BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050P01

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           209   3e-63   Solanum tuberosum [potatoes]
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           208   5e-63   Solanum tuberosum [potatoes]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                208   7e-63   Solanum lycopersicum
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             207   8e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                207   8e-63   Solanum lycopersicum
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   207   1e-62   
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           207   1e-62   Nicotiana tomentosiformis
gb|KHG04393.1|  60S ribosomal L5                                        206   1e-62   Gossypium arboreum [tree cotton]
ref|XP_002524558.1|  ribosomal protein L5, putative                     207   2e-62   Ricinus communis
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   207   2e-62   
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           207   2e-62   Nicotiana sylvestris
ref|XP_010101365.1|  60S ribosomal protein L5                           207   3e-62   
ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                205   8e-62   Nicotiana sylvestris
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           205   1e-61   Nicotiana tomentosiformis
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           204   1e-61   
emb|CDP18434.1|  unnamed protein product                                206   1e-61   Coffea canephora [robusta coffee]
gb|KJB71614.1|  hypothetical protein B456_011G133700                    204   1e-61   Gossypium raimondii
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           204   2e-61   Sesamum indicum [beniseed]
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                204   3e-61   Prunus mume [ume]
gb|KJB84075.1|  hypothetical protein B456_N001600                       199   4e-61   Gossypium raimondii
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                203   5e-61   Populus euphratica
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                203   5e-61   Nicotiana tomentosiformis
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           202   7e-61   Populus euphratica
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         202   9e-61   Jatropha curcas
gb|KHG14330.1|  60S ribosomal L5                                        201   9e-61   Gossypium arboreum [tree cotton]
gb|KJB27798.1|  hypothetical protein B456_005G010200                    202   1e-60   Gossypium raimondii
gb|KHG10377.1|  60S ribosomal protein L5                                201   2e-60   Gossypium arboreum [tree cotton]
gb|KHG10378.1|  60S ribosomal protein L5                                200   2e-60   Gossypium arboreum [tree cotton]
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             201   3e-60   Citrus clementina [clementine]
gb|KJB84074.1|  hypothetical protein B456_N001600                       199   3e-60   Gossypium raimondii
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           201   3e-60   Citrus sinensis [apfelsine]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   201   3e-60   Citrus sinensis [apfelsine]
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                201   3e-60   Nelumbo nucifera [Indian lotus]
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           201   3e-60   Nicotiana sylvestris
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           201   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                201   4e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001274803.1|  uncharacterized protein LOC102577675               201   4e-60   Solanum tuberosum [potatoes]
gb|ADR71226.1|  60S ribosomal protein L5B                               201   5e-60   Hevea brasiliensis [jebe]
gb|ABK93596.1|  unknown                                                 200   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             200   6e-60   Populus trichocarpa [western balsam poplar]
emb|CDP17898.1|  unnamed protein product                                202   8e-60   Coffea canephora [robusta coffee]
gb|ADR71225.1|  60S ribosomal protein L5A                               200   1e-59   Hevea brasiliensis [jebe]
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  198   1e-59   Citrus sinensis [apfelsine]
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     199   1e-59   Eucalyptus grandis [rose gum]
gb|KJB84072.1|  hypothetical protein B456_N001600                       199   1e-59   Gossypium raimondii
gb|KJB84073.1|  hypothetical protein B456_N001600                       199   1e-59   Gossypium raimondii
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  199   2e-59   Citrus sinensis [apfelsine]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           199   2e-59   Citrus sinensis [apfelsine]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                199   2e-59   Sesamum indicum [beniseed]
ref|XP_002524859.1|  ribosomal protein L5, putative                     199   3e-59   Ricinus communis
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           201   4e-59   
gb|AES74307.2|  60S ribosomal protein L5-2                              197   8e-59   Medicago truncatula
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             200   9e-59   
gb|ACJ85054.1|  unknown                                                 197   9e-59   Medicago truncatula
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     197   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     197   1e-58   
gb|AFK41086.1|  unknown                                                 197   1e-58   Medicago truncatula
ref|XP_003604056.1|  60S ribosomal protein L5                           198   1e-58   
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                197   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                197   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                196   2e-58   Eucalyptus grandis [rose gum]
tpg|DAA56364.1|  TPA: hypothetical protein ZEAMMB73_635593              194   2e-58   
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           196   4e-58   Cicer arietinum [garbanzo]
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           196   4e-58   Populus euphratica
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         196   4e-58   Jatropha curcas
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                195   5e-58   Vitis vinifera
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           194   5e-58   
emb|CBI24704.3|  unnamed protein product                                196   7e-58   Vitis vinifera
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     197   8e-58   Eucalyptus grandis [rose gum]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         195   9e-58   Tarenaya hassleriana [spider flower]
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              194   1e-57   Zea mays [maize]
gb|ACG36552.1|  60S ribosomal protein L5-1                              194   1e-57   Zea mays [maize]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           194   1e-57   
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           194   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             194   2e-57   
gb|ABK95722.1|  unknown                                                 194   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         194   2e-57   Brachypodium distachyon [annual false brome]
gb|KJB22669.1|  hypothetical protein B456_004G060400                    194   2e-57   Gossypium raimondii
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                194   2e-57   Fragaria vesca subsp. vesca
gb|KJB22668.1|  hypothetical protein B456_004G060400                    194   2e-57   Gossypium raimondii
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             193   3e-57   Phaseolus vulgaris [French bean]
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                193   4e-57   Elaeis guineensis
gb|AFW84308.1|  hypothetical protein ZEAMMB73_937605                    191   4e-57   
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           193   5e-57   Sesamum indicum [beniseed]
gb|KHG15135.1|  60S ribosomal L5                                        191   6e-57   Gossypium arboreum [tree cotton]
gb|EYU36673.1|  hypothetical protein MIMGU_mgv1a0142632mg               187   7e-57   Erythranthe guttata [common monkey flower]
gb|ABK93902.1|  unknown                                                 192   8e-57   Populus trichocarpa [western balsam poplar]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             192   1e-56   Phaseolus vulgaris [French bean]
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    192   2e-56   
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           191   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    191   2e-56   Elaeis guineensis
dbj|BAB33422.1|  putative senescence-associated protein                 191   2e-56   Pisum sativum [garden pea]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   191   2e-56   
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         191   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           191   3e-56   Cicer arietinum [garbanzo]
gb|ACR38045.1|  unknown                                                 191   3e-56   Zea mays [maize]
gb|ACU23594.1|  unknown                                                 191   3e-56   Glycine max [soybeans]
gb|EMT04099.1|  60S ribosomal protein L5-2                              190   5e-56   
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   191   7e-56   
gb|AFK39593.1|  unknown                                                 190   7e-56   Lotus japonicus
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              190   8e-56   Brachypodium distachyon [annual false brome]
gb|KJB27799.1|  hypothetical protein B456_005G010200                    189   8e-56   Gossypium raimondii
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   189   9e-56   Phaseolus vulgaris [French bean]
ref|XP_004171975.1|  PREDICTED: 60S ribosomal protein L5-like           188   9e-56   
ref|NP_001151284.1|  60S ribosomal protein L5-1                         189   1e-55   Zea mays [maize]
sp|P93779.1|RL5_SOLME  RecName: Full=60S ribosomal protein L5           184   1e-55   Solanum melongena [aubergine]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           191   1e-55   Glycine max [soybeans]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           189   1e-55   Phoenix dactylifera
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                189   2e-55   Cucumis melo [Oriental melon]
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           189   2e-55   Phoenix dactylifera
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           189   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           189   2e-55   Cucumis melo [Oriental melon]
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                189   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           188   2e-55   Glycine max [soybeans]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         188   3e-55   Pyrus x bretschneideri [bai li]
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         188   4e-55   Oryza brachyantha
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           187   7e-55   Cucumis sativus [cucumbers]
gb|KHN36792.1|  60S ribosomal protein L5                                187   7e-55   Glycine soja [wild soybean]
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         187   8e-55   Malus domestica [apple tree]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    187   9e-55   Phoenix dactylifera
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         187   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    187   1e-54   
gb|AEV92989.1|  60S ribosomal protein L5                                187   1e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                187   1e-54   
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           186   1e-54   Glycine max [soybeans]
gb|EMS47485.1|  60S ribosomal protein L5-1                              185   2e-54   Triticum urartu
ref|NP_001267659.1|  60S ribosomal protein L5                           186   2e-54   Cucumis sativus [cucumbers]
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    186   2e-54   Glycine max [soybeans]
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                186   3e-54   Malus domestica [apple tree]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           186   3e-54   Glycine max [soybeans]
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           186   3e-54   Fragaria vesca subsp. vesca
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           185   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             185   4e-54   Phaseolus vulgaris [French bean]
gb|AHA84189.1|  60S ribosomal protein L5                                185   5e-54   Phaseolus vulgaris [French bean]
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           185   5e-54   
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    186   5e-54   
dbj|BAJ89012.1|  predicted protein                                      185   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           185   7e-54   
gb|KHN27258.1|  60S ribosomal protein L5                                184   8e-54   Glycine soja [wild soybean]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              184   9e-54   Tarenaya hassleriana [spider flower]
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         184   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         184   1e-53   Setaria italica
gb|AFK46994.1|  unknown                                                 184   1e-53   Lotus japonicus
gb|AFK36106.1|  unknown                                                 184   1e-53   Lotus japonicus
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        184   2e-53   
dbj|BAD82173.1|  putative ribosomal protein L5                          183   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             183   3e-53   Prunus persica
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      183   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    183   4e-53   Oryza brachyantha
ref|NP_001045083.1|  Os01g0896800                                       183   4e-53   
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        183   4e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    182   5e-53   
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          182   6e-53   Sorghum bicolor [broomcorn]
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         182   9e-53   Prunus mume [ume]
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             181   1e-52   Eutrema salsugineum [saltwater cress]
gb|EMS59984.1|  60S ribosomal protein L5-2                              181   2e-52   Triticum urartu
gb|EMT23062.1|  60S ribosomal protein L5-2                              180   6e-52   
gb|EMT20601.1|  60S ribosomal protein L5-2                              180   6e-52   
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         179   1e-51   Zea mays [maize]
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               179   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_010451808.1|  PREDICTED: 60S ribosomal protein L5-1-like         173   2e-51   
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         178   2e-51   
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         178   3e-51   Tarenaya hassleriana [spider flower]
gb|KHF99386.1|  60S ribosomal L5                                        176   4e-51   Gossypium arboreum [tree cotton]
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             177   4e-51   Arabidopsis lyrata subsp. lyrata
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    177   5e-51   Arabis alpina [alpine rockcress]
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           178   7e-51   Elaeis guineensis
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             177   8e-51   
ref|NP_001189970.1|  60S ribosomal protein L5-1                         173   9e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010648788.1|  PREDICTED: 60S ribosomal protein L5-like           173   1e-50   Vitis vinifera
gb|KHN15970.1|  60S ribosomal protein L5                                176   1e-50   Glycine soja [wild soybean]
ref|XP_009384264.1|  PREDICTED: 60S ribosomal protein L5-like iso...    172   2e-50   
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    176   2e-50   Brassica rapa
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    176   3e-50   Arabis alpina [alpine rockcress]
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             176   3e-50   Eutrema salsugineum [saltwater cress]
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    175   3e-50   
ref|NP_198790.1|  60S ribosomal protein L5-2                            175   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384265.1|  PREDICTED: 60S ribosomal protein L5-like iso...    172   7e-50   
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             174   1e-49   Capsella rubella
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         174   2e-49   Camelina sativa [gold-of-pleasure]
ref|NP_566767.1|  60S ribosomal protein L5-1                            173   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         173   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         173   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         173   2e-49   Camelina sativa [gold-of-pleasure]
dbj|BAH20263.1|  AT3G25520                                              170   2e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86312.1|  BnaA06g30290D                                          173   2e-49   
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         173   3e-49   Brassica rapa
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             173   3e-49   
emb|CDY52294.1|  BnaA03g57870D                                          173   4e-49   Brassica napus [oilseed rape]
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          172   4e-49   
emb|CDY27889.1|  BnaA07g04790D                                          172   4e-49   Brassica napus [oilseed rape]
emb|CDY52293.1|  BnaA03g57860D                                          173   5e-49   Brassica napus [oilseed rape]
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    172   5e-49   Camelina sativa [gold-of-pleasure]
emb|CDX85331.1|  BnaC07g26420D                                          174   9e-49   
gb|AFK34395.1|  unknown                                                 171   1e-48   Lotus japonicus
emb|CDY50258.1|  BnaC07g47930D                                          171   1e-48   Brassica napus [oilseed rape]
emb|CDY15089.1|  BnaC03g44500D                                          171   2e-48   Brassica napus [oilseed rape]
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             171   2e-48   Capsella rubella
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              170   3e-48   
gb|AAM64753.1|  ribosomal protein, putative                             170   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876523.1|  predicted protein                                  169   8e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         168   2e-47   Brassica rapa
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             166   1e-46   Capsella rubella
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   164   3e-46   Citrus sinensis [apfelsine]
gb|ABK21084.1|  unknown                                                 164   6e-46   Picea sitchensis
gb|KJB71615.1|  hypothetical protein B456_011G133700                    162   1e-45   Gossypium raimondii
gb|KJB10810.1|  hypothetical protein B456_001G226000                    162   3e-45   Gossypium raimondii
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     160   1e-44   Eucalyptus grandis [rose gum]
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            159   1e-44   
gb|KCW63927.1|  hypothetical protein EUGRSUZ_G016041                    155   4e-44   Eucalyptus grandis [rose gum]
ref|XP_001759628.1|  predicted protein                                  159   7e-44   
ref|XP_001767871.1|  predicted protein                                  158   9e-44   
ref|XP_001783620.1|  predicted protein                                  158   9e-44   
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  155   5e-43   Citrus sinensis [apfelsine]
ref|XP_009383145.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    151   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY15088.1|  BnaC03g44490D                                          155   3e-42   Brassica napus [oilseed rape]
ref|XP_001783411.1|  predicted protein                                  154   5e-42   
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   151   7e-41   Phaseolus vulgaris [French bean]
gb|KHN36791.1|  60S ribosomal protein L5                                147   5e-40   Glycine soja [wild soybean]
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             144   2e-38   Selaginella moellendorffii
ref|XP_011014769.1|  PREDICTED: 60S ribosomal protein L5-like           138   2e-38   Populus euphratica
emb|CBI38287.3|  unnamed protein product                                137   5e-38   Vitis vinifera
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             142   1e-37   Selaginella moellendorffii
gb|ABK92743.1|  unknown                                                 134   1e-36   Populus trichocarpa [western balsam poplar]
gb|EPS61271.1|  hypothetical protein M569_13526                         137   4e-36   Genlisea aurea
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    137   6e-36   
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         135   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_011399144.1|  60S ribosomal protein L5-1                         129   2e-32   Auxenochlorella protothecoides
dbj|BAD94104.1|  ribosomal protein                                      122   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              127   8e-32   Chlorella variabilis
ref|XP_009373234.1|  PREDICTED: 60S ribosomal protein L5-like           120   9e-31   Pyrus x bretschneideri [bai li]
dbj|BAB10894.1|  60S ribosomal protein L5                               117   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          122   6e-30   
gb|KDD76608.1|  ribosomal L18p/L5e                                      119   8e-29   Helicosporidium sp. ATCC 50920
gb|EMS54008.1|  60S ribosomal protein L5-1                              114   1e-28   Triticum urartu
gb|EMT09987.1|  hypothetical protein F775_52606                         112   3e-28   
gb|EFX90266.1|  hypothetical protein DAPPUDRAFT_299917                  116   1e-27   Daphnia pulex
gb|KEZ38694.1|  hypothetical protein SAPIO_CDS10715                     113   1e-26   Scedosporium apiospermum
ref|XP_008198550.1|  PREDICTED: 60S ribosomal protein L5                113   1e-26   Tribolium castaneum [rust-red flour beetle]
