Nicotiana tomentosiformis
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.0    2e-16   Nicotiana tomentosiformis
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.0    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    2e-16   Cucumis melo [Oriental melon]
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...  83.2    2e-16   Nicotiana alata [flowering tobacco]
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    2e-16   Cucumis sativus [cucumbers]
ref|NP_001147791.1|  transparent testa 12 protein                     86.7    2e-16   Zea mays [maize]
gb|AHI48506.1|  multidrug and toxic extrusion transporter             86.7    2e-16   Vaccinium corymbosum [American blueberry]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    2e-16   Fragaria vesca subsp. vesca
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12          86.7    2e-16   Tarenaya hassleriana [spider flower]
ref|NP_001149176.1|  transparent testa 12 protein                     86.7    2e-16   Zea mays [maize]
emb|CDY47166.1|  BnaA01g22920D                                        86.7    2e-16   Brassica napus [oilseed rape]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    2e-16   Brassica rapa
tpg|DAA50100.1|  TPA: putative MATE efflux family protein             86.7    2e-16   
ref|NP_564787.1|  MATE efflux family protein                          86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12          86.7    2e-16   
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    2e-16   
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    2e-16   Elaeis guineensis
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12          86.3    3e-16   Brassica rapa
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    3e-16   Eucalyptus grandis [rose gum]
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    3e-16   Camelina sativa [gold-of-pleasure]
emb|CDY25329.1|  BnaC01g29980D                                        85.9    3e-16   Brassica napus [oilseed rape]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein            86.3    3e-16   Gossypium arboreum [tree cotton]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  85.9    3e-16   Nicotiana tomentosiformis
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g           85.9    3e-16   Phaseolus vulgaris [French bean]
emb|CDY19507.1|  BnaC09g13960D                                        85.9    3e-16   Brassica napus [oilseed rape]
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg           85.9    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.9    3e-16   Brassica rapa
emb|CDY12916.1|  BnaA09g13580D                                        85.9    3e-16   Brassica napus [oilseed rape]
emb|CBI23253.3|  unnamed protein product                              83.2    3e-16   Vitis vinifera
gb|AAK82541.1|  At1g61890/F8K4_9                                      85.9    3e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDP04390.1|  unnamed protein product                              85.5    3e-16   Coffea canephora [robusta coffee]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.9    4e-16   Populus euphratica
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    4e-16   Solanum tuberosum [potatoes]
emb|CDY27434.1|  BnaC03g64740D                                        85.5    4e-16   Brassica napus [oilseed rape]
ref|XP_002867813.1|  mate efflux family protein                       85.5    4e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.9    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.9    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.1    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg           84.3    5e-16   
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g           85.5    5e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    5e-16   Elaeis guineensis
emb|CBI23254.3|  unnamed protein product                              84.7    5e-16   Vitis vinifera
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    5e-16   Sesamum indicum [beniseed]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    5e-16   Glycine max [soybeans]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    5e-16   
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg           85.5    5e-16   Capsella rubella
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                          85.5    5e-16   Glycine soja [wild soybean]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    5e-16   Prunus mume [ume]
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                  85.1    5e-16   Arabis alpina [alpine rockcress]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12          85.1    6e-16   Vitis vinifera
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                          84.7    6e-16   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.1    6e-16   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.1    6e-16   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.1    6e-16   
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  85.1    6e-16   Nicotiana sylvestris
dbj|BAJ34540.1|  unnamed protein product                              85.1    7e-16   Eutrema halophilum
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.1    7e-16   
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  84.7    7e-16   
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    7e-16   
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg           84.7    7e-16   Capsella rubella
emb|CDY07257.1|  BnaC04g19140D                                        82.8    8e-16   
emb|CAN82750.1|  hypothetical protein VITISV_014577                   84.0    9e-16   Vitis vinifera
ref|XP_003605914.1|  Transparent testa 12 protein                     84.7    9e-16   Medicago truncatula
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                   83.6    9e-16   Eucalyptus grandis [rose gum]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    9e-16   Nicotiana tomentosiformis
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    1e-15   
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.3    1e-15   Solanum lycopersicum
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.3    1e-15   Solanum lycopersicum
gb|AAM62936.1|  unknown                                               84.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567640.1|  MATE efflux family protein                          84.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720        84.0    1e-15   Sorghum bicolor [broomcorn]
emb|CDY34637.1|  BnaC08g41960D                                        84.0    1e-15   Brassica napus [oilseed rape]
dbj|BAH19969.1|  AT4G21910                                            84.0    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                          84.0    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12          84.0    1e-15   
gb|EEC75606.1|  hypothetical protein OsI_12318                        84.0    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    2e-15   Vitis vinifera
gb|ABF97209.1|  MATE efflux family protein, expressed                 84.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    2e-15   Setaria italica
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     83.6    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg           83.6    2e-15   Capsella rubella
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  83.6    2e-15   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     83.6    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     83.6    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007026057.1|  MATE efflux family protein                       83.6    2e-15   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     83.6    2e-15   
gb|KEH36840.1|  MATE efflux family protein                            83.6    2e-15   Medicago truncatula
emb|CDP17486.1|  unnamed protein product                              83.6    2e-15   Coffea canephora [robusta coffee]
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg           83.6    3e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  83.2    3e-15   Brassica rapa
emb|CDY27431.1|  BnaC03g64710D                                        83.2    3e-15   Brassica napus [oilseed rape]
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     83.2    3e-15   Brachypodium distachyon [annual false brome]
ref|NP_001050524.1|  Os03g0572900                                     83.2    3e-15   
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                          82.4    3e-15   
gb|EEC75610.1|  hypothetical protein OsI_12322                        83.2    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100        83.2    3e-15   Sorghum bicolor [broomcorn]
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  83.2    3e-15   Camelina sativa [gold-of-pleasure]
emb|CDX94063.1|  BnaC07g36970D                                        82.8    3e-15   
emb|CDX98712.1|  BnaA03g44970D                                        82.8    3e-15   
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12          82.8    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g           82.8    4e-15   
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg           82.0    4e-15   
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  82.8    4e-15   Elaeis guineensis
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg           82.4    5e-15   Citrus clementina [clementine]
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.6    5e-15   
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.4    5e-15   Prunus mume [ume]
gb|AGT17221.1|  transparent testa 12 protein                          82.4    5e-15   Saccharum hybrid cultivar R570
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.4    6e-15   Cucumis sativus [cucumbers]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.4    6e-15   Fragaria vesca subsp. vesca
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.0    7e-15   Prunus mume [ume]
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg           82.0    7e-15   
emb|CBI23251.3|  unnamed protein product                              81.6    7e-15   Vitis vinifera
ref|NP_001142368.1|  uncharacterized protein LOC100274540             81.6    8e-15   Zea mays [maize]
gb|AGT17223.1|  MATE efflux family protein                            82.0    8e-15   Saccharum hybrid cultivar R570
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12          81.6    8e-15   Vitis vinifera
dbj|BAD95082.1|  hypothetical protein                                 79.3    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389638.1|  MATE efflux family protein                       81.6    1e-14   
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  81.6    1e-14   Citrus sinensis [apfelsine]
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg           81.3    1e-14   Capsella rubella