gb|AAC32143.1|  probable 60S ribosomal protein L5                       107   1e-26   Picea mariana [black spruce]
ref|XP_005643753.1|  60S ribosomal protein L5                           112   3e-26   Coccomyxa subellipsoidea C-169
dbj|BAN20290.1|  ribosomal protein L5                                   112   3e-26   Riptortus pedestris
gb|AES86898.2|  ribosomal L18 carboxy-terminal region protein           107   1e-25   Medicago truncatula
ref|XP_002550737.1|  60S ribosomal protein L5                           110   1e-25   Candida tropicalis MYA-3404
ref|XP_004533872.1|  PREDICTED: 60S ribosomal protein L5-like           109   3e-25   Ceratitis capitata [medfly]
gb|EHJ70750.1|  ribosomal protein L5                                    108   6e-25   
gb|EMF17397.1|  60S ribosomal protein L5                                108   7e-25   Sphaerulina musiva SO2202
gb|EMS62821.1|  60S ribosomal protein L5-1                              104   8e-25   Triticum urartu
ref|NP_001037008.1|  60S ribosomal protein L5                           108   9e-25   Bombyx mori [silk moth]
gb|ADT80695.1|  ribosomal protein L5                                    108   1e-24   Euphydryas aurinia [marsh fritillary]
gb|KIK30810.1|  hypothetical protein PISMIDRAFT_86523                   108   1e-24   Pisolithus microcarpus 441
gb|AAV34814.1|  ribosomal protein L5                                    108   1e-24   Bombyx mori [silk moth]
gb|ABS18358.1|  ribosomal protein L5                                    105   1e-24   Artemia franciscana
ref|XP_002497480.1|  60S ribosomal protein L5                           107   1e-24   Zygosaccharomyces rouxii
gb|ACY95338.1|  ribosomal protein L5                                    107   2e-24   Manduca sexta [Carolina sphinx]
gb|AAS93729.1|  RE57391p                                                103   2e-24   Drosophila melanogaster
ref|XP_002617003.1|  hypothetical protein CLUG_02447                    107   2e-24   Clavispora lusitaniae ATCC 42720
gb|AGO11355.1|  AaceriACR104Cp                                          107   3e-24   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_001729279.1|  hypothetical protein MGL_3746                      103   3e-24   Malassezia globosa CBS 7966
ref|NP_983506.1|  60S ribosomal protein L5                              107   3e-24   Eremothecium gossypii ATCC 10895
ref|XP_007793071.1|  putative 60s ribosomal protein l5 protein          103   3e-24   
ref|XP_003648419.1|  hypothetical protein Ecym_8324                     106   3e-24   Eremothecium cymbalariae DBVPG#7215
ref|XP_011197235.1|  PREDICTED: 60S ribosomal protein L5                106   3e-24   Bactrocera dorsalis [papaya fruit fly]
ref|XP_003604701.1|  60S ribosomal protein L5-1                         105   4e-24   
ref|XP_007738723.1|  60S ribosomal protein L5                           106   4e-24   Capronia epimyces CBS 606.96
ref|XP_002002621.1|  GI17484                                            109   4e-24   
ref|XP_007773415.1|  60S ribosomal protein L5                           106   4e-24   Coniophora puteana RWD-64-598 SS2
ref|XP_007880337.1|  hypothetical protein PFL1_04620                    106   4e-24   Anthracocystis flocculosa PF-1
emb|CCQ18634.1|  60S ribosomal protein L5                               106   5e-24   Sycon ciliatum
ref|XP_007392523.1|  hypothetical protein PHACADRAFT_250801             106   5e-24   Phanerochaete carnosa HHB-10118-sp
gb|KDR83692.1|  hypothetical protein GALMADRAFT_236026                  106   6e-24   Galerina marginata CBS 339.88
ref|XP_011191002.1|  PREDICTED: 60S ribosomal protein L5                105   7e-24   Zeugodacus cucurbitae [melon fruit fly]
gb|KIO13004.1|  hypothetical protein M404DRAFT_706860                   105   9e-24   Pisolithus tinctorius Marx 270
ref|XP_005188116.1|  PREDICTED: 60S ribosomal protein L5                105   1e-23   Musca domestica
ref|XP_003349274.1|  60S ribosomal protein L5                           105   1e-23   Sordaria macrospora k-hell
ref|XP_003424029.1|  PREDICTED: 60S ribosomal protein L5                105   1e-23   Nasonia vitripennis
emb|CAJ17229.1|  ribosomal protein L5e                                  105   1e-23   Carabus granulatus
ref|XP_001912102.1|  hypothetical protein                               105   1e-23   Podospora anserina S mat+
gb|KJA30227.1|  hypothetical protein HYPSUDRAFT_196476                  105   1e-23   Hypholoma sublateritium FD-334 SS-4
ref|XP_001639289.1|  predicted protein                                  104   2e-23   
sp|Q56FG6.1|RL5_LYSTE  RecName: Full=60S ribosomal protein L5           104   2e-23   
emb|CAJ17231.1|  ribosomal protein L5e                                  100   2e-23   
ref|XP_003856228.1|  60S ribosomal protein L5                           104   3e-23   
emb|CAJ17230.1|  ribosomal protein L5e                                  103   3e-23   
ref|XP_007381881.1|  60S ribosomal protein L5                           104   3e-23   
ref|XP_007366056.1|  hypothetical protein DICSQDRAFT_86741              103   3e-23   
emb|CDO75577.1|  hypothetical protein BN946_scf184858.g17               103   3e-23   
ref|XP_009847564.1|  hypothetical protein NEUTE1DRAFT_75066             103   3e-23   
ref|XP_007861880.1|  60S ribosomal protein L5                           103   3e-23   
ref|XP_001268969.1|  60S ribosomal protein L5                           103   3e-23   
ref|XP_004182559.1|  hypothetical protein TBLA_0J00400                  103   4e-23   
gb|EPY50445.1|  60S ribosomal protein L5                                103   4e-23   
gb|EPY50651.1|  60S ribosomal protein L5                                103   4e-23   
ref|XP_007920104.1|  hypothetical protein MYCFIDRAFT_54807              103   4e-23   
ref|XP_009153803.1|  60S ribosomal protein L5                           103   4e-23   
gb|KIJ20064.1|  hypothetical protein PAXINDRAFT_166226                  103   4e-23   
gb|EJK70557.1|  hypothetical protein THAOC_08069                        103   4e-23   
gb|KID72246.1|  Ribosomal protein L5, eukaryotic/archaeal               103   5e-23   
ref|XP_960578.1|  60s ribosomal protein l5                              103   5e-23   
dbj|BAA31570.1|  ribosomal protein L5 homolog                           102   5e-23   
ref|NP_001036387.1|  ribosomal protein L5, isoform A                    103   5e-23   
ref|XP_002066772.1|  GK24660                                            103   5e-23   
ref|XP_453370.1|  60S ribosomal protein L5                              103   6e-23   
ref|XP_001973913.1|  GG21448                                            103   6e-23   
ref|XP_002044351.1|  GM26730                                            103   6e-23   
emb|CCF48291.1|  probable RPL5-60S large subunit ribosomal protei...    103   6e-23   
ref|XP_003675508.1|  hypothetical protein NCAS_0C01510                  103   6e-23   
gb|KID66354.1|  Ribosomal protein L5, eukaryotic/archaeal               103   6e-23   
gb|KIM46136.1|  hypothetical protein M413DRAFT_441200                   103   6e-23   
gb|AEL28875.1|  ribosomal protein L5                                    103   7e-23   
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   102   7e-23   
emb|CCX32875.1|  Similar to 60S ribosomal protein L5; acc. no. O5...    103   7e-23   
ref|XP_002023101.1|  GL21177                                            102   7e-23   
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 102   7e-23   
gb|EPX71630.1|  60S ribosomal protein L5                                102   8e-23   
ref|XP_003649901.1|  60S ribosomal protein L5                           102   8e-23   
gb|KIW93473.1|  60S ribosomal protein L5                                102   8e-23   
ref|XP_011167373.1|  PREDICTED: 60S ribosomal protein L5                102   8e-23   
sp|O65353.1|RL5_HELAN  RecName: Full=60S ribosomal protein L5           102   8e-23   
ref|XP_007725761.1|  60S ribosomal protein L5                           102   8e-23   
gb|KIK95588.1|  hypothetical protein PAXRUDRAFT_826861                  102   9e-23   
gb|EFZ13276.1|  hypothetical protein SINV_12586                         102   9e-23   
ref|XP_007816229.1|  Ribosomal protein L5, eukaryotic/archaeal          102   9e-23   
gb|KEF55260.1|  60S ribosomal protein L5                                102   9e-23   
ref|XP_001264474.1|  60S ribosomal protein L5                           103   1e-22   
dbj|BAM19090.1|  ribosomal protein L5                                   102   1e-22   
gb|KID85893.1|  Ribosomal protein L5, eukaryotic/archaeal               102   1e-22   
gb|KIY49257.1|  hypothetical protein FISHEDRAFT_72600                   102   1e-22   
ref|XP_004200165.1|  Piso0_002740                                       102   1e-22   
ref|XP_007800448.1|  60S ribosomal protein L5                           102   1e-22   
gb|EPX72323.1|  60S ribosomal protein L5                                102   1e-22   
gb|KDR11979.1|  60S ribosomal protein L5                                102   1e-22   
ref|XP_006689766.1|  hypothetical protein CANTEDRAFT_116632             102   1e-22   
gb|KDQ29411.1|  hypothetical protein PLEOSDRAFT_1055401                 102   1e-22   
ref|XP_001966910.1|  GF22760                                            102   1e-22   
gb|KIK06671.1|  hypothetical protein K443DRAFT_673956                   102   1e-22   
gb|EMG45911.1|  60S ribosomal protein L5                                102   1e-22   
ref|XP_003662289.1|  hypothetical protein MYCTH_78218                   102   1e-22   
ref|XP_002109848.1|  expressed hypothetical protein                     102   1e-22   
gb|KHN10903.1|  60S ribosomal protein L5-1                            98.6    1e-22   
ref|XP_008474018.1|  PREDICTED: 60S ribosomal protein L5                102   1e-22   
gb|ADQ73874.1|  60S ribosomal protein L5                                102   1e-22   
ref|XP_007813241.1|  60S ribosomal protein L5                           102   2e-22   
gb|KIK68088.1|  hypothetical protein GYMLUDRAFT_92742                   102   2e-22   
ref|NP_596399.1|  60S ribosomal protein L5                              102   2e-22   
ref|XP_007712612.1|  hypothetical protein COCCADRAFT_5332               102   2e-22   
gb|KIM67945.1|  hypothetical protein SCLCIDRAFT_107388                  102   2e-22   
ref|XP_002295395.1|  RL5, ribosomal protein 5, 60S large ribosoma...    102   2e-22   
ref|XP_001877132.1|  60S ribosomal protein L5                           102   2e-22   
ref|XP_007687883.1|  hypothetical protein COCMIDRAFT_36698              102   2e-22   
gb|KEQ78036.1|  hypothetical protein M436DRAFT_59974                    101   2e-22   
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             102   2e-22   
gb|KEQ82579.1|  hypothetical protein M438DRAFT_398586                   101   2e-22   
gb|KIM25886.1|  hypothetical protein M408DRAFT_330884                   102   2e-22   
emb|CCF42723.1|  60S ribosomal protein L5                             99.0    2e-22   
gb|KIX05556.1|  60S ribosomal protein L5                                101   2e-22   
gb|KHN96356.1|  60S ribosomal protein L5                                101   2e-22   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     101   2e-22   
gb|KII95147.1|  hypothetical protein PLICRDRAFT_97457                   101   2e-22   
ref|XP_011105789.1|  rpl5p                                              101   2e-22   
dbj|BAM17686.1|  ribosomal protein L5                                   101   2e-22   
ref|XP_011264134.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    101   2e-22   
gb|AEE61390.1|  unknown                                                 101   2e-22   
ref|XP_007746291.1|  60S ribosomal protein L5                           101   3e-22   
ref|XP_003173381.1|  60S ribosomal protein L5                           101   3e-22   
gb|KFH68392.1|  60S ribosomal protein L5                                101   3e-22   
ref|XP_007705225.1|  hypothetical protein COCSADRAFT_41417              101   3e-22   
ref|XP_008022306.1|  hypothetical protein SETTUDRAFT_167313             100   3e-22   
gb|KEQ61687.1|  hypothetical protein M437DRAFT_67147                    101   3e-22   
emb|CCK72232.1|  hypothetical protein KNAG_0J01510                      101   3e-22   
gb|ACY66547.1|  ribosomal protein L5                                  99.0    3e-22   
ref|XP_007852257.1|  60s ribosomal protein l5                           101   3e-22   
gb|KEQ95896.1|  hypothetical protein AUEXF2481DRAFT_39748               101   3e-22   
ref|XP_003670285.1|  ribosomal protein L5                               101   3e-22   
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       101   3e-22   
emb|CEJ93107.1|  Putative 60S ribosomal protein L5 (CPR4)               100   3e-22   
ref|XP_003958806.1|  hypothetical protein KAFR_0H02620                  101   3e-22   
ref|XP_003487475.1|  PREDICTED: 60S ribosomal protein L5-like           101   3e-22   
ref|XP_001837210.1|  60S ribosomal protein L5                           101   3e-22   
emb|CDF91015.1|  ZYBA0S09-02894g1_1                                     101   4e-22   
ref|XP_003394373.1|  PREDICTED: 60S ribosomal protein L5-like           101   4e-22   
gb|KDQ64549.1|  hypothetical protein JAAARDRAFT_28194                   101   4e-22   
emb|CCE29368.1|  probable 60S ribosomal protein L5                      100   4e-22   
gb|EMD40741.1|  hypothetical protein CERSUDRAFT_80390                   100   4e-22   
ref|XP_009543697.1|  hypothetical protein HETIRDRAFT_408220             100   4e-22   
gb|KIJ70516.1|  hypothetical protein HYDPIDRAFT_78845                   100   4e-22   
ref|XP_002176750.1|  predicted protein                                  100   5e-22   
ref|XP_003842266.1|  similar to 60S ribosomal protein L5                100   5e-22   
ref|XP_007275120.1|  60s ribosomal protein l5                           100   5e-22   
emb|CDO93596.1|  unnamed protein product                                100   5e-22   
emb|CDH08743.1|  probable 60S ribosomal protein L5                      100   5e-22   
gb|EQB57780.1|  hypothetical protein CGLO_02053                         100   5e-22   
ref|XP_011150405.1|  PREDICTED: 60S ribosomal protein L5-like           100   6e-22   
gb|ELU36170.1|  60S ribosomal protein L5                                100   6e-22   
ref|XP_011390982.1|  ribosomal 60S subunit protein L5                   100   6e-22   
ref|XP_002675028.1|  predicted protein                                  100   6e-22   
ref|XP_007315632.1|  hypothetical protein SERLADRAFT_461185             100   6e-22   
ref|XP_002130156.1|  PREDICTED: 60S ribosomal protein L5                100   6e-22   
gb|EPT03783.1|  hypothetical protein FOMPIDRAFT_1022326                 100   6e-22   
ref|XP_001951987.1|  PREDICTED: 60S ribosomal protein L5                100   7e-22   
gb|EFN77280.1|  60S ribosomal protein L5                                100   7e-22   
ref|XP_011264968.1|  PREDICTED: 60S ribosomal protein L5-like           100   8e-22   
gb|EFN62403.1|  60S ribosomal protein L5                                100   8e-22   
gb|KIY71482.1|  hypothetical protein CYLTODRAFT_487247                  100   9e-22   
ref|XP_006611949.1|  PREDICTED: 60S ribosomal protein L5-like           100   9e-22   
ref|XP_004199306.1|  Piso0_002740                                     99.8    9e-22   
ref|NP_594180.1|  60S ribosomal protein L5                            99.8    1e-21   
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                   99.8    1e-21   
ref|XP_002478553.1|  60S ribosomal protein L5                         99.8    1e-21   
gb|EMR84013.1|  putative 60s ribosomal protein l5 protein             99.8    1e-21   
emb|CEJ93106.1|  Putative 60S ribosomal protein L5 (CPR4)             99.8    1e-21   
ref|XP_001612181.1|  ribosomal L18p/L5e family protein                99.8    1e-21   
ref|XP_003006324.1|  60S ribosomal protein L5                         99.8    1e-21   
gb|EFN62999.1|  60S ribosomal protein L5                                103   1e-21   
gb|KDN36129.1|  putative RPL5-60S large subunit ribosomal protein...  99.8    1e-21   
gb|KIV84110.1|  60S ribosomal protein L5                              99.8    1e-21   
gb|ACG27083.1|  60S ribosomal protein L5-2                            99.8    1e-21   
ref|XP_002845089.1|  60S ribosomal protein L5                         99.8    1e-21   
ref|XP_007268728.1|  60S ribosomal protein L5                         99.8    1e-21   
gb|EPS25441.1|  hypothetical protein PDE_00374                        99.4    1e-21   
ref|XP_011054859.1|  PREDICTED: 60S ribosomal protein L5              99.4    1e-21   
gb|ACB37346.1|  Ts5 protein                                           99.4    1e-21   
emb|CEL63831.1|  60S ribosomal protein L5-A OS=Schizosaccharomyce...  99.8    1e-21   
gb|KDB12690.1|  60S ribosomal protein L5                              99.8    1e-21   
ref|XP_001547892.1|  60S ribosomal protein L5                         99.4    1e-21   
gb|EHM99874.1|  Rpl5p                                                 99.4    2e-21   
gb|KIP10396.1|  hypothetical protein PHLGIDRAFT_28501                 99.4    2e-21   
ref|XP_007303062.1|  hypothetical protein STEHIDRAFT_120627           99.4    2e-21   
ref|XP_624620.2|  PREDICTED: 60S ribosomal protein L5                 99.4    2e-21   
ref|XP_006460296.1|  hypothetical protein AGABI2DRAFT_142569          99.4    2e-21   
gb|KIW09974.1|  60S ribosomal protein L5                              99.0    2e-21   
ref|XP_001588768.1|  60S ribosomal protein L5                         99.0    2e-21   
ref|XP_007329342.1|  hypothetical protein AGABI1DRAFT_84575           99.0    2e-21   
gb|ADV40159.1|  putative 60S ribosomal protein L5                     99.0    2e-21   
ref|XP_003708145.1|  PREDICTED: 60S ribosomal protein L5-like         99.0    2e-21   
gb|KIW58102.1|  60S ribosomal protein L5                              99.0    2e-21   
ref|XP_009648689.1|  60S ribosomal protein L5                         99.0    2e-21   
ref|XP_002490002.1|  60S ribosomal protein L5                         99.0    2e-21   
ref|XP_001224676.1|  60S ribosomal protein L5                         99.0    2e-21   
ref|XP_003010152.1|  hypothetical protein ARB_03590                   99.0    2e-21   
ref|XP_006696670.1|  60S ribosomal protein l5-like protein            99.0    2e-21   
ref|XP_011302246.1|  PREDICTED: 60S ribosomal protein L5              99.0    2e-21   
emb|CCU97371.1|  unnamed protein product                              99.0    2e-21   
gb|EFQ28351.1|  ribosomal L18p/L5e family protein                     98.6    2e-21   
dbj|BAN65645.1|  ribosomal L18p/L5e family protein                    98.6    2e-21   
gb|KDN68874.1|  putative ribosomal L18p/L5e family protein            98.6    2e-21   
ref|XP_003036567.1|  60S ribosomal protein L5                         98.6    2e-21   
ref|XP_011506330.1|  PREDICTED: 60S ribosomal protein L5              98.6    3e-21   
ref|XP_007779399.1|  60S ribosomal protein L5                         98.6    3e-21   
ref|XP_002625745.1|  60S ribosomal protein L5                         98.6    3e-21   
ref|XP_011444358.1|  PREDICTED: 60S ribosomal protein L5-like         95.1    3e-21   
gb|EKC29232.1|  60S ribosomal protein L5                              95.1    3e-21   
ref|XP_001940200.1|  60S ribosomal protein L5                         98.6    3e-21   
gb|EUC66279.1|  60S ribosomal protein L5                              98.2    3e-21   
gb|ENH79878.1|  60s ribosomal protein l5                              98.2    4e-21   
ref|XP_008599464.1|  60S ribosomal protein L5 (CPR4)                  98.2    4e-21   
gb|KDQ12695.1|  hypothetical protein BOTBODRAFT_34150                 98.2    4e-21   
gb|EUB56475.1|  60S ribosomal protein L5                              98.2    4e-21   
ref|XP_004992672.1|  ribosomal protein L5                             98.2    4e-21   
gb|AAN73355.1|  ribosomal protein L5                                  97.8    4e-21   
emb|CCF44686.1|  60S ribosomal protein L5                             98.2    4e-21   
ref|XP_001634531.1|  predicted protein                                98.2    4e-21   
ref|XP_002146254.1|  60S ribosomal protein L5                         98.2    4e-21   
gb|KIW22485.1|  60S ribosomal protein L5                              98.2    4e-21   
sp|Q5XUC7.1|RL5_TOXCI  RecName: Full=60S ribosomal protein L5         97.8    4e-21   
ref|XP_003715227.1|  60S ribosomal protein L5                         98.2    5e-21   
emb|CDI55135.1|  probable RPL5-60S large subunit ribosomal protei...  97.8    5e-21   
emb|CDS19989.1|  ribosomal protein l5                                 97.8    5e-21   
gb|KHJ99496.1|  ribosomal L18p/L5e family protein                     97.8    5e-21   
gb|KIW74224.1|  60S ribosomal protein L5                              97.8    6e-21   
ref|XP_001210567.1|  60S ribosomal protein L5                         97.8    6e-21   
emb|CCG82998.1|  60S ribosomal protein L5-B                           97.8    6e-21   
ref|XP_007337949.1|  hypothetical protein AURDEDRAFT_110414           97.8    6e-21   
ref|XP_001242010.1|  60S ribosomal protein L5                         97.4    7e-21   
ref|XP_003234828.1|  60S ribosomal protein L5                         97.4    7e-21   
gb|KIK48932.1|  hypothetical protein CY34DRAFT_797724                 97.4    7e-21   
gb|EGE00888.1|  60S ribosomal protein L5                              97.4    7e-21   
gb|EGE06634.1|  60S ribosomal protein L5                              97.4    7e-21   
gb|KIR56129.1|  50S small subunit ribosomal protein L5e               97.4    7e-21   
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5              97.4    7e-21   
ref|XP_006013881.1|  PREDICTED: 60S ribosomal protein L5-B-like       94.4    7e-21   
ref|XP_011147768.1|  PREDICTED: 60S ribosomal protein L5-like         97.4    7e-21   
ref|XP_008553482.1|  PREDICTED: 60S ribosomal protein L5              97.4    7e-21   
ref|XP_001854652.1|  60S ribosomal protein L5                         97.4    7e-21   
gb|KIR87405.1|  50S small subunit ribosomal protein L5e               97.4    7e-21   
dbj|GAM82159.1|  hypothetical protein ANO11243_001380                 97.4    7e-21   
gb|KIR67575.1|  50S small subunit ribosomal protein L5e               97.4    7e-21   
sp|O22608.1|RL5_DUNSA  RecName: Full=60S ribosomal protein L5         97.1    7e-21   
ref|NP_001104213.1|  uncharacterized protein LOC100126642             97.4    8e-21   
emb|CEP64074.1|  LALA0S10e01684g1_1                                   97.4    8e-21   
gb|EGI65189.1|  60S ribosomal protein L5                                100   8e-21   
ref|XP_001483338.1|  hypothetical protein PGUG_04067                  97.4    8e-21   
gb|KIM90853.1|  hypothetical protein PILCRDRAFT_811340                97.4    8e-21   
ref|XP_001645025.1|  hypothetical protein Kpol_1072p37                97.4    8e-21   
gb|KIR48750.1|  50S small subunit ribosomal protein L5e               97.1    9e-21   
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                    97.1    9e-21   
ref|XP_003019448.1|  hypothetical protein TRV_06528                   97.1    9e-21   
ref|XP_009223169.1|  60S ribosomal protein L5                         97.1    9e-21   
gb|EFN79020.1|  60S ribosomal protein L5                              97.4    1e-20   
gb|KIL96266.1|  60s ribosomal protein l5                              97.1    1e-20   



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHVA YM+ LIEDEPEKYQ+ FS YIKKG++AD L
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYGGHVATYMKTLIEDEPEKYQTHFSEYIKKGLEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP  KKSEKQPPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRADPCPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDA+VHRKYIYGGHVA YM+ LIEDEPEKYQS FS YIK+G++ADNL
Sbjct  176  EKRFAGFSKDSKQLDADVHRKYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKRGLEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRA+PS KKSEKQPPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRAEPSPKKSEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHVA YM+ LIEDEPEKY S FS YIK+G++ADNL
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYGGHVATYMKTLIEDEPEKYLSHFSGYIKRGLEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRA+PS KKSEKQPPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRAEPSPKKSEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD+KQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQS FS Y+K+GIDAD +
Sbjct  176  DKRFAGFAKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+AKKSEKQPPKEHKRYNLKKLTYEERKA L+ RLNALN+AA
Sbjct  236  EALYKKVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLVERLNALNSAA  291



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDA+VHRKYIYGGHVA YM+ LIEDEPEKYQ+ FS YIKKG +AD L
Sbjct  176  EKRFAGFSKDSKQLDADVHRKYIYGGHVATYMQTLIEDEPEKYQTHFSQYIKKGFEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADPS KKSEKQPPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKY+YGGHVAAYMR L+EDEPEKYQS FS YIK+GI+AD+L
Sbjct  176  DKRFAGFSKDSKQLDAEVHRKYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+AKKSEK+PPKEHKR+NLKKLTYEERKA LI RL+ LN+AAG
Sbjct  236  EALYKKVHAAIRADPTAKKSEKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  292



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDA+VHRKYIYGGHVA YM+ L EDEPEKYQS FS YIK+G++AD+L
Sbjct  176  EKRFAGFSKDSKQLDADVHRKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADPS KKSEKQPPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>gb|KHG04393.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADN+
Sbjct  137  DKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMRILMEDEPEKYQSHFSEYIKRGIEADNI  196

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPSAKKSEK PPK+HKR+NLKKLTYEERKA LI RL+ LNAAAG
Sbjct  197  ESLYKKVHAAIRADPSAKKSEKAPPKQHKRFNLKKLTYEERKAKLIDRLHTLNAAAG  253



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+K+SKQLD+EVHRKYIYGGHVAAYMR L+EDEPEKYQS FS YIKKG+D DN+
Sbjct  176  EKRFAGFNKESKQLDSEVHRKYIYGGHVAAYMRMLLEDEPEKYQSHFSEYIKKGVDPDNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E++YKKVHAAIRADPSAKK+EKQPPKEHKRYNLKKLTYEERKA LI RL ALN+AA
Sbjct  236  EEMYKKVHAAIRADPSAKKTEKQPPKEHKRYNLKKLTYEERKAKLIERLTALNSAA  291



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKY+YGGHVAAYMR L+EDEPEKYQS FS YIK+GI+AD+L
Sbjct  177  DKRFAGFSKDSKQLDAEVHRKYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDL  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+AKKSEK+PPKEHKR+NLKKLTYEERKA LI RL+ LN+AAG
Sbjct  237  EALYKKVHAAIRADPTAKKSEKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  293



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDA+VHRKYIYGGHVA YM+ L EDEPEKYQS FS YIK+G++AD+L
Sbjct  176  EKRFAGFSKDSKQLDADVHRKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADPS KKSEKQPPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMR L EDEPEK+ + FS Y+K+GIDADNL
Sbjct  181  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRTLAEDEPEKFLAHFSEYLKRGIDADNL  240

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ +KSEKQPPKEHKRYNLKKLTYEERKA LI RLNA N+AA
Sbjct  241  EELYKKVHAAIRADPTGRKSEKQPPKEHKRYNLKKLTYEERKAKLIERLNAFNSAA  296



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   205 bits (522),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDA+VHR YIYGGHVA YM+ LIEDEPEKYQS FS YIKKG++AD L
Sbjct  176  EKRFAGFSKDSKQLDADVHRNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KKS+KQPPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRADPTFKKSDKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KDSKQLDA+VHRKYIYGGHV+AYM+ L+EDEPEKYQS FS YIK G++AD+L
Sbjct  176  EKRFAGFGKDSKQLDADVHRKYIYGGHVSAYMKTLMEDEPEKYQSHFSEYIKTGLEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADPS+KKS+KQPPK+HKRYNLKKLTY+ERKA LI RLNALNAAAG
Sbjct  236  EEMYKKVHAAIRADPSSKKSDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAG  292



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAG+SKDSKQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQ+ FS YIK G++ADNL
Sbjct  176  EKRFAGYSKDSKQLDAEVHRKYIYGGHVAAYMNTLMEDEPEKYQTHFSLYIKAGLEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADPS KKS KQPPK HKRYNLKKLTYEERKA LI RLNALNAA G
Sbjct  236  EEMYKKVHAAIRADPSPKKSGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGG  292



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF K+SKQLD EVHRKYIYGGHVAAYMR LIEDEPE+YQS FS YIK+G++ADN+
Sbjct  206  EKRFAGFDKESKQLDPEVHRKYIYGGHVAAYMRTLIEDEPERYQSHFSEYIKRGLEADNI  265

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRAD SAKKSEK+PPKEHKRYNLKKLTYEER+A LI RLNALN+AAG
Sbjct  266  EELYKKVHAAIRADSSAKKSEKEPPKEHKRYNLKKLTYEERRAKLIERLNALNSAAG  322



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD+KQLDAEVH KYIYGGHVAAYMR L+EDEPEKYQS FS YIK+GI+ADN+
Sbjct  176  DKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+AKK+EK+PPK+HKR+NLKKLTYEERKA LI RL+ LNAAAG
Sbjct  236  ESLYKKVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKAKLIERLHTLNAAAG  292



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD+KQLDAEVHRKYIYGGHV+AYM  L+EDEPEKYQS FS YIKK I+ DN+
Sbjct  176  DKRFAGFSKDNKQLDAEVHRKYIYGGHVSAYMNTLMEDEPEKYQSHFSEYIKKSIEPDNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP+ KKSEKQPPKEHKRYNLKKLTYEERKA LI RLNALNAAAG
Sbjct  236  EAMYKKVHAAIRADPTEKKSEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNAAAG  292



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLD EVHRKYIYGGHVAAYMR L+EDEPEKYQ+ FS YIKKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E +YKKVHAAIRADP+AKK EKQPPKEHKRYNLKKLTYEERK  LI RLNA N+AA
Sbjct  236  EAVYKKVHAAIRADPTAKKIEKQPPKEHKRYNLKKLTYEERKNKLIERLNAFNSAA  291



>gb|KJB84075.1| hypothetical protein B456_N001600 [Gossypium raimondii]
 gb|KJB84076.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=186

 Score =   199 bits (507),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+KD+KQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADNL
Sbjct  62   EKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNL  121

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  122  EGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  178



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG++KD+KQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQS FS Y+K+GIDAD +
Sbjct  176  DKRFAGYAKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+AKKSEKQP KEHKRYNLKKLTYEERKA L+ RLNALN+AA
Sbjct  236  EALYKKVHAAIRADPTAKKSEKQPSKEHKRYNLKKLTYEERKAKLVERLNALNSAA  291



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDA+VHR YIYGGHVA YM+ LIEDEPEKYQS FS YIKKG++AD+L
Sbjct  176  EKRFAGFSKDSKQLDADVHRNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADHL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KKS+K PPK+HKRYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  236  EEMYKKVHAAIRADPTFKKSDKHPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   202 bits (515),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD+KQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQS FS Y+K+GIDAD +
Sbjct  176  EKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADCM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEKQPPKEHKRYNLKKLTYEERK  L+ RLN  N+AA
Sbjct  236  EALYKKVHAAIRADPTTKKSEKQPPKEHKRYNLKKLTYEERKEKLVERLNTFNSAA  291



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   202 bits (515),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAE+HRKYIYGGHVAAYMR L+EDEPEKYQS FS Y+K+GIDADN+
Sbjct  176  DKRFAGFSKDSKQLDAELHRKYIYGGHVAAYMRILMEDEPEKYQSHFSEYVKRGIDADNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVH+AIRADP  KK+EKQPPKEHKRYNLKKLTYEERK  LI RL ALN+AA
Sbjct  236  EELYKKVHSAIRADPITKKTEKQPPKEHKRYNLKKLTYEERKNKLIERLKALNSAA  291



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD+KQLDAEVH KYIYGGHVAAYMR L+EDEPEKYQS FS YIK+GI+ADN+
Sbjct  137  DKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNI  196

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYK VHAAIRADP+AKK+EK+PPK+HKR+NLKKLTYEERK+ LI RL+ LNAAAG
Sbjct  197  ESLYKNVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKSKLIERLHTLNAAAG  253



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHR YIYGGHVAAYMR L+EDEPEKYQS FS YIK+GI+ADN+
Sbjct  176  DKRFAGFSKDGKQLDAEVHRNYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPSAKKSEK PPK+H R+NLKKLTYEERKA LI RL+ LNAAAG
Sbjct  236  ESLYKKVHAAIRADPSAKKSEKAPPKQHMRFNLKKLTYEERKAKLIDRLHTLNAAAG  292



>gb|KHG10377.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=268

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+KDSKQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADNL
Sbjct  144  EKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNL  203

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  204  EGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  260



>gb|KHG10378.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=261

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+KDSKQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADNL
Sbjct  137  EKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNL  196

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  197  EGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  253



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIY GHVAAYMR L+EDEPEKYQS F  YIK+GI+ADNL
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E+LYKKVHAAIRADP+ KKSEK+PP EHKRYNLKKLTYEERKA L+ RL ALNAA
Sbjct  236  EELYKKVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>gb|KJB84074.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=252