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.3    1e-14   Cucumis melo [Oriental melon]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.3    1e-14   Prunus mume [ume]
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.3    1e-14   Brassica rapa
emb|CDY64933.1|  BnaCnng45550D                                        80.9    2e-14   Brassica napus [oilseed rape]
gb|EEE67272.1|  hypothetical protein OsJ_24453                        80.5    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.9    2e-14   Populus euphratica
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg           80.9    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.9    2e-14   Brassica rapa
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.9    2e-14   Populus euphratica
emb|CDX98713.1|  BnaA03g44980D                                        80.5    2e-14   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...  80.9    2e-14   
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.5    2e-14   Zea mays [maize]
gb|EEC82143.1|  hypothetical protein OsI_26198                        80.5    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     79.7    3e-14   
ref|NP_001059785.1|  Os07g0516600                                     80.1    3e-14   
gb|KGN64598.1|  hypothetical protein Csa_1G071120                     80.1    3e-14   Cucumis sativus [cucumbers]
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1    80.1    3e-14   Zea mays [maize]
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.1    3e-14   Cucumis melo [Oriental melon]
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg           80.1    3e-14   Eutrema salsugineum [saltwater cress]
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                 79.3    3e-14   Citrus sinensis [apfelsine]
ref|XP_002518495.1|  multidrug resistance pump, putative              80.1    4e-14   Ricinus communis
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.1    4e-14   Prunus mume [ume]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.1    4e-14   Brachypodium distachyon [annual false brome]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     79.7    4e-14   Nicotiana sylvestris
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                 79.7    4e-14   Citrus sinensis [apfelsine]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  79.7    5e-14   Populus euphratica
gb|KGN43526.1|  hypothetical protein Csa_7G043680                     79.7    5e-14   Cucumis sativus [cucumbers]
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg           79.7    5e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     79.3    5e-14   Brassica rapa
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                  79.7    5e-14   Arabis alpina [alpine rockcress]
emb|CDX79109.1|  BnaA01g11760D                                        79.3    5e-14   
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  79.3    6e-14   Populus euphratica
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     79.3    6e-14   Zea mays [maize]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                  79.0    8e-14   Arabis alpina [alpine rockcress]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.6    1e-13   Brassica rapa
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg           78.6    1e-13   Prunus persica
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  78.6    1e-13   Sesamum indicum [beniseed]
ref|XP_002518493.1|  multidrug resistance pump, putative              78.6    1e-13   Ricinus communis
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg              78.6    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.6    1e-13   Populus euphratica
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg           78.2    1e-13   
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.2    2e-13   
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g           78.2    2e-13   
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  78.2    2e-13   
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.2    2e-13   
ref|NP_001119025.1|  mate efflux domain-containing protein            77.8    2e-13   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.8    2e-13   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.8    2e-13   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  77.8    2e-13   
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  77.8    2e-13   
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.4    2e-13   
emb|CDP22168.1|  unnamed protein product                              71.6    3e-13   
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g           77.4    3e-13   
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                  77.4    3e-13   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.4    3e-13   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg           77.4    3e-13   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  77.4    3e-13   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  77.0    4e-13   
emb|CDY71092.1|  BnaAnng36070D                                        73.2    4e-13   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  77.0    4e-13   
ref|NP_172632.1|  MATE efflux family protein                          76.6    4e-13   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     76.6    5e-13   
emb|CDM85992.1|  unnamed protein product                              76.3    7e-13   
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.9    9e-13   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.9    1e-12   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.9    1e-12   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                       76.3    1e-12   
ref|XP_002867814.1|  mate efflux family protein                       75.5    1e-12   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg           75.1    1e-12   
gb|KGN43522.1|  Mate efflux family protein                            75.1    1e-12   
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.1    1e-12   
emb|CDY33129.1|  BnaCnng07000D                                        75.1    2e-12   
ref|XP_002892653.1|  mate efflux family protein                       75.1    2e-12   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.1    2e-12   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.3    3e-12   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg           74.3    3e-12   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    3e-12   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.3    3e-12   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.9    4e-12   
gb|AAM98160.1|  unknown protein                                       73.9    4e-12   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.9    4e-12   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.9    4e-12   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...  73.6    5e-12   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.2    6e-12   
gb|ADE77677.1|  unknown                                               72.8    9e-12   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  72.8    1e-11   
gb|ACF80989.1|  unknown                                               66.6    1e-11   
gb|EPS67796.1|  hypothetical protein M569_06975                       72.0    2e-11   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                          72.4    2e-11   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                          72.0    2e-11   
dbj|BAJ90668.1|  predicted protein                                    71.6    3e-11   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                          70.9    6e-11   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    6e-11   
emb|CDP04391.1|  unnamed protein product                              70.5    7e-11   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                  70.1    7e-11   
gb|ABF97208.1|  MATE efflux family protein, expressed                 69.3    8e-11   
ref|NP_001050521.1|  Os03g0571700                                     69.3    8e-11   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                     70.1    8e-11   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     69.7    9e-11   
emb|CDY33131.1|  BnaCnng07020D                                        67.0    9e-11   
gb|EEE59383.1|  hypothetical protein OsJ_11499                        69.3    9e-11   
gb|EPS59093.1|  hypothetical protein M569_15717                       66.6    1e-10   
emb|CDY38631.1|  BnaA05g19560D                                        69.3    1e-10   
emb|CAN69304.1|  hypothetical protein VITISV_021604                   69.3    2e-10   
emb|CAN60226.1|  hypothetical protein VITISV_039920                   68.9    2e-10   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg              68.9    2e-10   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    2e-10   
emb|CDY39494.1|  BnaA01g24940D                                        68.6    3e-10   
emb|CDY39493.1|  BnaA01g24950D                                        68.2    3e-10   
emb|CDY65669.1|  BnaCnng48120D                                        67.8    4e-10   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg              67.8    5e-10   
emb|CDX94064.1|  BnaC07g36980D                                        67.0    6e-10   
emb|CDY24252.1|  BnaC03g42250D                                        64.7    6e-10   
gb|EEC68782.1|  hypothetical protein OsI_37323                        64.7    7e-10   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.4    7e-10   
gb|ABK24492.1|  unknown                                               66.6    1e-09   
emb|CDY19294.1|  BnaC01g31860D                                        66.6    1e-09   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                          66.2    2e-09   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg              65.9    2e-09   
gb|AAS01962.1|  putative MATE efflux family protein                   65.9    2e-09   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  66.2    2e-09   
ref|NP_001190793.1|  MATE efflux family protein                       65.5    3e-09   
emb|CDX92916.1|  BnaA03g36380D                                        65.5    3e-09   
ref|NP_001065641.2|  Os11g0129000                                     62.8    3e-09   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120        65.5    3e-09   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg           65.1    3e-09   
ref|NP_001176767.1|  Os12g0125500                                     61.2    4e-09   
gb|EEE51571.1|  hypothetical protein OsJ_32800                        64.3    4e-09   
ref|NP_001176328.1|  Os11g0128900                                     64.3    5e-09   
gb|ABA91295.1|  MATE efflux family protein, expressed                 63.9    7e-09   