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+KD+KQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADNL
Sbjct  128  EKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNL  187

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  188  EGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  244



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIY GHVAAYMR L+EDEPEKYQS F  YIK+GI+ADNL
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E+LYKKVHAAIRADP+ KKSEK+PP EHKRYNLKKLTYEERKA L+ RL ALNAA
Sbjct  236  EELYKKVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIY GHVAAYMR L+EDEPEKYQS F  YIK+GI+ADNL
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E+LYKKVHAAIRADP+ KKSEK+PP EHKRYNLKKLTYEERKA L+ RL ALNAA
Sbjct  236  EELYKKVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ KQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADN+
Sbjct  176  DKRFAGFKKEDKQLDPEVHRKYIYGGHVASYMRALMEDEPEKYQSHFSEYIKRGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KKSEK+PPKEHKRYNLKKLTYEERK+ LI RLNALN+AAG
Sbjct  236  EELYKKVHAAIRADPTIKKSEKEPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KDSKQLDA+VHRKYIYGGHV+AYM+ L+EDEPEKYQS F+ YIK G++AD+L
Sbjct  176  EKRFAGFGKDSKQLDADVHRKYIYGGHVSAYMKTLMEDEPEKYQSHFNEYIKTGLEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADPS+KK +KQPPK+HKRYNLKKLTY+ERKA LI RLNALNAAAG
Sbjct  236  EEMYKKVHAAIRADPSSKKFDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAG  292



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ KQLD EVHRKYIYGGHVA+YMR L EDEPEKYQS FS YI KGIDADN+
Sbjct  176  DKRFAGFKKEEKQLDPEVHRKYIYGGHVASYMRALNEDEPEKYQSHFSEYINKGIDADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LY+KVHAAIRADP+ KKSEKQPPKEHKRYNLKKLTYEER++ LI RLNALN+AAG
Sbjct  236  EELYRKVHAAIRADPTTKKSEKQPPKEHKRYNLKKLTYEERRSKLIERLNALNSAAG  292



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAE HRKYIYGGHV+ YM+ L+EDEPEKYQ+ FS Y+K+GIDAD L
Sbjct  176  DKRFAGFSKDGKQLDAEAHRKYIYGGHVSGYMKTLMEDEPEKYQTHFSEYVKRGIDADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+AK+SEK+ PK HKRYNLKKLTY+ERKASLI RLNALNAAAG
Sbjct  236  EALYKKVHAAIRADPTAKQSEKEAPKTHKRYNLKKLTYDERKASLIERLNALNAAAG  292



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAG+SKDSKQLDAEVHRK+IYGGHV AYM  L+EDEPEKYQ+ FS YIK G++ADNL
Sbjct  176  EKRFAGYSKDSKQLDAEVHRKFIYGGHVTAYMNTLMEDEPEKYQTHFSLYIKAGLEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP  KKS KQPPK HKRYNLKKLTYEERKA LI RLNALNAA G
Sbjct  236  EEMYKKVHAAIRADPCPKKSGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGG  292



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQ  FS YIK+GI+ D++
Sbjct  176  DKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQLHFSEYIKRGIEPDDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E+LYKKVHAAIRADP+AKKSEKQPPKEHKRYNL+K+TYEERKA LI RL ALN+
Sbjct  236  EELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD KQLDAEVHRKYIYGGHVAAYMRNL+EDEPEKYQS FS YIK+GI+ DN+
Sbjct  176  DKRFAGFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E+LYKKVHAAIRADP+AKKSEKQ PKEHKRYNLKKLTYEERKA L+ RL ALN+
Sbjct  236  EELYKKVHAAIRADPTAKKSEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   200 bits (509),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD KQLDAEVHRKYIYGGHVAAYMRNL+EDEPEKYQS FS YIK+GI+ DN+
Sbjct  176  DKRFAGFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E+LYKKVHAAIRADP+AKKSEKQ PKEHKRYNLKKLTYEERKA L+ RL ALN+
Sbjct  236  EELYKKVHAAIRADPTAKKSEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF K++KQLD EVHRKYI+GGHVAAYMR L EDEPE+YQS FS Y K+G++ADNL
Sbjct  230  EKRFAGFDKETKQLDPEVHRKYIFGGHVAAYMRTLAEDEPERYQSHFSEYHKRGLEADNL  289

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KKSEK PPKEHKRYNLKKLTYEERKASLI RLNALN+AAG
Sbjct  290  EELYKKVHAAIRADPTPKKSEKAPPKEHKRYNLKKLTYEERKASLIERLNALNSAAG  346



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQ  FS YIK+GI+ D++
Sbjct  176  DKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRMLMEDEPEKYQLHFSEYIKRGIEPDDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E+LYKKVHAAIRADP+AKKSEKQPPKEHKRYNL+K+TYEERKA LI RL ALN+
Sbjct  236  EELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>gb|KDO45956.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=257

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS F+ YIKKGIDAD L
Sbjct  137  DKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGL  196

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEK  PKEHKRYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  197  EALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  252



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLD +VHRKYIYGGHVAAYMR L EDEPEKYQS FS YIK+G++AD+L
Sbjct  176  DKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP  KKSEK+PPKEHKR+NL+KLTYEERKA L+ RLNALN+A G
Sbjct  236  EGLYKKVHAAIRADPILKKSEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAGG  292



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+KD+KQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADNL
Sbjct  176  EKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  236  EGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+KD+KQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+ADNL
Sbjct  173  EKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNL  232

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  233  EGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS F+ YIKKGIDAD L
Sbjct  176  DKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEK  PKEHKRYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  236  EALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  291



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS F+ YIKKGIDAD L
Sbjct  176  DKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEK  PKEHKRYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  236  EALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  291



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKYIYGGHVA+YM NL+EDEPEKYQS FS Y+KKG++ADNL
Sbjct  193  DKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMTNLMEDEPEKYQSHFSKYVKKGLEADNL  252

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISR  240
            E+LYKKVHAAIRADP+AKKSEKQPPKEHKRYNLKKLTYEERKA LI R
Sbjct  253  EELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLIER  300



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKD KQLD+EVHRKYIYGGHVAAYM  L+EDEPEKYQS FS YIK G++AD++
Sbjct  176  EKRFAGFSKDGKQLDSEVHRKYIYGGHVAAYMNTLMEDEPEKYQSHFSKYIKSGVEADDI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E LYKKVHAAIRADPS KKSEKQPPKEHKRYNLKKLTYEERKA LI RL ALN+
Sbjct  236  EALYKKVHAAIRADPSPKKSEKQPPKEHKRYNLKKLTYEERKAKLIERLQALNS  289



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLD +VHRKYIYGGHVAAYMR L EDEPEKYQS FS YIK+G++AD+L
Sbjct  257  DKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDL  316

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP  KKSEK+PPKEHKR+NL+KLTYEERKA L+ RLNALN+A G
Sbjct  317  EGLYKKVHAAIRADPILKKSEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAGG  373



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKYI+GGHVAAYM+ L+EDEPEKYQ+ FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADPS KK EKQPPKEHKRYNLKKLTYEERK  L+SRL ALN+AAG
Sbjct  236  EELYKKVHAAIRADPSIKKPEKQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  292



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS F+ YIKKGIDAD L
Sbjct  263  DKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGL  322

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEK  PKEHKRYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  323  EALYKKVHAAIRADPTTKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  378



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   197 bits (501),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKYI+GGHV+AYM+ LIEDEPEKYQ+ FS YIKKGI+AD L
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ KKSEKQPPK+HKRYNLKKLTYEERKA L+SRL ALNAA 
Sbjct  236  EELYKKVHAAIRADPTIKKSEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAE HRKYIYGGHVA YMR L+EDEPEKYQ+ FS Y+K+GI+AD L
Sbjct  176  DKRFAGFSKDGKQLDAETHRKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS KKSEK  P++HKRYN KKLTY+ERKASLI RLNALNAAAG
Sbjct  236  EALYKKVHAAIRADPSVKKSEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAE HRKYIYGGHVA YMR L+EDEPEKYQ+ FS Y+K+GI+AD L
Sbjct  178  DKRFAGFSKDGKQLDAETHRKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGL  237

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS KKSEK  P++HKRYN KKLTY+ERKASLI RLNALNAAAG
Sbjct  238  EALYKKVHAAIRADPSVKKSEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  294



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKYI+GGHV+AYM+ LIEDEPEKYQ+ FS YIKKGI+AD L
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ KKSEKQPPK+HKRYNLKKLTYEERKA L+SRL ALNAA 
Sbjct  236  EELYKKVHAAIRADPTIKKSEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKYI+GGHVAAYM+ L+EDEPEKYQ+ FS YIK+GI+AD +
Sbjct  207  DKRFAGFDKEKKELDAEVHRKYIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEADGI  266

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADPS KK EKQPPKEHKRYNLKKLTYEERK  L+SRL ALN+AAG
Sbjct  267  EELYKKVHAAIRADPSIKKPEKQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  323



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG++KD+KQLD EVHRKYIYGGHVA+YM  L+EDEP+KYQS FS Y+KKG++ADN+
Sbjct  176  DKRFAGYNKDNKQLDPEVHRKYIYGGHVASYMNTLMEDEPDKYQSHFSKYVKKGVEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KKS+KQ PK+HKRYNLKKLTYEERKA LI RLNALNAAAG
Sbjct  236  EEMYKKVHAAIRADPTPKKSDKQQPKQHKRYNLKKLTYEERKAKLIERLNALNAAAG  292



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAEVHRKYI+GGHVA+YM+ L+EDEPEKYQ+ FS YIKKGID D++
Sbjct  176  DKRFAGFKKDEKQLDAEVHRKYIFGGHVASYMKTLMEDEPEKYQAHFSEYIKKGIDPDDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP A KS K PPKEHKRYNLKKLTYEERKA LI RLNALNA+AG
Sbjct  236  EEMYKKVHAAIRADPIAVKSTKPPPKEHKRYNLKKLTYEERKAKLIERLNALNASAG  292



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHV+AYM +L+EDEPEKYQS FS YIKKGI+ D+ 
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDF  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+ KKS+K  PKEHKR+NLKKLTYEERK  LI RLNALN+AAG
Sbjct  236  EALYKKVHAAIRADPTLKKSDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  292



>tpg|DAA56364.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=229

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDA++HRKYIYGGHVA YMRNL E+EPEKYQS FS YIKKGI+AD++
Sbjct  104  EKRFAGFKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDM  163

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS KQPPKEHKRYN KKLTYE+RKASLI RLN LN++ G
Sbjct  164  EALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKYI+GGHV AYM+ LIEDEPEKYQ+ FS YIK+G++AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYIFGGHVTAYMKTLIEDEPEKYQTHFSEYIKRGVEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KKS KQPPKEHKRYNLKKLTYEERKA LI+RL ALN+AAG
Sbjct  236  EELYKKVHAAIRADPTIKKSGKQPPKEHKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD KQLDAEVHRKYIYGGHVAAYMRNL+EDEPEKYQS FS YIK+GI+ DN+
Sbjct  176  DKRFAGFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E+LYKKVHAAIR DP+AKKS KQ PKEHKRYNLKKLTYEERKA L+ RL ALN+
Sbjct  236  EELYKKVHAAIREDPTAKKSGKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD+KQLDAEVHRKYIYGGHVAAYM+ L+EDEPEKYQ+ FS Y+K+GI+ DNL
Sbjct  176  DKRFAGFTKDNKQLDAEVHRKYIYGGHVAAYMKTLMEDEPEKYQTHFSEYVKRGIEPDNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E LYKKVHAAIRADP+ KK EKQPPKEHKRYNL+KLTYEERKA LI RL ALN+
Sbjct  236  EALYKKVHAAIRADPTLKKIEKQPPKEHKRYNLRKLTYEERKAKLIERLQALNS  289



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKYIYGGHV+AYM  LIEDEPEKYQS FS YIKKG++ D++
Sbjct  176  DKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E++YKKVHAAIRA+P  KK EKQPPKEHKRYNLKKLTYEERKA LI RLNALN+
Sbjct  236  EEMYKKVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  289



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFS+D KQLDA+VHRKYI+GGHVAAYM  L+EDEPEKYQS FS YIK+GI+ D +
Sbjct  138  DKRFAGFSRDGKQLDADVHRKYIFGGHVAAYMTTLMEDEPEKYQSHFSEYIKRGIEPDGI  197

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHA+IRADP+ KKSEK+PPK HKR+NLKKLTYEERKA LI RLNALN+AAG
Sbjct  198  EEMYKKVHASIRADPTPKKSEKEPPKVHKRHNLKKLTYEERKAKLIERLNALNSAAG  254



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKYIYGGHV+AYM  LIEDEPEKYQS FS YIKKG++ D++
Sbjct  208  DKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDI  267

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E++YKKVHAAIRA+P  KK EKQPPKEHKRYNLKKLTYEERKA LI RLNALN+
Sbjct  268  EEMYKKVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  321



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHV+AYM +L+EDEPEKYQS FS YIKKGI+ D+ 
Sbjct  240  EKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDF  299

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+ KKS+K  PKEHKR+NLKKLTYEERK  LI RLNALN+AAG
Sbjct  300  EALYKKVHAAIRADPTLKKSDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  356



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   195 bits (495),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+SKQLD EVHRKYIYGGH+A YMR L EDEPEKYQS FS YIK+GI+ADN+
Sbjct  176  DKRFAGFNKESKQLDPEVHRKYIYGGHIADYMRLLNEDEPEKYQSHFSEYIKRGIEADNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS KKSEKQPPKEHKR+N KKLTYEERKA LI RL ALN+A G
Sbjct  236  EALYKKVHAAIRADPSVKKSEKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDA++HRKYIYGGHVA YMRNL E+EPEKYQS FS YIKKGI+AD++
Sbjct  177  EKRFAGFKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS KQPPKEHKRYN KKLTYE+RKASLI RLN LN++ G
Sbjct  237  EALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDA++HRKYIYGGHVA YMRNL E+EPEKYQS FS YIKKGI+AD++
Sbjct  177  EKRFAGFKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS KQPPKEHKRYN KKLTYE+RKASLI RLN LN++ G
Sbjct  237  EALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYM  L EDEPEKYQ+ FS YIKKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNAL  228
            E+LYKKVHAAIRADP+AKK+EKQPPKEHKRYNLKKLT++ERK  L+ RL A 
Sbjct  236  EELYKKVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+SKQLDAEVHRKYIYG HVA YMR ++EDEPEKYQS FS YIK+GI+ADN+
Sbjct  176  DKRFAGFNKESKQLDAEVHRKYIYGVHVADYMRVMMEDEPEKYQSHFSEYIKRGIEADNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+ KKSEKQPPKEHKR+N KKLTYEERKA LI RL ALN+A G
Sbjct  236  EALYKKVHAAIRADPTIKKSEKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD+KQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQS FS Y+K+ IDAD +
Sbjct  171  EKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCM  230

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEK+P KEHKRYNLKKLTYEERK  L+ RLN  N+AA
Sbjct  231  EALYKKVHAAIRADPTTKKSEKEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAA  286



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD+KQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQS FS Y+K+ IDAD +
Sbjct  176  EKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEK+P KEHKRYNLKKLTYEERK  L+ RLN  N+AA
Sbjct  236  EALYKKVHAAIRADPTTKKSEKEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAA  291



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAEVHRKYIYGGHVA YMR+L ++EPEK+QS FS YIKKGI AD++
Sbjct  176  DKRFAGFKKDEKQLDAEVHRKYIYGGHVADYMRSLADEEPEKFQSHFSEYIKKGISADDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS K+PPK HKRYNLKKLTY+ERKASL+ RLNALNA+AG
Sbjct  236  EALYKKVHAAIRADPSMAKSTKEPPKTHKRYNLKKLTYDERKASLVQRLNALNASAG  292



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD KQLD EVHRKYIYGGHVAAYMRNL+EDEPEKYQS FS YIK+ I+ D +
Sbjct  173  DKRFAGFNKDGKQLDPEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTI  232

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  233  EGMYKKVHAAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVH KYIYGGHVAAYMR L+EDEPEKYQ+ FS Y+KKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDAEVHHKYIYGGHVAAYMRTLMEDEPEKYQTHFSEYLKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E++YKKVHAAIRADP+ KKS K  P EHKR+NLKKLTYEERK  LI RLNA N+AA
Sbjct  236  EEVYKKVHAAIRADPTMKKSSKPQPSEHKRWNLKKLTYEERKNKLIERLNAFNSAA  291