ref|NP_001066047.1|  Os12g0126000                                     63.9    8e-09   
gb|EEC68785.1|  hypothetical protein OsI_37326                        63.9    8e-09   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.5    1e-08   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.5    1e-08   
gb|AHI48503.1|  multidrug and toxic extrusion transporter             63.2    1e-08   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                     63.2    2e-08   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    2e-08   
gb|AGT17222.1|  MATE efflux family protein                            62.8    2e-08   
emb|CDP13215.1|  unnamed protein product                              62.8    2e-08   
gb|ABA26978.1|  TO22-3                                                58.9    2e-08   
dbj|BAJ95959.1|  predicted protein                                    62.4    3e-08   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    3e-08   
gb|EEC68781.1|  hypothetical protein OsI_37322                        62.4    3e-08   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    3e-08   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    3e-08   
gb|AFK46935.1|  unknown                                               62.0    4e-08   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    4e-08   
emb|CDX83628.1|  BnaC07g23680D                                        61.6    4e-08   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    4e-08   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                        62.0    4e-08   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    5e-08   
emb|CAA17157.1|  putative protein                                     62.0    5e-08   
ref|XP_008455546.1|  PREDICTED: MATE efflux family protein LAL5-like  58.9    5e-08   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    5e-08   
ref|XP_006856151.1|  hypothetical protein AMTR_s00059p00169290        61.2    5e-08   
emb|CBI31189.3|  unnamed protein product                              61.6    5e-08   
ref|XP_006852295.1|  hypothetical protein AMTR_s00049p00187620        58.5    6e-08   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.2    6e-08   
ref|NP_001176768.1|  Os12g0125800                                     60.5    6e-08   
ref|XP_006852301.1|  hypothetical protein AMTR_s00049p00190450        58.9    7e-08   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                          61.2    7e-08   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein            60.8    8e-08   
ref|XP_009380883.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.8    8e-08   
gb|EAZ06832.1|  hypothetical protein OsI_29069                        60.8    9e-08   
ref|NP_001190792.1|  mate efflux domain-containing protein            60.8    9e-08   
gb|EAY90718.1|  hypothetical protein OsI_12316                        56.6    9e-08   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.8    1e-07   
gb|ABF97220.1|  MATE efflux family protein, expressed                 60.5    1e-07   
ref|XP_011468929.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.0    1e-07   
emb|CDP20703.1|  unnamed protein product                              60.1    1e-07   
gb|KHN34619.1|  Protein TRANSPARENT TESTA 12                          60.5    1e-07   
ref|NP_001065623.1|  Os11g0126100                                     60.5    1e-07   
ref|XP_004957085.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.5    1e-07   
ref|NP_001141051.1|  putative MATE efflux family protein              60.5    1e-07   
emb|CAN63841.1|  hypothetical protein VITISV_021179                   60.1    1e-07   
ref|XP_010905904.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.5    1e-07   
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                  60.5    1e-07   
ref|XP_003554068.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.1    1e-07   
ref|XP_007051759.1|  MATE efflux family protein                       60.1    1e-07   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  60.1    1e-07   
ref|XP_011086620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.1    1e-07   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                          60.5    2e-07   
ref|XP_002865386.1|  mate efflux family protein                       60.1    2e-07   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  59.7    2e-07   
gb|ABR16195.1|  unknown                                               60.1    2e-07   
ref|XP_007044785.1|  MATE efflux family protein isoform 2             60.1    2e-07   
gb|KFK28220.1|  hypothetical protein AALP_AA8G488200                  57.0    2e-07   
gb|AAN64140.1|  Putative ripening regulated protein                   59.7    2e-07   
ref|XP_007044784.1|  MATE efflux family protein isoform 1             59.7    2e-07   
ref|XP_007044786.1|  MATE efflux family protein isoform 3             59.7    2e-07   
ref|XP_006438288.1|  hypothetical protein CICLE_v10031274mg           59.7    2e-07   
ref|XP_010243274.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  59.7    2e-07   
ref|XP_010243275.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  59.7    2e-07   
ref|XP_004239125.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.7    2e-07   
ref|XP_010243273.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  59.7    2e-07   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                          59.7    2e-07   
ref|XP_006856152.1|  hypothetical protein AMTR_s00059p00169820        59.7    2e-07   
ref|XP_006438289.1|  hypothetical protein CICLE_v10031274mg           59.7    2e-07   
ref|XP_006483933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.7    2e-07   
gb|KJB31160.1|  hypothetical protein B456_005G179100                  59.7    2e-07   
ref|XP_011087098.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    2e-07   
gb|EEE58464.1|  hypothetical protein OsJ_09708                        59.3    2e-07   
gb|EEC74654.1|  hypothetical protein OsI_10313                        59.3    3e-07   
ref|NP_199218.1|  MATE efflux family protein                          59.3    3e-07   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.9    3e-07   
dbj|BAD09618.1|  putative ripening regulated protein DDTFR18          58.9    3e-07   
ref|XP_006491465.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    3e-07   
ref|NP_001062523.2|  Os08g0562800                                     58.9    3e-07   
ref|XP_006395543.1|  hypothetical protein EUTSA_v10005286mg           58.9    4e-07   
gb|KEH25522.1|  MATE efflux family protein                            58.9    4e-07   
ref|XP_009605336.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.9    4e-07   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.9    4e-07   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.6    4e-07   
gb|KEH25521.1|  MATE efflux family protein                            58.9    4e-07   
gb|EEE51569.1|  hypothetical protein OsJ_32798                        58.5    4e-07   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                        58.5    4e-07   
emb|CDY13643.1|  BnaA06g32800D                                        58.5    5e-07   
emb|CDX83627.1|  BnaC07g23670D                                        58.5    5e-07   
emb|CDY68535.1|  BnaCnng59430D                                        56.6    5e-07   
dbj|BAJ90744.1|  predicted protein                                    58.5    5e-07   
ref|XP_009152044.1|  PREDICTED: protein TRANSPARENT TESTA 12          58.5    5e-07   
gb|EEC73528.1|  hypothetical protein OsI_07920                        58.5    5e-07   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.5    5e-07   
ref|NP_567173.3|  MATE efflux family protein                          58.5    6e-07   
ref|XP_002460370.1|  hypothetical protein SORBIDRAFT_02g027130        58.2    6e-07   
emb|CDY69605.1|  BnaA06g39220D                                        56.2    6e-07   
ref|XP_010556554.1|  PREDICTED: protein TRANSPARENT TESTA 12          58.2    6e-07   
gb|AAO42212.1|  unknown protein                                       58.2    6e-07   
ref|XP_006445000.1|  hypothetical protein CICLE_v10018703mg           58.5    6e-07   
ref|XP_007018128.1|  MATE efflux family protein isoform 2             58.2    6e-07   
emb|CDY66203.1|  BnaA09g51730D                                        58.2    7e-07   
emb|CDY07225.1|  BnaCnng02400D                                        58.2    7e-07   
ref|XP_007018127.1|  MATE efflux family protein isoform 1             58.2    7e-07   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g           58.2    7e-07   
ref|XP_009111491.1|  PREDICTED: protein TRANSPARENT TESTA 12          58.2    7e-07   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.2    7e-07   
ref|XP_003628949.1|  Protein TRANSPARENT TESTA                        58.2    7e-07   
ref|XP_010270616.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.2    7e-07   
ref|XP_006357608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.2    7e-07   
ref|XP_004985412.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  57.8    8e-07   
ref|XP_002875033.1|  mate efflux family protein                       57.8    8e-07   
ref|XP_004489662.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.8    8e-07   
emb|CBI22674.3|  unnamed protein product                              54.3    8e-07   
ref|XP_002267831.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.8    9e-07   
ref|XP_008777525.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.8    9e-07   
emb|CBI31194.3|  unnamed protein product                              57.4    9e-07   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340        57.8    9e-07   
ref|XP_010044581.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.8    1e-06   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    1e-06   
ref|XP_002468362.1|  hypothetical protein SORBIDRAFT_01g044660        57.4    1e-06   
gb|KCW86662.1|  hypothetical protein EUGRSUZ_B03290                   57.4    1e-06   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                        57.4    1e-06   
ref|XP_010044578.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    1e-06   
ref|XP_004501679.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    1e-06   
ref|XP_010044579.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    1e-06   
gb|EEC84727.1|  hypothetical protein OsI_31705                        57.4    1e-06   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760        57.4    1e-06   
ref|XP_006484782.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    1e-06   
gb|KCW86665.1|  hypothetical protein EUGRSUZ_B03293                   57.0    1e-06   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710        57.0    1e-06   
ref|XP_008458202.1|  PREDICTED: protein TRANSPARENT TESTA 12          57.0    1e-06   