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD KQLD EVHRKYIYGGHVAAYMRNL+EDEPEKYQS FS YIK+ I+ D +
Sbjct  176  DKRFAGFNKDGKQLDPEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRA P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  236  EGMYKKVHAAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K+LDA++HRKY++GGHVA+YM+ LIEDEPEKYQ+ FS YIK+GI+ DNL
Sbjct  176  DKRFAGFDKDKKELDADIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGIEPDNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E++YKKVHAAIRADP+ KKSEK+PPKEHKRYNLKKLTYEERKA L++RL ALN+AA
Sbjct  236  EEVYKKVHAAIRADPTFKKSEKEPPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHRKYI+GGHVA+YMR L+EDEPEKYQ+ FS YIK+GI+ D++
Sbjct  176  DKRFAGFSKDDKQLDAEVHRKYIFGGHVASYMRMLMEDEPEKYQTHFSEYIKRGIEPDDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+  KS K+PPKEHKRYNL+KLTYEERKA LI RLNALNA A
Sbjct  236  EGLYKKVHAAIRADPTMVKSAKEPPKEHKRYNLRKLTYEERKAKLIDRLNALNARA  291



>gb|AFW84308.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=229

 Score =   191 bits (485),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDA+ HR+YIYGGHVA YM+NL E+EPEKYQS FSAYIKKG++AD +
Sbjct  104  EKRFAGFKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEI  163

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS KQPPKEHKRYN KKLTYE+RKASLI RLN LN++ G
Sbjct  164  EALYKKVHAAIRADPSIVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLDAEVHRKYIYGGHVA+YM  L+EDEPEKYQS F  Y+KKG++ DNL
Sbjct  176  DKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMTTLMEDEPEKYQSHFGLYVKKGLEPDNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISR  240
            E+LYKKVHAAIRADP+AKKSEKQPPKEHKRYNLKKLTYEERKA LI R
Sbjct  236  EELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLIER  283



>gb|KHG15135.1| 60S ribosomal L5 [Gossypium arboreum]
Length=262

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KDSKQLD EVHRKYIYGGHVAAYMR L+EDEPEKYQS FS YIK+ I+ D +
Sbjct  137  DKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRSIEPDTI  196

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVH AIRA P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  197  EGMYKKVHTAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  253



>gb|EYU36673.1| hypothetical protein MIMGU_mgv1a0142632mg, partial [Erythranthe 
guttata]
Length=140

 Score =   187 bits (475),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG++KDSK LDAEVHRKYIYGGHVAAYM  L+EDEP+KYQ+ FS Y+K G++AD L
Sbjct  13   DKRFAGYAKDSKSLDAEVHRKYIYGGHVAAYMNTLMEDEPDKYQTHFSKYVKNGLEADEL  72

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKS+KQP KEHKR+NLKKLTYEERK  LI RLNALN+AA
Sbjct  73   EALYKKVHAAIRADPTPKKSDKQPRKEHKRFNLKKLTYEERKNKLIERLNALNSAA  128



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD+KQLDAEVHRKYIYGGHVAAYMR L+EDEPEKYQS FS Y+K+ IDAD +
Sbjct  176  EKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKSEK+P KEHK+YNLKKLTYEERK  L+ RLN  N+AA
Sbjct  236  EALYKKVHAAIRADPTTKKSEKEPLKEHKKYNLKKLTYEERKEKLVERLNTFNSAA  291



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K+LD ++HRKY++GGHVA+YM+ LIEDEPEKYQ+ FS YIK+GI+AD L
Sbjct  176  DKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADCL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+ KKSEK+ PKEHKRYNLKKLTYEERKA L++RL ALN+AAG
Sbjct  236  EDLYKKVHAAIRADPTFKKSEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAEVHR YI GGHVA+YMR ++EDEPEKYQ+ FS YIK+GI+ D++
Sbjct  178  DKRFAGFKKDEKQLDAEVHRNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSM  237

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP A KS K+PPKEHKR+NLKKLTYEERKA LI RLNALNA+AG
Sbjct  238  EEMYKKVHAAIRADPIAIKSTKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAG  294



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF  D KQLDAEVHR YI+GGHVA+YMR L+EDEP+KYQ+ FS YIKKGI+ D++
Sbjct  176  DKRFAGFKNDEKQLDAEVHRNYIFGGHVASYMRALMEDEPDKYQTHFSEYIKKGIEPDDI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADPSA KS K+PP EHKRYNLKKLTYEERKA LI RLNALNA+ G
Sbjct  236  EEMYKKVHAAIRADPSAIKSTKEPPTEHKRYNLKKLTYEERKAKLIERLNALNASGG  292



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAEVHR YI GGHVA+YMR ++EDEPEKYQ+ FS YIK+GI+ D++
Sbjct  176  DKRFAGFKKDEKQLDAEVHRNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP A KS K+PPKEHKR+NLKKLTYEERKA LI RLNALNA+AG
Sbjct  236  EEMYKKVHAAIRADPIAIKSTKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAG  292



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKYI+GGHV AYM+ LIEDEPEKYQ+ FS YIKKGI+AD +
Sbjct  156  DKRFAGFDKEKKELDAEVHRKYIFGGHVTAYMKTLIEDEPEKYQTHFSQYIKKGIEADGI  215

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ KK+EKQPPKEHKRYNLKKLTY+ER+  LI+RL ALN+A 
Sbjct  216  EELYKKVHAAIRADPANKKAEKQPPKEHKRYNLKKLTYDERRTKLIARLEALNSAV  271



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KDSKQLD EVHRKYIYGGHVAAYMR L+EDEPEKYQS FS YIK+ I+ DN+
Sbjct  178  DKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNM  237

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRAD  AKKSE++PP EHKRYNLKKL+Y+ERKA LI RL  LN+AAG
Sbjct  238  EGLYKKVHAAIRADSEAKKSEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  294



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYM  L EDEPEKYQ+ FS YIKKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNAL  228
            E+LYKKVHAAIRADP+ KK+EKQPP EHKRYNLKKLT++ERK  L+ RL A 
Sbjct  236  EELYKKVHAAIRADPTPKKTEKQPPTEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKYI+GGHV+AYM+ LIEDEPEKYQ+ FS YIKKGI+AD L
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADPS KKSEK P KEHKR+NLKKLTYEERKA LI+RL ALNAA 
Sbjct  236  EELYKKVHAAIRADPSIKKSEKPPRKEHKRFNLKKLTYEERKAKLIARLQALNAAV  291



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDA+ HR+YIYGGHVA YM+NL E+EPEKYQS FSAYIKKG++AD +
Sbjct  177  EKRFAGFKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEI  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS KQPPKEHKRYN KKLTYE+RKASLI RLN LN++ G
Sbjct  237  EALYKKVHAAIRADPSIVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADPS KKSEKQPPKEHKRYNLKKLTYEERKA LI+R+ A+N+AA
Sbjct  236  EALYKKVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAA  291



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAE+HRKYIYGGHVA YM++L ++EPEKYQS FS YIKKGI+ADN+
Sbjct  173  DKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADNM  232

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+PPK HKRYN KKLTYE+RKASL+ RLNALN++AG
Sbjct  233  EALYKKVHAAIRADPTMAKSTKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  289



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KDSKQLD EVHRKYIYGGHVAAYMR L+EDEPEKYQS FS YIK+ I+ DN+
Sbjct  232  DKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNM  291

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRAD  AKKSE++PP EHKRYNLKKL+Y+ERKA LI RL  LN+AAG
Sbjct  292  EGLYKKVHAAIRADSEAKKSEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  348



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ LIEDEPEKYQS FS YIK+GI+AD L
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP++KKSEK  PKEHKRYNLKKLTY+ERK  LI+RL ALN+AA
Sbjct  236  EELYKKVHAAIRADPTSKKSEKPQPKEHKRYNLKKLTYDERKNKLIARLQALNSAA  291



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAEVHRKYIYGGHVA YM+ L E+EPEKYQS FS YIKKGI+A  +
Sbjct  176  DKRFAGFKKDEKQLDAEVHRKYIYGGHVADYMKTLAEEEPEKYQSHFSEYIKKGIEAGGM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+PPK HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  236  EALYKKVHAAIRADPTLAKSTKEPPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHR YIYGGHVAAYMR L+EDEPEKYQS FS YIK+GI+ADN+
Sbjct  176  DKRFAGFSKDGKQLDAEVHRNYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPSAKKSEK PPK+H R    KLTYEERKA LI RL+ LNAAAG
Sbjct  236  ESLYKKVHAAIRADPSAKKSEKAPPKQHMRL---KLTYEERKAKLIDRLHTLNAAAG  289



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K+LD ++HRKY++GGHVA+YM+ LIEDEPEKYQ+ FS YIK+GI+AD L
Sbjct  176  DKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+ KK EK+ PKEHKRYNLKKLTYEERKA L++RL ALN+AAG
Sbjct  236  EDLYKKVHAAIRADPTFKKFEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>ref|XP_004171975.1| PREDICTED: 60S ribosomal protein L5-like, partial [Cucumis sativus]
Length=246

 Score =   188 bits (477),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRFAGFSK + +L+A+VHRKYI+GGHVAAYMR L+EDEPEKYQ+ FS YIKKGI+ DN+E
Sbjct  122  KRFAGFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIE  181

Query  380  QLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            +L KKVH+AIRA+P  K +EKQPPK HKRYNLKKLTYE+RKA L+ RLNALN+AAG
Sbjct  182  ELLKKVHSAIRAEPLVKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  237



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDA+ HR+YIYGGHVA YM+NL E+EPEKYQS FSAYIKKG++A+ +
Sbjct  177  EKRFAGFKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEAEEI  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS KQPPKEHKRYN KKLTYE+RKASLI RLN LN++ G
Sbjct  237  EALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>sp|P93779.1|RL5_SOLME RecName: Full=60S ribosomal protein L5, partial [Solanum melongena]
 dbj|BAA19415.1| ribosomal protein L5 [Solanum melongena]
Length=121

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -1

Query  542  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV  363
            SKDSKQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS FS+YIK  +  DN+E++YKKV
Sbjct  2    SKDSKQLDAEVHRKYIYGGHVAAYMNILMEDEPEKYQSHFSSYIKADLAPDNIEEMYKKV  61

Query  362  HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            HAAIR DPS KKS+KQPPK HKRYNLKKLTYEERKA LI RLNALNAA G
Sbjct  62   HAAIRPDPSPKKSQKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGG  111



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  217  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  276

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADPS KKSEKQPPKEHKRYNLKKLTYEERKA LI+R+ A+N+AA
Sbjct  277  EALYKKVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAA  332



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+KD KQLDAEVHRKYI+GGHVA+YMR L+EDEPEKYQ+ FS YI++GI+ D+L
Sbjct  176  DKRFAGFNKDGKQLDAEVHRKYIFGGHVASYMRILMEDEPEKYQTHFSEYIQRGIEPDDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRAD +  KS ++PPKEHKRYNLKKLTYEERKA LI RLNALNA+ 
Sbjct  236  EELYKKVHAAIRADATMAKSTREPPKEHKRYNLKKLTYEERKARLIERLNALNAST  291



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG++K+S+QLD EVHRKYI+GGHVAAYMR L+EDEPEKYQS FS YIKKGI+AD+L
Sbjct  176  DKRFAGYTKNSQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRA+P+ KKS+K  PK HKRYNLKKLTY+ERKA L+ RLNALN+AA
Sbjct  236  EGLYKKVHAAIRANPTVKKSDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAEVHRKYI+GGHVA+YMR L+EDEPEKYQ+ F  YIK+GI+ D++
Sbjct  176  DKRFAGFKKDEKQLDAEVHRKYIFGGHVASYMRMLMEDEPEKYQTHFIEYIKRGIEPDDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+  KS K+PPKEHKR+NLKKLTY+ERKA LI RLNALN++A
Sbjct  236  EELYKKVHAAIRADPTLVKSSKEPPKEHKRFNLKKLTYDERKARLIERLNALNSSA  291



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ KQLD EVH KYIYGGHVA+YM  L+EDEPEKYQS F  YIKKGI+ DN+
Sbjct  177  DKRFAGFKKEDKQLDPEVHHKYIYGGHVASYMMTLMEDEPEKYQSHFGEYIKKGIEPDNI  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LY+KVHAAIRADP+  KSEKQPPKEHKRYNLKKLTYEERK+ LI RLNALN+AAG
Sbjct  237  EALYRKVHAAIRADPTM-KSEKQPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRFAGFSK + +L+A+VHRKYI+GGHVAAYMR L+EDEPEKYQ+ FS YIKKGI+ DN+E
Sbjct  177  KRFAGFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIE  236

Query  380  QLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            +L KKVH+AIRA+P AK +EKQPPK HKRYNLKKLTYE+RKA L+ RLNALN+AAG
Sbjct  237  ELLKKVHSAIRAEPLAKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLD EVHRKYIYGGHVAAYMRNL EDEPEKYQS FS YIKKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMRNLAEDEPEKYQSHFSEYIKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNAL  228
            E+LYKKVHAAIRADP+ KK+EK  P+EHKRYNLKKLT++ERK  L+ RL A 
Sbjct  236  EELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAF  287



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKS+KQPPKEHKRYNLKKLTYEERKA LI+R+ +LN+AA
Sbjct  236  EALYKKVHAAIRADPTLKKSDKQPPKEHKRYNLKKLTYEERKAKLIARVASLNSAA  291



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYM  L +DEPEKYQS FS YIKKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMTTLADDEPEKYQSHFSEYIKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ KK+EK  P+EHKRYNLKKLT++ERK  L+ RL A N A 
Sbjct  236  EELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEAG  291



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDAE+HRKYIYGGHVA YMR+L E+EPEK+Q+ FS YIK+GI+AD++
Sbjct  177  EKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMRSLAEEEPEKFQAHFSDYIKRGIEADDM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRA+P+  KS K+PPK HKRYNLKKLTYE RKASL+ RLNALN++AG
Sbjct  237  EALYKKVHAAIRANPTMVKSTKEPPKTHKRYNLKKLTYEGRKASLVQRLNALNSSAG  293



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   187 bits (476),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRFAGFSK + +L+A+VHRKYI+GGHVAAYMR L+EDEPEKYQ+ FS YIKKGI+ DN+E
Sbjct  177  KRFAGFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIE  236

Query  380  QLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            +L KKVH+AIRA+P  K +EKQPPK HKRYNLKKLTYE+RKA L+ RLNALN+AAG
Sbjct  237  ELLKKVHSAIRAEPLVKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   187 bits (475),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ +KS+KQPPKEHKRYN+KKLTYEERKA LI+R+ A+N+AA
Sbjct  236  EALYKKVHAAIRADPTLRKSDKQPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYM  L +DEPEK+QS FS YIKKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMTTLADDEPEKFQSHFSEYIKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ KK+EK  P+EHKRYNLKKLT++ERK  L+ RL A N A 
Sbjct  236  EELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEAG  291



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   187 bits (475),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD EVHRKYI+GGHVA+YMR ++EDEPEKYQ+ FS YIKKGI+ DN+
Sbjct  176  DKRFAGFKKDEKQLDEEVHRKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKK HAAIRADP+  KS K+ PKEH+R+NLKKLTYEERKA LI RLNALN +AG
Sbjct  236  EEIYKKAHAAIRADPTMIKSTKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  292



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD+EVHRKYIYGGHVA YMR+L ++EPEKYQS FS YIKKGI AD++
Sbjct  176  DKRFAGFKKDEKQLDSEVHRKYIYGGHVADYMRSLADEEPEKYQSHFSEYIKKGISADDI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP+  KS K+ PK HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  236  ESVYKKVHAAIRADPTLVKSTKEAPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD EVHRKYI+GGHVA+YMR ++EDEPEKYQ+ FS YIKKGI+ DN+
Sbjct  178  DKRFAGFKKDEKQLDEEVHRKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNM  237

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKK HAAIRADP+  KS K+ PKEH+R+NLKKLTYEERKA LI RLNALN +AG
Sbjct  238  EEIYKKAHAAIRADPTMIKSTKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  294



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAE+HRKYIYGGHVA YM++L ++EPEKYQS FS YIKKGI+ D++
Sbjct  176  DKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+PPK HKRYN KKLTYE+RKASL+ RLNALN++AG
Sbjct  236  EALYKKVHAAIRADPTVAKSTKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKD KQLDAE+HRKYIYGGHVAAYMR L EDEPEKYQS FS YIKKGI+AD++
Sbjct  176  EKRFAGFSKDGKQLDAEIHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E++YKKVHAAIRADP+ KK+EK  P+EHKRYNLKKLT++ERK  L+ RL A N A 
Sbjct  236  EEVYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNDAG  291