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  340  FYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  395



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD K+EPLL
Sbjct  507  FFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWDEKKEPLL  562



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  436  FFFNLGAKGIWGGLIGGTALQTTILLWVTIRTDWTKEVEEAQKRLNKWDEKKQPLL  491



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F+FNLGAKGIW G+IGGT +QT ILLWVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  436  FFFNLGAKGIWGGLIGGTALQTAILLWVTMRTDWTKEVEEAQKRLNKWDEKKEPLL  491



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  449  FYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  504



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+W  K+EPLL
Sbjct  340  FFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWSEKKEPLL  395



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  112  FYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  167



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  438  FFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWSKEVEEAQKRLNKWDEKKQPLL  493



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  313
            F F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQWD K++PLL  T
Sbjct  437  FKFHLGAKGIWSGMLGGTCMQTLILFWITFRTDWNKEVEQAKKRLNQWDDKKQPLLAST  495



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F+FNLGAKGIW G+IGGT +QT ILLWVTIRT+W +EVE A+KRLN+WD K+EPLL
Sbjct  375  FFFNLGAKGIWGGLIGGTALQTTILLWVTIRTNWTEEVEEAQKRLNKWDEKKEPLL  430



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF  GAKGIW GM+GGTVMQTIILLWVT RTDW KEVE A KRL +W+ K+EPLL
Sbjct  448  FYFQFGAKGIWLGMLGGTVMQTIILLWVTFRTDWTKEVEEAAKRLTKWEDKKEPLL  503



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE AKKRLN+WD K EPL
Sbjct  458  FYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWDVK-EPL  511



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD K+EPLL
Sbjct  450  FYFQFGAKGIWLGMLGGTTMQTIILIWVTFRTDWNKEVEESAKRLNKWDDKKEPLL  505



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LG KGIW GMIGGTVMQT+IL W+T RTDW KEVE A KRL++WDA +EP+L
Sbjct  440  FYFKLGVKGIWLGMIGGTVMQTLILFWITFRTDWNKEVEEATKRLSKWDASKEPIL  495



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRLN+W+ K++PLL
Sbjct  463  FKFNLGAKGIWSGMIGGTFMQTLILLWVTFRTDWNKEVEQAIKRLNKWEGKKQPLL  518



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  464  FYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  519



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  313
            F F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+ K++PLL  T
Sbjct  340  FKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLLAGT  398



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  459  FKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  514



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  458  FKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  513



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ WD KR+PLL
Sbjct  442  FTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWDEKRQPLL  497



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN WD KR+P LP+
Sbjct  442  FKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWDKEVENAKNRLNTWDDKRQPPLPE  499



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F LGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE AKKRLN+W+ K+EPLL
Sbjct  430  FKFGLGAKGIWGGMIGGTFMQTLILLWVTFRTDWNKEVEEAKKRLNKWEDKKEPLL  485



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  313
            F F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+ K++PLL  T
Sbjct  439  FKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLLAGT  497



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  444  FKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  444  FKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE A KRLN+WD K EPL
Sbjct  458  FYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEANKRLNKWDVK-EPL  511



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  313
            F F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+ K++PLL  T
Sbjct  439  FKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLLAGT  497



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  444  FKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYFN GAKGIW GM+ GT+MQTIILLW+TIRTDW KEVE A +RLN WD K EPL
Sbjct  131  FYFNFGAKGIWLGMMAGTLMQTIILLWITIRTDWKKEVEEAARRLNNWDVK-EPL  184



>emb|CBI28940.3| unnamed protein product [Vitis vinifera]
Length=100

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+RL +WD K++PLL
Sbjct  43   FYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERLEKWDDKKQPLL  98



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFNLGAKGIW GMI G V+QT+ILLWVTIRTDW KEV+ A KRL  W+ K EPL+
Sbjct  138  FYFNLGAKGIWSGMIAGIVLQTVILLWVTIRTDWNKEVQEALKRLETWEGKEEPLV  193



>ref|XP_008342112.1| PREDICTED: MATE efflux family protein ALF5-like [Malus domestica]
Length=179

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  343
            FYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE AKKRLN+WD
Sbjct  129  FYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWD  177



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  348  FTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  403



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE A+KRL  W+ K+EPLL
Sbjct  448  FYFKLGAKGIWSGMIGGTAMQTLILVWVTFRTDWKKEVEEARKRLVTWEDKKEPLL  503



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  340  FVFNLGVKGIWSGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  322
            FYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W  K+ EPLL
Sbjct  449  FYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWQVKKEEPLL  505



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGTVMQT+IL+W+TIRTDW KEVE A+ RLN+W  K+EP L
Sbjct  446  FYFKLGAKGIWLGMMGGTVMQTVILIWITIRTDWNKEVEAAQGRLNKWGDKKEPEL  501



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  340  FVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  395



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLG KGIW GM+GGT MQT IL+WVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  437  FVFNLGVKGIWGGMLGGTCMQTAILVWVTLRTDWKKEVEEAQKRLNKWDDKKEPLL  492



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF  GAKGIW GM+GGT MQT+IL+WVT RTDW KEV+ A KRLN+W+ K+EPLL
Sbjct  446  FYFQFGAKGIWLGMLGGTTMQTVILMWVTFRTDWNKEVQEADKRLNKWEDKKEPLL  501



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  322
            F F LGAKGIW GMIGGT+MQT+IL+WVT RTDW KEVE AKKRLN+WD K+ EPLL
Sbjct  464  FKFGLGAKGIWGGMIGGTIMQTLILMWVTFRTDWNKEVEEAKKRLNKWDGKKEEPLL  520