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ +KS+KQPPKEHKRYN+KKLTYEERKA L++R+ A+N+AA
Sbjct  236  EALYKKVHAAIRADPTLRKSDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAA  291



>gb|EMS47485.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=269

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAE+HRKYIYGGHVA YM++L ++EPEKYQS FS YIKKGI+ D++
Sbjct  144  DKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDM  203

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+PPK HKRYN KKLTYE+RKA+L+ RLNALN++AG
Sbjct  204  EALYKKVHAAIRADPTVAKSTKEPPKTHKRYNPKKLTYEQRKANLVERLNALNSSAG  260



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG++K+ +QLD EVHRKYI+GGHVAAYMR L+EDEPEKYQS FS YIKKGI+AD L
Sbjct  176  DKRFAGYAKNGQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADEL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRA+P AKKS+K  PK HKRYNLKKLTY+ERKA L+ RLNALN+AA
Sbjct  236  EGLYKKVHAAIRANPIAKKSDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYK VHAAIRADP+ KKS+KQ PKEHKRYNLKKLTYEERKA LISR+ ALN+AA
Sbjct  236  EALYKNVHAAIRADPTLKKSDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAA  291



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKD KQLDAE+HRKYIYGGHVAAYMR L EDEPEKYQS FS YIKKGI+AD++
Sbjct  176  EKRFAGFSKDGKQLDAEIHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E++YKKVHAAIRADP+ KK+EK  P+EHKRYNLKKLT++ERK  L+ RL A N
Sbjct  236  EEVYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVDRLKAFN  288



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ +KS+K+PPKEHKRYN+KKLTYEERKA LI+R+ A+N+AA
Sbjct  236  EALYKKVHAAIRADPTLRKSDKEPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSK LDAE HRKYIYGGHVAAYM  LIEDEPEKYQ+ FS YIKKGI+A+ +
Sbjct  176  EKRFAGFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP  KK+ K  PK+HKR+NLKKLTYEERK  LI RLNA N+AA
Sbjct  236  EELYKKVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDA+ HR YI+GGHVA+YMR L+EDEPEKYQ+ FS YIK+ +  D++
Sbjct  176  DKRFAGFKKDEKQLDADFHRNYIFGGHVASYMRTLMEDEPEKYQTHFSDYIKRNVGPDDM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADPS  KS K+PPKEHKRYNLKKLTYEERKA LI RLNALN+A 
Sbjct  236  EDLYKKVHAAIRADPSTVKSTKEPPKEHKRYNLKKLTYEERKAKLIDRLNALNSAT  291



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K+LD ++HRKY++GGHVA+YM+ L+EDEPEKYQ+ FS YIK+G++AD L
Sbjct  176  DKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLMEDEPEKYQTHFSDYIKRGVEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKS K+ PKEHKRYNLKKLTYEERKA L++RL ALN+AA
Sbjct  236  EDLYKKVHAAIRADPTFKKSSKEAPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K+LD ++HRKY++GGHVA+YM+ LIEDEPEKYQ+ FS YIK+G++AD L
Sbjct  176  DKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGVEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKS K+ PKEHKRYNLKKLTYEERKA L++RL A N+AA
Sbjct  236  EDLYKKVHAAIRADPTFKKSSKEAPKEHKRYNLKKLTYEERKAKLVARLQAFNSAA  291



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLD EVHRKYIYGGHVAAYM  L EDEPEKYQS FS YIKK I+ADN+
Sbjct  176  EKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKCIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ KK+EK  P+EHKRYNLKKLT++ERK  L+ RL A N A 
Sbjct  236  EELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFNDAG  291



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  194  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  253

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYK VHAAIRADP+ KKS+KQ PKEHKRYNLKKLTYEERKA LISR+ ALN+AA
Sbjct  254  EALYKNVHAAIRADPTLKKSDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAA  309



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAE+HRKYIYGGHVA YM++L ++EPEKYQS FS YIKKGI+AD +
Sbjct  176  DKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADGM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+PPK HK+YN KKLTYE+RKASL+ RLNALN++ G
Sbjct  236  EALYKKVHAAIRADPTIAKSTKEPPKTHKKYNPKKLTYEQRKASLVERLNALNSSGG  292



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   185 bits (469),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLD EVHRKYIYGGHVAAYM  L EDEPEKYQS FS YIKK I+ADN+
Sbjct  176  EKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKXIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ KK+EK  P+EHKRYNLKKLT++ERK  L+ RL A N A 
Sbjct  236  EELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFNDAG  291



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGHVAAYM+ L EDEPEKYQS FS YIK+GI+AD +
Sbjct  179  DKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGI  238

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKS+KQ PKEHKRYNLKKLTYEERKA LI+R+ +LN+AA
Sbjct  239  EALYKKVHAAIRADPTLKKSDKQLPKEHKRYNLKKLTYEERKAKLIARVASLNSAA  294



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   184 bits (468),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+K++KQLD E HR YI+GGHVA YM+ L EDEPEKYQ+ FS Y+KKGI+ADNL
Sbjct  176  EKRFAGFNKENKQLDPETHRNYIFGGHVANYMKVLTEDEPEKYQTHFSGYVKKGIEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP+ KKSEK  P EHKRYNLKKLTYEERK  LI RL ALN+ AG
Sbjct  236  EAMYKKVHAAIRADPTLKKSEKSAPTEHKRYNLKKLTYEERKERLIERLKALNSGAG  292



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE HR YI+GGHV +YM+ ++EDEPEKYQS FS Y KKGI+ADNL
Sbjct  176  DKRFAGFNKETKQLDAETHRNYIFGGHVGSYMKLMMEDEPEKYQSHFSEYAKKGIEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+ KKS+K  P EHKRYNLKKLTYEERKA LI RL ALN+ AG
Sbjct  236  EALYKKVHAAIRADPTLKKSDKPAPTEHKRYNLKKLTYEERKARLIERLKALNSGAG  292



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K LDAE+HRKYIYGGHVA YMR L E+EPEKYQ+ FS YIKKGI+AD++
Sbjct  177  DKRFAGFKKDEKNLDAEIHRKYIYGGHVADYMRTLAEEEPEKYQAHFSEYIKKGIEADDM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIR +P+  K  KQPPKEHKRYN KKLTYE+RKASL+ RLNALN++ G
Sbjct  237  EALYKKVHAAIRGEPTMAKITKQPPKEHKRYNPKKLTYEQRKASLVERLNALNSSGG  293



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF K+ K+LDAEVHRKYI+GGHVA+YM+ L EDEPEKYQS FS YIK+GI+AD L
Sbjct  176  EKRFAGFDKEKKELDAEVHRKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E+LYKKVHAAIRADPS KKS K  PKEHKRYNLKKLTY+ERK  LI+RL ALN+
Sbjct  236  EELYKKVHAAIRADPSTKKSGKPEPKEHKRYNLKKLTYDERKNELIARLQALNS  289



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF K+ K+LDAEVHRKYI+GGHVA+YM+ L EDEPEKYQS FS YIK+GI+AD L
Sbjct  176  EKRFAGFDKEKKELDAEVHRKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E+LYKKVHAAIRADPS KKS K  PKEHKRYNLKKLTY+ERK  LI+RL ALN+
Sbjct  236  EELYKKVHAAIRADPSTKKSGKPEPKEHKRYNLKKLTYDERKNKLIARLQALNS  289



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +
Sbjct  177  DKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  237  ESLYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +
Sbjct  177  DKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  237  ESLYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKD+KQLD++VHRKYIYGGHVAAYM  L EDEPEK+Q+ FSAYIKKG++A+ +
Sbjct  176  EKRFAGFSKDNKQLDSDVHRKYIYGGHVAAYMGILSEDEPEKFQTHFSAYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ K +EK+  KEHKR+NLKKLTY+ERK  LI RLNA N+AAG
Sbjct  236  EEMYKKVHAAIRADPTVKLTEKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAG  292



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +
Sbjct  174  DKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGM  233

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  234  EALYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  290



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K LDA++HRKYI+GGHVA YMR++ E+EPEKYQ+ FS Y+K+GIDAD +
Sbjct  177  DKRFAGFKKDEKNLDADIHRKYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+PP  HKRYNLKKLTYE+RKA L+ RLNALN++AG
Sbjct  237  EALYKKVHAAIRADPTMAKSTKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  293



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +
Sbjct  177  DKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  237  EALYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +
Sbjct  177  DKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  237  EALYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K LDA++HRKYI+GGHVA YMR++ E+EPEKYQ+ FS Y+K+GIDAD +
Sbjct  180  DKRFAGFKKDEKNLDADIHRKYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGM  239

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+  KS K+PP  HKRYNLKKLTYE+RKA L+ RLNALN++AG
Sbjct  240  EALYKKVHAAIRADPTMAKSTKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  296



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDA++HRKYIYG HVA YM+NL ++EPEKYQ+ FS YIKKGI+AD++
Sbjct  178  DKRFAGFKKDDKQLDADIHRKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDM  237

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADPS  KS K PPKEHKRYN KKLTYE+RKASL+ RLNALN++ 
Sbjct  238  EALYKKVHAAIRADPSMAKSTKTPPKEHKRYNPKKLTYEQRKASLVERLNALNSSG  293



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   182 bits (461),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKD+KQLD++VHRKYIYGGHVAAYM  L EDEPEK+Q+ FS YIKKG++A+ +
Sbjct  176  EKRFAGFSKDNKQLDSDVHRKYIYGGHVAAYMGILSEDEPEKFQTHFSGYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ K +EK+  KEHKR+NLKKLTY+ERK  LI RLNA N+AAG
Sbjct  236  EEMYKKVHAAIRADPTVKLTEKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAG  292



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+SKQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+N+
Sbjct  176  DKRFAGFNKESKQLDAEIHRNYIYGGHVSNYMKLLTEDEPEKFQTHFSQYVKKGVDAENI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+ K  PKEHKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EELYKKVHAAIRADPNPKKTVKAAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K LDAE+HRKYI+GGHVA YMR+L ++EPEKYQ+ FS YIK+GI AD++
Sbjct  177  DKRFAGFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKYQTHFSEYIKRGISADDM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP+  KS K PPK HKRYN KKLTYE+RKASL+ RLNALN +AG
Sbjct  237  EAVYKKVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  293



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K LDAE+HRKYI+GGHVA YMR+L ++EPEK+Q+ FS YIK+GI AD++
Sbjct  173  DKRFAGFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDM  232

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP+  KS K PPK HKRYN KKLTYE+RKASL+ RLNALN +AG
Sbjct  233  EAVYKKVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD K LDAE+HRKYI+GGHVA YMR+L ++EPEK+Q+ FS YIK+GI AD++
Sbjct  173  DKRFAGFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDM  232

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP+  KS K PPK HKRYN KKLTYE+RKASL+ RLNALN +AG
Sbjct  233  EAVYKKVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDA++HRKYIYG HVA YM+NL ++EPEKYQ+ FS YIKKGI+AD++
Sbjct  177  DKRFAGFKKDDKQLDADIHRKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADPS  KS K  PKEHKRYN KKLTYE+RKA L+ RLNALN++ G
Sbjct  237  EALYKKVHAAIRADPSMAKSTKAQPKEHKRYNPKKLTYEQRKARLVERLNALNSSGG  293



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG++KD+KQLD EVHRKYIYGGHVA+YM  L+EDEPEKYQS F  YIK+G++ADN+
Sbjct  176  DKRFAGYNKDNKQLDPEVHRKYIYGGHVASYMNALMEDEPEKYQSHFKEYIKRGVEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISR  240
            E++YKKVHAAIRADP+ KKS+KQ PKEHKRYNLKKLTYEERKA LI R
Sbjct  236  EEMYKKVHAAIRADPTPKKSDKQQPKEHKRYNLKKLTYEERKAKLIER  283



>ref|XP_010451808.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=143

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+ +
Sbjct  17   DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGI  76

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  77   EELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  133



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAEVH KYIYGGHVA YMR L E+E EKYQS FS YIKKGI AD++
Sbjct  176  DKRFAGFKKDEKQLDAEVHHKYIYGGHVADYMRTLAEEEFEKYQSHFSEYIKKGIKADDV  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADPS  KS K+PPKEHKRYN KKLT+EER++ L+ RLNALN+  
Sbjct  236  ETLYKKVHAAIRADPSVAKSTKEPPKEHKRYNSKKLTHEERRSRLVERLNALNSCG  291



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+SKQLDAE HR YI+GGHVA YM+ L +DEPEKYQ+ FS Y+KKG+DADNL
Sbjct  176  DKRFAGFNKESKQLDAETHRNYIFGGHVANYMKLLNDDEPEKYQTHFSEYLKKGMDADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E LYKKVH AIRADP+ KKSEK  P EHKRYNLKKLTYEERK  LI RL ALN+
Sbjct  236  EALYKKVHTAIRADPTLKKSEKPAPTEHKRYNLKKLTYEERKERLIERLKALNS  289



>gb|KHF99386.1| 60S ribosomal L5 [Gossypium arboreum]
Length=259

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+K SKQLD EVHRKYIYGGHVAAYM+NL+EDEPEKYQS FS YIK+GI  D++
Sbjct  133  EKRFAGFNKGSKQLDPEVHRKYIYGGHVAAYMKNLMEDEPEKYQSHFSEYIKRGIQPDSI  192

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP AKKS+K+PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  193  EGMYKKVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  249



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  176  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KK+EK  PKEHKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EEMYKKVHAAIRADPNPKKTEKPAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+ KQLDAE+HRKYIYGGHV  YM+ L+EDEPEKYQ+ FS ++KKG++ +N+
Sbjct  176  DKRFAGFNKEGKQLDAEIHRKYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E++YKKVHAAIRADP AKKS+K+ PKEHKRYN KKLTYEERKASLI R+ ALN+
Sbjct  236  EEMYKKVHAAIRADPLAKKSDKETPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   178 bits (451),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLD EVHRKYI+GGHV++YMR L+EDEPEKYQ+ FS Y+K+GI+ D++
Sbjct  204  DKRFAGFSKDEKQLDPEVHRKYIFGGHVSSYMRMLMEDEPEKYQTHFSEYVKRGIEPDDI  263

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISR  240
            E+LYKKVHAAIRADP+  KS K+PPKEHKR+NLKKLTYEERKA LI R
Sbjct  264  EELYKKVHAAIRADPNMVKSTKEPPKEHKRFNLKKLTYEERKARLIER  311



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  179  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESI  238

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+EK  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  239  EELYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  295



>ref|NP_001189970.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AEE77020.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=190

 Score =   173 bits (439),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  65   DKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESI  124

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  125  EELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  181



>ref|XP_010648788.1| PREDICTED: 60S ribosomal protein L5-like, partial [Vitis vinifera]
Length=191

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRF GFS DSKQLDAEVHRK IY GHV+AYM   +EDEPE YQS FS YIKK ++ D +
Sbjct  63   DKRFFGFSNDSKQLDAEVHRKCIYVGHVSAYMGTFMEDEPETYQSHFSEYIKKIVEQDGI  122

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E++YKKVHA I A+P  KK EKQPPKEHKRYNLKKLTYEERKA L+ RLNALN+  
Sbjct  123  EEMYKKVHATICANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLVERLNALNSTT  178



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 6/116 (5%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAEVHRKY++GGH+      L EDEPEKYQS FS YIK+GI+AD +
Sbjct  176  DKRFAGFDKEKKELDAEVHRKYVFGGHI------LAEDEPEKYQSHFSEYIKRGIEADGI  229

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADPS KKSEKQPPKEHKRYNLKKLTYEERKA LI+R+ A+N+AA
Sbjct  230  EALYKKVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAA  285



>ref|XP_009384264.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=173

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  539  KDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVH  360
            +D KQLDAEVHR YI+GGHVA+Y++ L+EDEPEKYQ  FS YIK+GI+ D++E++YKKVH
Sbjct  57   RDEKQLDAEVHRNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVH  116

Query  359  AAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            AAI ADP+  KS KQPPKEH+R+NLKKLTYEERKA LI RLNALNA+A
Sbjct  117  AAIHADPTTIKSTKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  164



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+ K LDAE+HRKYIYGGHVA YM+ L+EDEPEKYQS FS Y+KK +  +N+
Sbjct  176  DKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YK VHAAIRADPS KKS+K+ PKEHKRYN KKLTY+ERKASLI R+ ALN+A G
Sbjct  236  EEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  292



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+ KQLDAE+HRKYIYGGHV  YM+ L+EDEPEKYQ+ FS ++KKG++ +N+
Sbjct  176  DKRFAGFNKEGKQLDAEIHRKYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E++YK VHAAIRADP AKKS+K+ PKEHKRYN KKLTYEERKASLI R+ ALN+
Sbjct  236  EEMYKNVHAAIRADPLAKKSDKEAPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+ K LDAE+HRKYIYGGHVA YMR L+EDEPEKYQS FS Y+KK +  +N+
Sbjct  176  DKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMRLLMEDEPEKYQSHFSDYLKKDLAPENM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E++YKKVHAAIRADPS KKS+K+ PKEHKRYN KKLTY+ERKASLI R+ ALN+ 
Sbjct  236  EEMYKKVHAAIRADPSVKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSV  290



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+ K LDAE+HRKYIYGGHVA YM+ L+EDEPEKYQS FS Y+KK +  +N+
Sbjct  180  DKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENM  239

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YK VHAAIRADPS KKS+K+ PKEHKRYN KKLTY+ERKASLI R+ ALN+A G
Sbjct  240  EEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  296



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  176  DKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRA+P+ KK+EK  PKEHKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EEMYKKVHAAIRAEPNHKKTEKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009384265.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   172 bits (436),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  539  KDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVH  360
            +D KQLDAEVHR YI+GGHVA+Y++ L+EDEPEKYQ  FS YIK+GI+ D++E++YKKVH
Sbjct  108  RDEKQLDAEVHRNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVH  167

Query  359  AAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            AAI ADP+  KS KQPPKEH+R+NLKKLTYEERKA LI RLNALNA+A
Sbjct  168  AAIHADPTTIKSTKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  215



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQL+AE HR YIYGGHV+ YM+ L EDEPEK Q+ FSAY+KKG++A+++
Sbjct  176  DKRFAGFNKENKQLNAETHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KK+EK  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EEMYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  176  DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EEIYKKVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  176  DKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+ +
Sbjct  176  DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EEIYKKVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+ +
Sbjct  176  DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EEIYKKVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+ +
Sbjct  176  DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>dbj|BAH20263.1| AT3G25520 [Arabidopsis thaliana]
Length=202

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K++KQLDAE+HR YIYGG V+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  77   DKRFAGFHKENKQLDAEIHRNYIYGGDVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESI  136

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  137  EELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  193



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+ K LDAE+HRKYIYGGHVA YM+ L+EDEPEKYQS FS Y+KK +  +N+
Sbjct  186  DKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENM  245

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E++YK VHAAIRADPS KKS+K+ PKEHKRYN KKLTY+ERKASLI R+ ALN+A
Sbjct  246  EEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  300



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+++
Sbjct  176  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  236  EELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQL+AE HR YIYGGHV+ YM+ L EDEPEK Q+ FSAY+KKG++A+++
Sbjct  197  DKRFAGFNKENKQLNAETHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAESI  256

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRADP+ KK+EK  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  257  EEMYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  313



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+++
Sbjct  206  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESM  265

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  266  EELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  318



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG+SKD K LDAEVHRKYIYGGHVAAYM  L EDEPEKYQS F  Y+K+ I+ +++
Sbjct  176  DKRFAGYSKDDKSLDAEVHRKYIYGGHVAAYMSMLREDEPEKYQSHFVEYLKREIEPESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVH AIRADPS+ K +K  PKEHKRYNLKKLTYEERKA L+ RLNALN+AAG
Sbjct  236  EEMYKKVHTAIRADPSSVK-KKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAAG  291



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+ +
Sbjct  183  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETM  242

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  243  EELYKKVHAAIRADPNPKKTEKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  295



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+++
Sbjct  200  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESM  259

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  260  EELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  312



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+ +
Sbjct  176  DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKILAEDEPEKLQTHFSAYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K+ K LDAE+HRKYIYGGHVA YM+ L+EDEPEKYQS FS Y+KK +  +N+
Sbjct  268  DKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENM  327

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E++YK VHAAIRADPS KKS+K+ PKEHKRYN KKLTY+ERKASLI R+ ALN+A
Sbjct  328  EEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  382



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LD EVHRKYI+GGHVAAYM+ LIEDEPEKYQS FS YIK+GI+AD L
Sbjct  176  DKRFAGFEKEKKELDPEVHRKYIFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E LYKKVHAAIRADP+ KK+EK+PPK+ KRYNLKKLTYEERKA LI+RL ALN+AAG
Sbjct  236  EDLYKKVHAAIRADPTIKKAEKKPPKKSKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA++HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+ +
Sbjct  184  DKRFAGFNKENKQLDADIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETM  243

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  244  EELYKKVHAAIRADPNPKKTEKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  296



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+++
Sbjct  193  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESM  252

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+EK  PK H RYNLKKLTYEERK  LI R+ ALN
Sbjct  253  EELYKKVHAAIRADPNPKKTEKPAPKTHNRYNLKKLTYEERKNKLIERVKALN  305



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FS YIKKG++A+ +
Sbjct  176  DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSGYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIRA+P+ KK+ K  PKEHKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EEMYKKVHAAIRAEPNHKKTVKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+ +
Sbjct  176  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+ K  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  236  EELYKKVHAAIRADPNPKKTAKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  288



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++
Sbjct  176  DKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E+LYKKVHAAIRA P+ +K+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  236  EELYKKVHAAIRAXPNXRKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSK++KQLD   H KYIYGGHVA YM+ L EDEPEK+Q+ FS Y+KKGI+AD +
Sbjct  177  DKRFAGFSKENKQLDFATHAKYIYGGHVADYMKTLNEDEPEKFQTHFSEYVKKGIEADEM  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP AKK+ KQ  KEHKR+NLKKLTY++RKA+LI R+  LN+AA
Sbjct  237  EALYKKVHAAIRADPLAKKAGKQSLKEHKRFNLKKLTYKQRKANLIDRITTLNSAA  292



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L  DEPEK+Q+ FS ++KKG+DA+++
Sbjct  176  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNYDEPEKFQTHFSQHLKKGVDAESM  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK+EK  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  236  EELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQL+AE+HR YI+GGHV+ YM+ L EDEPEK Q+ FSAYIKKG++ +++
Sbjct  176  DKRFAGFNKENKQLNAEIHRNYIFGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEPESI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E++YKKVH AIRADP+ KK EK  PKEHKR+NLKKLTYEERK  LI R+ ALN A+
Sbjct  236  EEMYKKVHLAIRADPNPKKCEKPAPKEHKRHNLKKLTYEERKNKLIERVKALNRAS  291



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLDAEVHRKYIY GHVAAYMR L+EDEPEKYQS F  YIK+GI+ADNL
Sbjct  176  EKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYN  288
            E+LYKKVHAAIRADP+ KKSEK+PP EHKRY 
Sbjct  236  EELYKKVHAAIRADPNQKKSEKKPPAEHKRYG  267



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAG++K+SK LDA++HRKYI GGHVAAYM+ L EDEPEKYQS FS Y KKGI+ +N+
Sbjct  176  DKRFAGYNKESKSLDADLHRKYILGGHVAAYMKTLREDEPEKYQSQFSEYHKKGIEPENI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+LYKKVHAAIRADP+ K SEK  PK  K Y  +KLTYEERK  LI+RLNALNA A
Sbjct  236  EELYKKVHAAIRADPTIKYSEKHVPKVQKHYLTRKLTYEERKNKLIARLNALNAGA  291



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD+KQLDAEVH KYIYGGHVAAYMR L+EDEPEKYQS FS YIK+GI+ADN+
Sbjct  176  DKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKR  294
            E LYKKVHAAIRADP+AKK+EK+PPK+HKR
Sbjct  236  ESLYKKVHAAIRADPTAKKTEKEPPKQHKR  265



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 102/117 (87%), Gaps = 4/117 (3%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF+KDSKQLD EVHRKYIYGGHVAAYM+      PEKYQS FS YIK+GI+ D++
Sbjct  176  EKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMKM----SPEKYQSHFSEYIKRGIEPDSI  231

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E +YKKVHAAIRADP AKKS+K+PPKEHKRYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  232  EGMYKKVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  288



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLD +VHRKYIYGGHVAAYMR L EDEPEKYQS FS YIK+G++AD+L
Sbjct  176  DKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLI  246
            E LYKKVHAAIRADP  KKSEK+PPKEHKR+      Y + K +L+
Sbjct  236  EGLYKKVHAAIRADPILKKSEKEPPKEHKRWG---YIYADEKMTLV  278



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSKDSKQLD EVHRKYIYGGHVAAYMR L+EDEPEKYQ+ FS YIKKGI+ADN+
Sbjct  176  EKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHK  297
            E +YKKV AAIRADP+AKK EKQPPKEHK
Sbjct  236  EAVYKKVQAAIRADPTAKKIEKQPPKEHK  264



>gb|KCW63927.1| hypothetical protein EUGRSUZ_G016041, partial [Eucalyptus grandis]
Length=150

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKDSKQLD +VHRKYIYGGHVAAYMR L EDEPEKYQS FS YIK+G++AD+L
Sbjct  62   DKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDL  121

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHK  297
            E LYKKVHAAIRADP  KKSEK+PPKEHK
Sbjct  122  EGLYKKVHAAIRADPILKKSEKEPPKEHK  150



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAG+SK+ K L+AE+HRKYI GGHVA YMR L EDEPEKYQS FS +IK+GI+AD+L
Sbjct  176  EKRFAGYSKEDKSLNAEIHRKYILGGHVADYMRLLKEDEPEKYQSHFSGFIKEGIEADDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
              +Y KVHAAIRADP+++K+ K+ P E +++ ++KLTYEER+A+L+ RLNA+N 
Sbjct  236  ADMYSKVHAAIRADPTSQKTAKKAPAEKRKWKIQKLTYEERQAALVKRLNAING  289



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAG+SK+ K L+AE HRKYI GGH+A YMR L EDEPEKYQS FS +IK G++ADNL
Sbjct  176  EKRFAGYSKEDKSLNAETHRKYILGGHIADYMRLLKEDEPEKYQSHFSGFIKAGVEADNL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
             ++Y  VHAAIRADP+ +K+EK+ P E +++ ++KLTYEER+A+L+ RLNA+N 
Sbjct  236  AEMYTSVHAAIRADPTQQKTEKKAPAEKRKWKIQKLTYEERQAALVKRLNAVNG  289



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGFSK+ K L+AE HRKYI GGHVA YMR L EDEPEKYQS F+ +IK+GI+AD L
Sbjct  176  EKRFAGFSKEDKSLNAETHRKYILGGHVADYMRLLKEDEPEKYQSHFNKFIKEGIEADEL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
             ++Y KVHAAIRADP  +K+EK+ P E +++ ++KLT+EER+A+L+ RLNA+NA
Sbjct  236  AEMYTKVHAAIRADPDQQKTEKKAPAEKRKWKIQKLTFEERQAALVQRLNAINA  289



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS F+ YIKKGIDAD L
Sbjct  176  DKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHK  297
            E LYKKVHAAIRADP+ KKSEK  PKEHK
Sbjct  236  EALYKKVHAAIRADPTMKKSEKPAPKEHK  264



>ref|XP_009383145.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L5-2 [Musa 
acuminata subsp. malaccensis]
Length=140

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF KD KQLDAE+HRKYI+GGHVA+ MRNL+EDEPEK Q+ F  YIK+  + D +
Sbjct  15   DKRFAGFKKDKKQLDAEIHRKYIFGGHVASSMRNLMEDEPEKXQAHFIEYIKRQAEPDGM  74

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  213
            E++YKKVHAAIR+    K +       H R+NLKKLTYEERKA LI RLNALNA AG
Sbjct  75   EEMYKKVHAAIRSSKIDKVTTNGAL--HCRFNLKKLTYEERKARLIERLNALNACAG  129



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK+Q+ FS Y+KKG+DA+++
Sbjct  209  DKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESM  268

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALN  225
            E+LYKKVHAAIRADP+ KK++K  PK HKRYNLKKLTYEERK  LI R+ ALN
Sbjct  269  EELYKKVHAAIRADPNPKKTKKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  321



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAG++K+ K L+AE+HRKYI GGHVA YM+ L EDEPEKYQS FS +IK G++A+NL
Sbjct  176  EKRFAGYNKEDKSLNAEIHRKYILGGHVADYMKLLKEDEPEKYQSHFSGFIKAGVEAENL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
             ++Y  VHAAIRADP+ +K+EK+ P E +++ ++KLTY+ER+A+L+ RLNA+N 
Sbjct  236  AEMYTSVHAAIRADPTQQKTEKKAPAEKRKWKIQKLTYDERQAALVKRLNAING  289



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            ++RFAG SKD K+L  E HRKY++G  +  YM+ LIEDEP KYQ+ F  Y   G   ++L
Sbjct  176  DQRFAGISKDKKELGPEFHRKYVFGDWLRPYMKTLIEDEPGKYQTPFMDYFSGGKKPEDL  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E+++KKVHAAIRA+P+ KK EKQPPKE KRYNLKKLTYEERKA L++RL ALN AA
Sbjct  236  EEVFKKVHAAIRANPTFKKVEKQPPKEPKRYNLKKLTYEERKAKLVARLQALNFAA  291



>gb|KHN36791.1| 60S ribosomal protein L5 [Glycine soja]
Length=240

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 90/116 (78%), Gaps = 16/116 (14%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K+LDAE+                L EDEPEKYQS FS YIK+GI+AD +
Sbjct  134  DKRFAGFDKEKKELDAEI----------------LAEDEPEKYQSHFSEYIKRGIEADGI  177

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            E LYKKVHAAIRADP+ KKS+KQPPKEHKRYN+KKLTYEERKA L++R+ A+N+AA
Sbjct  178  EALYKKVHAAIRADPTLKKSDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAA  233



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 96/119 (81%), Gaps = 7/119 (6%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAG+SK+ K L+AEVHRKYIYGGHVAAYM  L +++PEKYQS FS +IK+G++ ++L
Sbjct  177  EKRFAGYSKEDKSLNAEVHRKYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESL  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKE----HKRYNLKKLTYEERKASLISRLNALNAA  219
            E+LY KVHAAIRADPS ++    PPK+    HK+    KL+YE+RKA+LI+R+ ALNAA
Sbjct  237  EELYTKVHAAIRADPSPREP---PPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>ref|XP_011014769.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=87

 Score =   138 bits (347),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  458  IEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKK  279
            +EDEPEKYQS FS Y+K+GIDAD +E LYKKVHAAIRADP+AKKSEKQP KEHKRYNLKK
Sbjct  1    MEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKKSEKQPSKEHKRYNLKK  60

Query  278  LTYEERKASLISRLNALNAAA  216
            LTYEERKA L+ RLNALN+AA
Sbjct  61   LTYEERKAKLVERLNALNSAA  81



>emb|CBI38287.3| unnamed protein product [Vitis vinifera]
Length=95

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  470  MRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRY  291
            M  L+EDEPEKYQS FS YIK+GI+ D +E++YKKVHA+IRADP+ KKSEK+PPK HKR+
Sbjct  1    MTTLMEDEPEKYQSHFSEYIKRGIEPDGIEEMYKKVHASIRADPTPKKSEKEPPKVHKRH  60

Query  290  NLKKLTYEERKASLISRLNALNAAAG  213
            NLKKLTYEERKA LI RLNALN+AAG
Sbjct  61   NLKKLTYEERKAKLIERLNALNSAAG  86



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 95/119 (80%), Gaps = 7/119 (6%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAG+SK+ K L+AEVHRKYIYGGHVAAYM  L +++PEKYQS FS +IK+G++ ++L
Sbjct  177  EKRFAGYSKEDKSLNAEVHRKYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESL  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKE----HKRYNLKKLTYEERKASLISRLNALNAA  219
            E+LY KVHAAIR DPS ++    PPK+    HK+    KL+YE+RKA+LI+R+ ALNAA
Sbjct  237  EELYTKVHAAIREDPSPREP---PPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>gb|ABK92743.1| unknown [Populus trichocarpa]
Length=91

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  470  MRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRY  291
            MR L+EDEPEKYQS FS Y+K+ IDAD +E LYKKVHAAIRADP+ KKSEK+P KEHKRY
Sbjct  1    MRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSEKEPLKEHKRY  60

Query  290  NLKKLTYEERKASLISRLNALNAAAG  213
            NLKKLTYEERK  L+ RLN  N+AA 
Sbjct  61   NLKKLTYEERKEKLVERLNTFNSAAD  86



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 1/91 (1%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGFSKD KQLDA+VHRKYIYGGHVAAYM  L EDEPEKY+  FS + K+ I+AD L
Sbjct  152  DKRFAGFSKDGKQLDAKVHRKYIYGGHVAAYMNTLAEDEPEKYERHFSEFAKREIEADGL  211