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE AKKRL++W+ K+EPLL
Sbjct  462  FKFGLGAKGIWSGMIGGTLMQTVILLWVTFTTDWNKEVETAKKRLDRWEDKKEPLL  517



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  342  FYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  397



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  443  FTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  498



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  432  FVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  487



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            FYF LGAKG+W GM+GGT MQTIILLWVTIRTDW KEVEVA KRL++W D K+E LL
Sbjct  443  FYFQLGAKGLWSGMLGGTTMQTIILLWVTIRTDWNKEVEVALKRLDKWEDQKKEALL  499



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  340  FVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  340  FVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  452  FYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F ++LGAKGIW GMIGGT+MQT+ILLWVT RTDW KEVE AKKRL++W+ KRE LL
Sbjct  465  FIYHLGAKGIWSGMIGGTLMQTLILLWVTFRTDWNKEVETAKKRLDKWEDKRETLL  520



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  454  FYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  454  FYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  452  FYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  455  FYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVEAAQSRLKKWDDKKESILEE  512



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W+ K++PLL
Sbjct  463  FKFNLGAKGIWSGMIGGTFMQTLILIWVTFRTDWNKEVDEAIKRLNKWEDKKQPLL  518



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDA-KREPLL  322
            FYFN GAKGIW GM+GGT MQTIIL+WVT RTDW KEV+ A KRLN+W+  K+EPLL
Sbjct  450  FYFNFGAKGIWLGMLGGTTMQTIILMWVTFRTDWNKEVKEAAKRLNKWEEKKKEPLL  506



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ WD K +PLL
Sbjct  442  FTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWDEKGQPLL  497



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN WD KR+P L
Sbjct  442  FKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWNKEVENAKNRLNTWDDKRQPPL  497



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LG KGIW GMIGGTV+QT+ILLWVT RTDW KEVE A  RL++W+A +EPLL
Sbjct  452  FYFKLGVKGIWGGMIGGTVIQTVILLWVTFRTDWQKEVEKAASRLDKWEAVKEPLL  507



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFNLGAKGIW GMIGG V++T+ILLWVT RTDW KEV+ A KRL  W+ K+EPL+
Sbjct  345  FYFNLGAKGIWSGMIGGVVLRTVILLWVTCRTDWNKEVQEALKRLETWEGKKEPLV  400



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  435  FVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLGAKGIW GMIGGT+MQT+IL+WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  464  FKFNLGAKGIWSGMIGGTLMQTLILIWVTFRTDWNKEVNEAIKRLNKWEDKKKPLL  519



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+RL +WD K++PLL
Sbjct  450  FYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERLEKWDDKKQPLL  505



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  432  FVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  488



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GMIGGT+MQT+ILLWVT RT+W KEVE A KRLN+W+ K EPLL
Sbjct  455  FKFDLGAKGIWSGMIGGTMMQTLILLWVTYRTNWNKEVEEATKRLNKWEDKPEPLL  510



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+WVKEVE A+KRLN+W+ ++ PLL
Sbjct  456  FYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWVKEVEEAQKRLNKWE-EKSPLL  510



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  449  FYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  449  FYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE A+KRLNQW+  ++PLL
Sbjct  441  FKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWDKEVEEARKRLNQWEDNKQPLL  496



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  450  FYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  505



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  449  FYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEVE AK R+ +WD K++PLL
Sbjct  451  FVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVENAKSRVEKWDDKKQPLL  506



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  377  FYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  432



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEVE A++RLN W+ K+EPLL
Sbjct  440  FKFDLGAKGIWSGMIGGTFLQTLILIWVTYRTDWNKEVEKARQRLNSWEDKKEPLL  495



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+ GAKGIW GM+GGT MQT+IL+WVT RTDW KEVE A KRL+ W+ K+EP+L
Sbjct  451  FYFDFGAKGIWLGMLGGTAMQTVILIWVTFRTDWNKEVEEAAKRLSIWEDKKEPVL  506



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W+ +++PLL
Sbjct  433  FKFNLGAKGIWSGMIGGTFMQTVILIWVTFRTDWNKEVDEAIKRLNKWEDEKQPLL  488



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL  WD K+E +L
Sbjct  455  FYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQSRLKMWDDKKESIL  510



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  450  FYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  505



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            FYF LGAKG+W GM+GGT+MQTIILLWVTIRTDW+KEVE A +RL++W+  ++
Sbjct  375  FYFQLGAKGLWSGMLGGTIMQTIILLWVTIRTDWIKEVEAALRRLDKWEVLKD  427



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R  +WD K++PLL
Sbjct  208  FYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERXEKWDDKKQPLL  263



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++WD K++PLL
Sbjct  405  FYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKWDDKKQPLL  461



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++WD K++PLL
Sbjct  455  FYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKWDDKKQPLL  511



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  461  FYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  461  FYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  486  FYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  541



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW KEVE AKKRL++W+  + PL
Sbjct  443  FKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKEVECAKKRLDKWENLKGPL  497



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LG KGIW GM+GGTV+QT+ILLWVT RTDW  EVEVAK RL+ WD KR+PLL
Sbjct  444  FTFDLGVKGIWSGMLGGTVLQTLILLWVTWRTDWNTEVEVAKNRLSSWDDKRQPLL  499



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLG KGIW GMIGGT+MQT+ILLWVT RTDW KEVE A+KRL++W+   EPLL
Sbjct  452  FKFNLGVKGIWSGMIGGTMMQTLILLWVTFRTDWNKEVEKARKRLDKWEEITEPLL  507



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PL 
Sbjct  300  FKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  355



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  451  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  451  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYFNLGA GIW GMIGGT+MQTIIL WVT+RTDW KEVE A++RLN+W  K+  L
Sbjct  403  FYFNLGAMGIWSGMIGGTLMQTIILTWVTLRTDWSKEVETAQQRLNKWGDKQPAL  457



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  451  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  131  FYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  185



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F LG KGIW GMIGGTVMQT ILLWVT+RTDW KEVE A+KRLN+W D K EPLL
Sbjct  436  FVFKLGVKGIWGGMIGGTVMQTAILLWVTLRTDWSKEVEEAQKRLNKWEDKKTEPLL  492



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F FN G KG+W GMIGGT +QT ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  435  FVFNFGVKGLWGGMIGGTAIQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            FYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE + KRLN+WD K+E
Sbjct  453  FYFKLGAKGIWVGMIGGTFMQTVILIWVTYRTDWNKEVEESMKRLNKWDDKQE  505



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W  K++ ++P+
Sbjct  449  FYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F F++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTFDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLG KGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRL  WD  +EPLL
Sbjct  459  FKFNLGVKGIWTGMIGGTAMQTLILLWVTFRTDWNKEVEKAGKRLAMWDDIKEPLL  514



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  456  FHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWDDKKEAILEE  513



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  456  FHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWDDKKESILEE  513



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+ GAKGIW GMIGGTVMQTIILLWVT RTDW+KEVE AK RL++WD  ++ L
Sbjct  449  FKFDFGAKGIWSGMIGGTVMQTIILLWVTFRTDWIKEVEKAKMRLDKWDDDKQTL  503