Query  383  EQLYKKVHAAIRADPSAKKSEK-QPPKEHKR  294
            E+LY+KVHAAIRADP  KKSE+ QPPKE KR
Sbjct  212  EELYRKVHAAIRADPMPKKSERQQPPKEPKR  242



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -1

Query  479  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEH  300
            A + +NL E+EPEKYQS FSAYIKKG++AD +E LYKKVHAAIRADPS  KS KQPPKEH
Sbjct  181  AGFKKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKSTKQPPKEH  240

Query  299  KRYNLKKLTYEERKASLISRLNALNAAAG  213
            KRYN KKLTYE+RKASLI RLN LN++ G
Sbjct  241  KRYNPKKLTYEQRKASLIERLNQLNSSGG  269



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+ +
Sbjct  176  DKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGI  235

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKR  294
            E+LYKKVHAAIRADP+ KK+ K  PK+HKR
Sbjct  236  EELYKKVHAAIRADPNPKKTVKPAPKQHKR  265



>ref|XP_011399144.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
 gb|KFM26248.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
Length=293

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRF G+S+++K+LD+EV RKYI GGHVA YM +L E+EPEKY+  FS Y+K G++A+ L
Sbjct  177  DKRFVGYSRETKELDSEVLRKYILGGHVAEYMESLKEEEPEKYERHFSRYVKAGLEAEGL  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E+LY  VHAAIRADP  K+ E++ P + K +   KLTYE RK  L ++L  L AA
Sbjct  237  EELYTSVHAAIRADPVQKRKERKAPADKKAWKESKLTYEARKEKLKAKLAELTAA  291



>dbj|BAD94104.1| ribosomal protein [Arabidopsis thaliana]
Length=95

 Score =   122 bits (306),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  470  MRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRY  291
            M+ L EDEPEK Q+ FSAYIKKG++A+++E+LYKKVHAAIRADP+ KK+ K  PK+HKRY
Sbjct  1    MKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTVKPAPKQHKRY  60

Query  290  NLKKLTYEERKASLISRLNALNAAAG  213
            NLKKLTYEERK  LI R+ ALN A G
Sbjct  61   NLKKLTYEERKNKLIERVKALNGAGG  86



>ref|XP_005843140.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
 gb|EFN51038.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
Length=295

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRF GF  DSK+ DAEV RKYIYGGHV  YM  + E++PEKY + F+ Y+K G+++D+L
Sbjct  177  EKRFVGFDPDSKEFDAEVLRKYIYGGHVGEYMEEMQEEDPEKYTAHFAEYLKAGLESDDL  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAA  219
            E +Y KVH AIRADP+ +   +  P E KR+   KLTYE+RK  L ++L+ L A 
Sbjct  237  EDMYTKVHDAIRADPAPQLKARSKPAESKRWKEVKLTYEQRKDKLKAKLSELMAG  291



>ref|XP_009373234.1| PREDICTED: 60S ribosomal protein L5-like [Pyrus x bretschneideri]
Length=151

 Score =   120 bits (302),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -1

Query  548  GFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYK  369
            G    +K++   +  KYIYGGHVAAYM  L+E EPEKY S FS YIKKGI+ADN+++LYK
Sbjct  15   GPKTPNKEVFYSLSFKYIYGGHVAAYMTTLVEAEPEKYHSHFSEYIKKGIEADNIKELYK  74

Query  368  KVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  216
            KVHAAI  DP+ KK++K  P++ KRYNLKKLT++ERK  L+ RL A N  A
Sbjct  75   KVHAAIGVDPTIKKTKKLAPQKCKRYNLKKLTFDERKKKLVKRLKAFNDLA  125



>dbj|BAB10894.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
Length=88

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  470  MRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRY  291
            M+ L E EPEK Q++FSAYIKKG++A+++E++YKKVHAAIRA+P+ KK+EK   KEHKRY
Sbjct  1    MKLLGEYEPEKLQTLFSAYIKKGVEAESIEEMYKKVHAAIRAEPNHKKTEKPATKEHKRY  60

Query  290  NLKKLTYEERKASLISRLNALNAAAG  213
            +LKKLTYEERK  LI R+ ALN A+G
Sbjct  61   DLKKLTYEERKNKLIERVKALNGASG  86



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRFAGF KD KQLDA++HRKYIYGGHVA YM+NL E+EPEKYQS FS YIKKGI+A+++
Sbjct  177  EKRFAGFKKDDKQLDADIHRKYIYGGHVADYMKNLAEEEPEKYQSHFSDYIKKGIEAEDM  236

Query  383  EQLYKKVHAAIR  348
            E LYKKVHAAIR
Sbjct  237  EGLYKKVHAAIR  248



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRF G+S++SK LD++V RKYI+GGHV  YM ++ E++ EK++  FS YIK G++AD L
Sbjct  177  EKRFVGYSRESKSLDSDVLRKYIFGGHVGEYMESMAEEDEEKFKRHFSCYIKAGLEADGL  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA  222
            E LY KVHAAIRA P A K  +  P +   +   K TYEERK  L ++L  L A
Sbjct  237  EALYTKVHAAIRASPEAAKKSRSKPAKAGSWKTPKSTYEERKERLKAKLAELMA  290



>gb|EMS54008.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=137

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRF  F KD KQL AE+HRKYIY GHVA YM+++ +++P+KYQS FS YIKK I AD++
Sbjct  48   DKRFVRFKKDKKQLGAEIHRKYIYEGHVADYMKSIADEQPKKYQSHFSEYIKKNIAADDM  107

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHK  297
            E LYKKVHAAI A P+  KS K+P K HK
Sbjct  108  EALYKKVHAAICAYPTMAKSTKEPSKTHK  136



>gb|EMT09987.1| hypothetical protein F775_52606 [Aegilops tauschii]
Length=115

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  551  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY  372
            AGF KD KQL  E+HRKYIY GHVA YM+++ ++E +KYQS FS YIKK I  D++E LY
Sbjct  30   AGFKKDKKQLGGEIHRKYIYEGHVADYMKSIADEESKKYQSHFSEYIKKNIAGDDMEALY  89

Query  371  KKVHAAIRADPSAKKSEKQPPKEHK  297
            KKVHA IRA P+  KS K+PPK HK
Sbjct  90   KKVHATIRAYPTMAKSTKEPPKTHK  114



>gb|EFX90266.1| hypothetical protein DAPPUDRAFT_299917 [Daphnia pulex]
Length=302

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRF G+  +SK  +AEVHRK+I G HVA YMR L++++ E Y+  FS +IK G+ AD +E
Sbjct  178  KRFPGYDSESKDFNAEVHRKHIMGAHVADYMRQLVDEDEEAYKKQFSQFIKHGLVADTIE  237

Query  380  QLYKKVHAAIRADPSAKKSEKQPPK-EHKRYNLKKLTYEERKASLISR----LNALNAAA  216
             +YKK H AIRADP  +KS K P K + KR+N K+LT EERKA + ++    L+ L A+A
Sbjct  238  TMYKKAHEAIRADPEKQKSSKDPSKIKKKRWNAKRLTLEERKARVAAKKKEFLSKLEASA  297



>gb|KEZ38694.1| hypothetical protein SAPIO_CDS10715 [Scedosporium apiospermum]
Length=301

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 82/123 (67%), Gaps = 9/123 (7%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRF G+  ++K+LD+EV RKYI+GGHVA YM  L +D+ E+Y+S F  YI   IDAD L
Sbjct  180  EKRFPGYDIETKELDSEVLRKYIFGGHVAEYMETLADDDEERYKSQFQKYIDDDIDADGL  239

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKEHK--------RYNLKKLTYEERKASLISRLNAL  228
            E+LY + HAAIR DP  KK E + PK+ K        +Y  +KLTYE+RKA++  R+  +
Sbjct  240  EELYTEAHAAIREDP-FKKVEGKGPKKSKEEWKAISQKYKTRKLTYEQRKANVQKRIAEI  298

Query  227  NAA  219
              A
Sbjct  299  RDA  301



>ref|XP_008198550.1| PREDICTED: 60S ribosomal protein L5 [Tribolium castaneum]
 gb|EEZ97412.1| hypothetical protein TcasGA2_TC011241 [Tribolium castaneum]
Length=300

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRF G+  +SK  +A+VHR +I+G HVA YMR+L E++PE ++  FS YIK GI+AD +E
Sbjct  178  KRFPGYDAESKSFNADVHRSHIFGQHVADYMRSLEEEDPEAFKRQFSQYIKLGINADQIE  237

Query  380  QLYKKVHAAIRADPSA-KKSEKQPPKEHKRYNLKKLTYEERK  258
             +YK  HAAIRA+P+A KK EK P    KR+N KKLT  ERK
Sbjct  238  GIYKNAHAAIRANPTAEKKPEKAPSATKKRWNRKKLTLAERK  279



>gb|AAC32143.1| probable 60S ribosomal protein L5 [Picea mariana]
Length=89

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -1

Query  464  NLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNL  285
             L EDEPEKYQ  FS Y KKGI+ +N+E+LYKKVHAAIRADP+ K +EK  PK  K Y  
Sbjct  1    TLREDEPEKYQFQFSEYHKKGIEPENIEELYKKVHAAIRADPTIKYTEKHVPKVQKHYLT  60

Query  284  KKLTYEERKASLISRLNALNAAA  216
            +KLTYEERK  LI+RLNALNA A
Sbjct  61   RKLTYEERKNKLIARLNALNAGA  83



>ref|XP_005643753.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE19209.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRF G+S + K+LD EV RK+IYGGHVA YM  + E+ PEKYQS F+ +I+  +D +++
Sbjct  177  DKRFVGYSGEDKKLDPEVLRKHIYGGHVAEYMEEMQEEAPEKYQSHFAKWIEAEVDPEDI  236

Query  383  EQLYKKVHAAIRADPSAKKSEKQPPKE-HKRYNLKKLTYEERKASLISRLNAL  228
            E+LYK VH  IR +P  +K E+  P+   K++   KLTYEERKA+L ++L  L
Sbjct  237  EELYKGVHEKIRENPIGEKKERSKPETAQKKWKPSKLTYEERKAALKTKLAQL  289



>dbj|BAN20290.1| ribosomal protein L5 [Riptortus pedestris]
Length=299

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRF G+  +SK+ +AEVHRK+I+G HVA YMR L E + + Y+  FS YIK GI AD +E
Sbjct  178  KRFPGYDSESKEFNAEVHRKHIFGVHVADYMRQLAESDDDAYKKQFSQYIKNGITADQVE  237

Query  380  QLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASL  249
            ++YKK HAAIRADPS K   K      KR+N  KLT  ERK S+
Sbjct  238  EIYKKAHAAIRADPSKKAPAKTKTPVKKRWNRAKLTLAERKNSI  281



>gb|AES86898.2| ribosomal L18 carboxy-terminal region protein [Medicago truncatula]
Length=141

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  497  IYGGHVAAYMRNLI-EDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSE  321
            ++G    A +  LI +DEP KYQ  FS  IKKGI+AD  E+LYKKV+ AIR DPS KKS+
Sbjct  39   VFGAFKGALVGTLIADDEPAKYQRQFSKRIKKGIEADEFEKLYKKVNDAIRVDPSIKKSQ  98

Query  320  KQPPKEHKRYNLKKLTYEERKASLI  246
            K PPK+HK YNLKKLTYEERKA LI
Sbjct  99   KHPPKQHKMYNLKKLTYEERKAKLI  123



>ref|XP_002550737.1| 60S ribosomal protein L5 [Candida tropicalis MYA-3404]
 gb|EER31305.1| 60S ribosomal protein L5 [Candida tropicalis MYA-3404]
Length=298

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 80/118 (68%), Gaps = 5/118 (4%)
 Frame = -1

Query  557  RFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQ  378
            RF G+  ++++LDAE+ RKYI+GGHVA YM  L++D+ EK++S+F  Y+   ID++++E+
Sbjct  179  RFPGWDIEAEELDAELLRKYIFGGHVAEYMEELLDDDEEKFKSIFKGYLDDEIDSEDIEE  238

Query  377  LYKKVHAAIRADPSAKKSEKQPPKEH-----KRYNLKKLTYEERKASLISRLNALNAA  219
            +Y   H AIRADPS K +EK+  KE      K+Y   KLT EERKA +  R+    AA
Sbjct  239  IYANAHEAIRADPSFKPTEKKFTKEQYKAESKKYRQTKLTREERKAKIAERIAEFKAA  296



>ref|XP_004533872.1| PREDICTED: 60S ribosomal protein L5-like [Ceratitis capitata]
Length=298

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRF G+S ++K  +A+VHR +I+G HVA YMR L E++ E ++  FS YIK GI AD+LE
Sbjct  178  KRFPGYSAEAKSFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGIRADDLE  237

Query  380  QLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASL  249
             +YKK H +IRADP+ KK E++     KR+N KKLT E+RK  +
Sbjct  238  TIYKKAHQSIRADPTHKKKEQKSGGVKKRWNAKKLTNEQRKVKV  281



>gb|EHJ70750.1| ribosomal protein L5 [Danaus plexippus]
Length=297

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 8/118 (7%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRF GF  ++K+ +AEVHR +I+G HVA YM+NL +++ + ++  F  YIK G+ AD +E
Sbjct  178  KRFPGFDAEAKKFNAEVHRAHIFGLHVAEYMKNLEQEDEDSFKRQFGKYIKLGVSADAIE  237

Query  380  QLYKKVHAAIRADPSAKKSE-KQPPKEHKRYNLKKLTYEER-------KASLISRLNA  231
             LYKK H  IRADPS KK E K+ P + KR+N +KLT  ER       KAS I RL A
Sbjct  238  SLYKKAHELIRADPSHKKKESKKDPAKQKRWNKRKLTLAERKNRIKQKKASFIKRLQA  295



>gb|EMF17397.1| 60S ribosomal protein L5 [Sphaerulina musiva SO2202]
Length=302

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 7/119 (6%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            EKRF G+  ++K+LDAE  RKYI+ GHVA YM  L +D+ E+Y+S FS YI   I+AD L
Sbjct  180  EKRFPGYDIETKELDAETLRKYIFAGHVAEYMETLADDDEERYKSQFSGYIDDEIEADGL  239

Query  383  EQLYKKVHAAIRADP-------SAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNAL  228
            E+LY++ H AIR DP         KK++++   E ++Y LKKLT+EER+  +  ++  L
Sbjct  240  EELYQEAHKAIREDPWKKDEDAGEKKTKEEWKAESQKYKLKKLTHEERRQRVQEKIKTL  298



>gb|EMS62821.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=130

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -1

Query  563  EKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL  384
            +KRFAGF K+ K LD E+HR YIY  HVA  M+++ ++EPE+YQ  FS YIKKGI AD++
Sbjct  52   DKRFAGFKKNEKWLDTEIHRNYIYEDHVADCMKSIADEEPEEYQFHFSEYIKKGIAADDM  111

Query  383  EQLYKKVHAAIRADPSAKK  327
            E LYKKVHA IRADP+  K
Sbjct  112  EALYKKVHATIRADPTMAK  130



>ref|NP_001037008.1| 60S ribosomal protein L5 [Bombyx mori]
 sp|O76190.1|RL5_BOMMO RecName: Full=60S ribosomal protein L5 [Bombyx mori]
 gb|AAC24960.1| ribosomal protein L5 [Bombyx mori]
Length=299

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 79/118 (67%), Gaps = 8/118 (7%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRF G+  +SK+ +AEVHR +I+G HVA YMR+L +D+ + ++  FS YIK G+ AD +E
Sbjct  178  KRFPGYDAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIE  237

Query  380  QLYKKVHAAIRADPSAKKSE-KQPPKEHKRYNLKKLTYEER-------KASLISRLNA  231
             +YKK H AIRADPS KK E K+   + KR+N +KLT  ER       KAS I RL A
Sbjct  238  AIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQA  295



>gb|ADT80695.1| ribosomal protein L5 [Euphydryas aurinia]
Length=297

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 79/118 (67%), Gaps = 8/118 (7%)
 Frame = -1

Query  560  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE  381
            KRF G+  ++K+ +AEVHR +I+G HVA YMRNL +++ + ++  F  YIK G+ AD++E
Sbjct  178  KRFPGYDAEAKKFNAEVHRAHIFGLHVAEYMRNLEQEDEDSFKRQFGKYIKLGVTADSIE  237

Query  380  QLYKKVHAAIRADPSAKKSE-KQPPKEHKRYNLKKLTYEER-------KASLISRLNA  231
             LYKK H AIRADPS KK E K+ P + KR+N +KLT  ER       K S + RL A
Sbjct  238  SLYKKAHEAIRADPSHKKKEGKKDPAKQKRWNKRKLTLAERKNRIKQKKESFLKRLQA  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880