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF L AKGIW GM+GGTV+QTIIL+WVT  TDW KEVE A KRLN+W+ K EPL+
Sbjct  460  FYFKLSAKGIWLGMLGGTVLQTIILVWVTFGTDWNKEVEEAAKRLNKWEDKTEPLV  515



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  237  FTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  294



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEV+ AK R+ +WD K +PLL
Sbjct  451  FVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVDNAKSRVEKWDDKEQPLL  506



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  446  FTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  446  FTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+W+ + E L+
Sbjct  455  FYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWEDRTETLI  510



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W  K++ L+
Sbjct  131  FYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWSDKKQELV  186



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+  + PLL
Sbjct  402  FTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWEGSQAPLL  457



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIWCGMIGGT+MQT+IL+WVT RT+W KEVE A KRLN+W+  + P+L
Sbjct  462  FYFDLGAAGIWCGMIGGTLMQTLILVWVTFRTNWNKEVEEALKRLNKWE-DKSPIL  516



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PL
Sbjct  461  FKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPL  515



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PL
Sbjct  442  FKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPL  496



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+W+ + E L+
Sbjct  453  FYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWEDRTETLI  508



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW K+VE AKKRL++W+  + PL
Sbjct  443  FKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKKVECAKKRLDKWENLKGPL  497



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYF LGAKGIW GM+GGT+MQT+IL+WVT RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  431  FYFKLGAKGIWSGMMGGTLMQTVILVWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  487



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYF LGAKGIW GM+GGT+MQT+IL+WVT RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  456  FYFKLGAKGIWSGMMGGTLMQTVILVWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  512



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GMIGGT +QT+IL+WVT RT+W KEVE A KRL  WD K+EPLL
Sbjct  456  FKFDLGAKGIWSGMIGGTTVQTLILIWVTYRTNWNKEVEEAMKRLETWDEKKEPLL  511



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FY+  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD K+E  L
Sbjct  439  FYYKFGAKGIWLGMMGGTCMQTIILIWVTFRTDWNKEVEESMKRLNKWDVKQESTL  494



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  343
            F F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEVE AKKRL++W+
Sbjct  114  FKFDLGAKGIWTGMIGGTMMQTIILLWVTFRTDWNKEVESAKKRLDKWE  162



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            FYF LGAKGIW GMIGGT MQTIIL+WVT RTDW KEVE A KRLN+W+ K++
Sbjct  453  FYFKLGAKGIWLGMIGGTCMQTIILIWVTYRTDWNKEVEEATKRLNKWEDKQQ  505



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FY +LGAKG+W GM IGGT+ QT+ILLWVT+RTDW KEVE AK RL++WD K++PLL
Sbjct  454  FYLDLGAKGVWSGMVIGGTLTQTLILLWVTVRTDWNKEVENAKARLDKWDDKKQPLL  510



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  313
            F F+LGAKGIW GMIGGTV+QT IL+W T +TDW+KEVE AKKRL++WD   +PLL  +
Sbjct  466  FKFDLGAKGIWSGMIGGTVLQTAILIWTTYQTDWIKEVEKAKKRLDKWDDINQPLLKAS  524



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F F+ GA+GIW GMIGGT +QT+ILLWVT RTDW KEVE  K RL++WD K+EPLL +
Sbjct  449  FKFDFGAQGIWSGMIGGTFIQTLILLWVTFRTDWKKEVENVKNRLDRWDDKKEPLLTE  506



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF  GAKGIW GMI GTVMQTIIL WVT  TDW KEV++A KRL+QW  ++EPL
Sbjct  447  FYFKFGAKGIWTGMICGTVMQTIILAWVTFSTDWNKEVDLATKRLDQWSDRKEPL  501



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  458  FYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  458  FYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF LGAKGIW GM+ GT+MQT+IL+W+T RTDW KEVE A KRL++W   +EP L
Sbjct  463  FYFRLGAKGIWGGMLAGTIMQTLILMWITFRTDWNKEVEEAMKRLDEWQDNKEPFL  518



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FY+N GAKGIW GMIGGT+ QT IL WVT RTDW KEVE A KR+++W  K++ ++P+
Sbjct  449  FYYNFGAKGIWTGMIGGTITQTFILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  343
            FYF LGAKGIW GM+ GT+MQT+ILLWVTIRTDW KEVE AKKRLN+WD
Sbjct  456  FYFKLGAKGIWLGMVWGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWD  504



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  463  FKFDLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVYEATKRLNKWEDKKQPLL  518



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+  + PLL
Sbjct  447  FTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWEDSQAPLL  502



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGT MQT+IL+WVT RTDW KEVE AK RL++W+ K++PLL
Sbjct  455  FKFDLGAKGIWSGMLGGTTMQTLILIWVTYRTDWNKEVEKAKGRLDKWEDKKKPLL  510



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  328
            F FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD K+EP
Sbjct  452  FTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDEKKEP  505



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F  +LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PLL
Sbjct  461  FKNDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLL  516



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W+  +EPL
Sbjct  446  FKFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWENVKEPL  500



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF   AKGIW GM+GGTV+QT+IL+WVT RTDW KEV  A++RLNQW+  +EPLL
Sbjct  460  FYFKFNAKGIWLGMLGGTVLQTLILMWVTFRTDWNKEVVEAERRLNQWEDVKEPLL  515



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W D + EPLL
Sbjct  163  FKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  219



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTI+L+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIVLVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F + LGAKGIW GMIGGT+MQT+IL+W T RTDW KEVE A++RL  WD K+EPLL
Sbjct  377  FKYKLGAKGIWSGMIGGTMMQTLILVWSTFRTDWNKEVEKARERLRTWDDKKEPLL  432



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++W+ KR+P L
Sbjct  458  FKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKEVEKAKSRLHKWEDKRKPSL  513



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            FYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W +  ++PL 
Sbjct  442  FYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMWQNNSKKPLF  498



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  483  FNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  448  FNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+  AKGIW GMIGGT MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  451  FAFDFQAKGIWTGMIGGTFMQTLILLYVTYRTDWDKEVETARKRLDMWDDKKEPL  505



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  471  FRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  471  FRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  398  FRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  453



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  334
            FYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ W  K+
Sbjct  340  FYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDIWSNKK  391



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F F+LGAKGIW GM+GGTV+QT+ILL VT RTDW KEVE AK RL+ WD K EPLL K
Sbjct  444  FTFDLGAKGIWSGMLGGTVLQTLILLGVTWRTDWNKEVEGAKNRLSTWDDKSEPLLQK  501



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FN GAKGIW GMIGGT+MQT+ILLWVT RTDW KEV+ A KRL++W+ K++ LL
Sbjct  464  FKFNFGAKGIWSGMIGGTLMQTVILLWVTFRTDWNKEVDQALKRLDKWEDKKQHLL  519



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++W D + +PLL
Sbjct  377  FKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  433



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            F F LGAKGIW GM+GGT +QTIIL+WVT+RTDW KEVE+A+ RLN+W+ K+E
Sbjct  450  FVFKLGAKGIWSGMLGGTALQTIILIWVTVRTDWNKEVEIARGRLNRWEDKKE  502



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  328
            F F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  448  FTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  501



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W  +++ ++P+
Sbjct  381  FYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWNKEVEEASKRMDKWSNQKQEVVPE  438



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  328
            F FN  AKGIW GMIGG++MQT+ILL+VT RTDW KEVE AKKRL+ WD K+EP
Sbjct  448  FTFNFQAKGIWTGMIGGSLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDEKKEP  501



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  328
            F F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  447  FTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  500



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEVE A KRLN+W   +EPL
Sbjct  463  FYFKCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVEEAAKRLNKWGKVKEPL  517



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KEV  A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++W D + +PLL
Sbjct  451  FKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  507



>gb|EMT20038.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=456

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF+LGA GIWCGMIGGT MQT+IL+WVTIRT+W  EV  A KRL++W+ K+ PLL
Sbjct  398  FYFDLGAAGIWCGMIGGTFMQTVILVWVTIRTNWDSEVAEAMKRLHKWEDKK-PLL  452



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  478  FRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  533



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  471  FRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  481  FRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  536



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W   +EPL
Sbjct  447  FRFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWGNVKEPL  501



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  334
            FYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ W  K+
Sbjct  448  FYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDIWSNKK  499



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  474  FRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  529



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  405  FRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  460



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F LG KGIWCG+I GTV QT+ILL VT RTDW KEVE AKKRL++W+ K EPLL
Sbjct  468  FKFGLGVKGIWCGLIAGTVNQTLILLVVTFRTDWNKEVEEAKKRLDKWEEKEEPLL  523



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++W  K++ ++P+
Sbjct  460  FYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEEEEASKRMDKWSNKKQEVVPE  517



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            FY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++
Sbjct  450  FYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQ  502



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT++TDW KEVE +  RL+QW+  REPLL +
Sbjct  270  FTYDMGAKGIWTGMIGGTLMQTIILVVVTLKTDWDKEVEKSSSRLDQWEESREPLLKQ  327



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W D + EPLL
Sbjct  340  FKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDXEDEPLL  396



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF  GAKGIW GM+GGTV+QTIIL+WVT RTDW  EV  + KRLN+W+ K E LL
Sbjct  462  FYFKFGAKGIWLGMLGGTVLQTIILMWVTFRTDWNNEVVESNKRLNKWEGKTESLL  517



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  340  FKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  395



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+ GAKGIW GMIGGTVMQTIILLWVT  TDW KEVE A+KRL++W+  + PL
Sbjct  443  FKFDFGAKGIWTGMIGGTVMQTIILLWVTFSTDWNKEVESARKRLDKWENLKGPL  497



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++W  +++ ++P+
Sbjct  449  FYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWSKEAEEASKRMDKWSNQKQEVVPE  506



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  365  FKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  420



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F ++LGAKGIW GMIGGTVMQT IL+W T RTDW KEVE AK+RL++W+  +EPL  K
Sbjct  442  FKYDLGAKGIWTGMIGGTVMQTFILIWFTFRTDWNKEVEKAKERLDKWENVKEPLSKK  499



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW--DAKRE  331
            FYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W  ++K++
Sbjct  446  FYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMWQNNSKKQ  500



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  451  FTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  505



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  451  FTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  505



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+ G KG+W GMIGGT++QT+IL+W+T+RTDW KEVE A+KRL++WD  R+PLL
Sbjct  437  FKFDFGIKGLWGGMIGGTLIQTLILIWITLRTDWNKEVEEARKRLDKWDDTRQPLL  492



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL++W+  + PLL
Sbjct  402  FTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDKWEDTQAPLL  457



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  453  FTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  453  FTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  507



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF  GAKGIW G++GGT+MQTIIL+ V +RTDW KEVE A +RL+QW+ K+EPLL
Sbjct  458  FYFKHGAKGIWLGLLGGTLMQTIILIVVMVRTDWNKEVEKALERLDQWEDKKEPLL  513



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  464  FYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWEDKT-PLLSE  520



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W D + EPLL
Sbjct  450  FKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  506



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  464  FYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWEDKT-PLLSE  520



>ref|XP_004957863.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=501

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+ G KG+W GMIGGT++QT+IL+W+T+RTDW KEVE A+KRL++WD  R+PLL
Sbjct  442  FKFDFGIKGLWGGMIGGTLIQTLILIWITLRTDWNKEVEEARKRLDKWDDTRQPLL  497



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F F+LGAKGIW GM+GGT+MQT IL+WVT RTDW KEVE A +RL++W+  ++PLL  
Sbjct  436  FKFDLGAKGIWGGMLGGTLMQTFILIWVTFRTDWNKEVEQAMRRLDKWEDNKQPLLSN  493



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLL  499



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL +
Sbjct  444  FTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+ GAKGIW GM+GGTV+QT+IL++VT RTDW KEVE  + RL++W+ K+EPLL
Sbjct  456  FKFDFGAKGIWSGMMGGTVIQTLILMYVTFRTDWTKEVEKTRNRLDRWEDKKEPLL  511



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  483  FYFDLGAAGIWSGMIGGTLMQTLILVWVTFRTNWNREVEEAMKRLNKWEDK-TPLLSE  539



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  343
            F FNLG KGIW GMIGGTV+QT+ILLW+T RTDW+KEV  AKKRL++W+
Sbjct  446  FKFNLGVKGIWSGMIGGTVLQTLILLWITFRTDWIKEVNTAKKRLDKWE  494



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYF  GAKGIW G+I G  +QT+ILLW T RTDW KEVE+A+KRL  WD +++PLL
Sbjct  455  FYFKYGAKGIWIGIISGVFLQTLILLWTTFRTDWNKEVEIAQKRLATWDDQKQPLL  510



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            FYF   AKGIW GMI GTVMQT+IL WVT RTDWVKEVE A KRL++W  K+  ++P+
Sbjct  458  FYFKFDAKGIWTGMICGTVMQTVILAWVTFRTDWVKEVEEASKRLDKWSNKKLEVVPE  515



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            F FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD K++
Sbjct  451  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDDKKD  503



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            F FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD K++
Sbjct  451  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_010237714.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=496

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+ G KG+W GMIGGT++QTIILLW+T RTDW KEVE A++RL++WD  ++PLL
Sbjct  437  FKFDYGIKGLWGGMIGGTLIQTIILLWITFRTDWNKEVEEARRRLDKWDEAKQPLL  492



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  437  FVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>gb|EMT14886.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=400

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+ G KG+W GMIGGT++QTIILLW+T RTDW KEVE A++RL++WD  ++PLL
Sbjct  340  FKFDYGIKGLWGGMIGGTLIQTIILLWITFRTDWNKEVEEARRRLDKWDDAKQPLL  395



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            F F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  437  FVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR--EPLL  322
            F F LG KGIW GMIGGT MQT ILLWVT+RTDW KEVE A+KRL++W+ K+  EPLL
Sbjct  439  FVFKLGVKGIWGGMIGGTCMQTAILLWVTLRTDWNKEVEEAQKRLHKWEDKKTTEPLL  496



>ref|XP_010448968.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010448969.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=508

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  328
            F FN  AKGIW GMIGGT+MQT+ILL+VT RT W KEVE AKKRL+ WD K+EP
Sbjct  452  FTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTAWDKEVEKAKKRLDMWDEKKEP  505



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+  L
Sbjct  451  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKNSL  505



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+  L
Sbjct  451  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKNSL  505



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            F F+LGAKGIW GMIGGT+MQTIILLWV  RTDW +EVE A KRLN+W+ K +
Sbjct  447  FKFDLGAKGIWSGMIGGTLMQTIILLWVACRTDWKREVEEAAKRLNKWEDKHK  499



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F  + G KGIW GMIGGT++QTIILLWVT RTDW KEVE A  RLN WD  ++PLL
Sbjct  429  FKLDFGVKGIWSGMIGGTLIQTIILLWVTFRTDWNKEVEKATNRLNTWDNIKQPLL  484



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  340  FKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  397



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F FNLGAKGIW GMIGGT +QT+IL+WVT RTDW KEV+ A KRLN+W+  ++ LL
Sbjct  464  FKFNLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVDEAIKRLNKWEDNKKALL  519



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  451  FKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  508



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD   +P++
Sbjct  342  FYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWDDTAKPIV  397



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  328
            F F+LGA+GIW GMIGGT MQTIILLWVT RTDW KEVE A  RL +W+ K+ P
Sbjct  454  FKFDLGAEGIWSGMIGGTFMQTIILLWVTFRTDWNKEVETAGNRLKKWEDKKLP  507



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 10/66 (15%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEV----------AKKRLNQWDA  340
            FYF+LGA GIW GMIGGT MQT+IL+WVT RT+W KEV++          A+KRLN+W+ 
Sbjct  455  FYFDLGAAGIWSGMIGGTFMQTLILVWVTYRTNWTKEVQIAITYSNLVEEAQKRLNKWND  514

Query  339  KREPLL  322
             + PLL
Sbjct  515  SKAPLL  520



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD   +P++
Sbjct  457  FYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWDDTAKPIV  512



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD----AKREPLL  322
            F F+LGA+GIW GMIGGT MQTIILLWVT RTDW+KEV  ++ RL +WD     +++PLL
Sbjct  451  FKFDLGAQGIWSGMIGGTFMQTIILLWVTFRTDWIKEVGTSRDRLEKWDDSNKQQQQPLL  510



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            FYF  GAKGIW GM+ GT+MQT+IL+WVT RTDW KEVE A KRLN+W+  +E L
Sbjct  462  FYFKYGAKGIWLGMMAGTLMQTVILIWVTYRTDWKKEVEEAAKRLNKWEEVKEQL  516



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F FN  AKGIW GMIGGT+MQT+ILL+VT +TDW KEVE A+KRL+ WD K+E L
Sbjct  446  FTFNFQAKGIWTGMIGGTLMQTLILLYVTYQTDWDKEVEKARKRLDMWDDKKESL  500



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  WD      L
Sbjct  375  FKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWDTNNSASL  430



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR--EPLL  322
            F F LG KGIW GMIGGT MQT IL+WVT+RTDW KEVE A+ RL++W+A +  EPLL
Sbjct  384  FVFKLGVKGIWAGMIGGTCMQTAILVWVTLRTDWNKEVEEAQNRLHKWEANKTTEPLL  441



>gb|AGT17223.1| MATE efflux family protein [Saccharum hybrid cultivar R570]
Length=516

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LGAKGIW GM+GGT MQT+IL W+T RT+W KEVE  +KRLNQ +  ++PLL
Sbjct  456  FKFHLGAKGIWTGMLGGTCMQTLILFWITFRTNWNKEVEEVRKRLNQCEDNKQPLL  511



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  WD      L
Sbjct  448  FKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWDTNNSASL  503



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GA+GIW GMIGGT+MQTIIL+ VT RTDWVKEVE A +RL+QW+    PLL +
Sbjct  163  FTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWVKEVEKASRRLDQWE-DTSPLLKQ  219



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  334
            F F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++W+ KR
Sbjct  453  FKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWKKEVEKAKSRLHKWEDKR  504



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  450  FKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKEVEKARNRMDEWGDKTELLLKE  507



>ref|XP_006282967.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
 gb|EOA15865.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
Length=505

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            F FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD  +E
Sbjct  448  FTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVETAKKRLDMWDDVKE  500



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            FYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEV+ A KRL++WD   +P++
Sbjct  457  FYFNFGAKGIWVGLMGGTFMQTVILVWVTWRTDWNKEVDEAIKRLSKWDDTAKPVV  512



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            F F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEV  A  RL +WD ++E
Sbjct  454  FKFDLGAKGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEKWDDRQE  506



>ref|XP_009137221.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=508

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  325
            F FNL AKGIW GMIGGT+MQT+ILL+VT +TDW KEVE A+KRL+ WD K+  L
Sbjct  452  FTFNLQAKGIWTGMIGGTLMQTLILLYVTYQTDWDKEVEKARKRLDMWDDKKNSL  506



>emb|CDY64933.1| BnaCnng45550D [Brassica napus]
Length=505

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F +++GAKGIW GMI GT+MQTIILL VT RTDW KEVE A +RL+QW+  + PLL
Sbjct  448  FTYDMGAKGIWTGMIAGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLL  503



>gb|EEE67272.1| hypothetical protein OsJ_24453 [Oryza sativa Japonica Group]
Length=424

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F+ G KG+W GMIGGT++QT+IL+W+T RTDW KEVE A++RL++WD  ++PLL
Sbjct  365  FKFDYGIKGLWGGMIGGTLIQTLILIWITFRTDWNKEVEDARRRLDKWDDTKQPLL  420



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F  ++GAKGIW GM+GGT MQT++LLW T RT+W KEVE A+ RL+ WDA  EPLL
Sbjct  459  FACDMGAKGIWTGMLGGTAMQTLVLLWATFRTNWGKEVEKAQGRLDTWDATNEPLL  514



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            F +++GA GIW GMIGGT+MQTIILL VT RTDW KEVE A +RL+QW+  + PLL +
Sbjct  450  FTYDMGAMGIWTGMIGGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  507



>ref|XP_009110708.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=504

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F +++GAKGIW GMI GT+MQTIILL VT RTDW KEVE A +RL+QW+  + PLL
Sbjct  447  FTYDMGAKGIWTGMIAGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLL  502



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F  ++GAKGIW GM+GGT+MQTI+LLW T RT+W KEVE A  RL+ W+  +EPLL
Sbjct  456  FTCDMGAKGIWSGMLGGTIMQTIVLLWATFRTNWKKEVEKAHSRLDSWNDNKEPLL  511



>emb|CDX98713.1| BnaA03g44980D [Brassica napus]
Length=455

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  331
            F FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K  
Sbjct  400  FTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKES  452



>ref|XP_008667480.1| PREDICTED: putative MATE efflux family protein isoform 1 isoform 
X1 [Zea mays]
Length=567

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  489  FYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            F F  G KG+W GMIGGT++QT+ L+W+T+RTDW KEVE A+KRL++WD  R+PL+
Sbjct  508  FKFGFGIKGLWGGMIGGTLIQTLALIWITLRTDWNKEVEEARKRLDKWDDTRQPLV  563



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490