BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050N10

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002526974.1|  copine, putative                                   108   2e-24   Ricinus communis
gb|AAX20031.1|  RING-finger protein                                     107   4e-24   Capsicum annuum
emb|CDP16621.1|  unnamed protein product                                106   8e-24   Coffea canephora [robusta coffee]
ref|XP_006646587.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    105   8e-24   Oryza brachyantha
ref|XP_011101825.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    105   8e-24   
ref|XP_009370343.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    105   1e-23   
gb|EYU44849.1|  hypothetical protein MIMGU_mgv1a005375mg                105   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_006338634.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    106   1e-23   Solanum tuberosum [potatoes]
ref|XP_008230495.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    105   1e-23   Prunus mume [ume]
ref|NP_001266128.1|  E3 ubiquitin-protein ligase RGLG2-like             106   1e-23   Solanum lycopersicum
ref|XP_009371747.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       105   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_011101822.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    105   1e-23   
ref|XP_008341364.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       105   1e-23   
ref|XP_011097361.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    105   1e-23   
ref|XP_010089180.1|  E3 ubiquitin-protein ligase RGLG2                  105   2e-23   Morus notabilis
ref|XP_003622329.1|  E3 ubiquitin-protein ligase RGLG2                  104   2e-23   Medicago truncatula
ref|XP_010420077.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    105   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008797006.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    104   3e-23   
ref|XP_007215340.1|  hypothetical protein PRUPE_ppa005347mg             104   4e-23   Prunus persica
ref|XP_006287684.1|  hypothetical protein CARUB_v10000894mg             104   4e-23   Capsella rubella
tpg|DAA56239.1|  TPA: hypothetical protein ZEAMMB73_877987              104   4e-23   
tpg|DAA56240.1|  TPA: hypothetical protein ZEAMMB73_877987              104   4e-23   
ref|NP_001045146.1|  Os01g0908700                                       104   4e-23   
ref|NP_001146212.1|  uncharacterized protein LOC100279782               104   4e-23   Zea mays [maize]
ref|XP_007222138.1|  hypothetical protein PRUPE_ppa005724mg             103   6e-23   
ref|XP_002458953.1|  hypothetical protein SORBIDRAFT_03g043290          103   6e-23   Sorghum bicolor [broomcorn]
ref|XP_011005559.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       103   6e-23   Populus euphratica
gb|ABG34341.1|  copine-like protein                                     103   6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008221938.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       103   7e-23   
ref|XP_010932261.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    103   8e-23   Elaeis guineensis
ref|XP_008357726.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    103   8e-23   
ref|XP_010927544.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    103   9e-23   
ref|XP_010927542.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    103   1e-22   
ref|XP_006399953.1|  hypothetical protein EUTSA_v10013466mg             103   1e-22   Eutrema salsugineum [saltwater cress]
ref|XP_008379181.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    103   1e-22   
ref|XP_010453560.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009125973.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       103   1e-22   Brassica rapa
ref|XP_004970988.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    103   1e-22   Setaria italica
emb|CDX91062.1|  BnaC02g05350D                                          102   2e-22   
ref|XP_004156734.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    101   2e-22   
ref|XP_003618769.1|  E3 ubiquitin-protein ligase RGLG2                  102   2e-22   Medicago truncatula
ref|XP_004309992.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    102   2e-22   Fragaria vesca subsp. vesca
ref|XP_009778227.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    102   2e-22   Nicotiana sylvestris
gb|AFW84239.1|  hypothetical protein ZEAMMB73_082799                    102   2e-22   
ref|XP_009599491.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       102   3e-22   
ref|XP_003564886.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       102   3e-22   Brachypodium distachyon [annual false brome]
ref|XP_004142779.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    101   3e-22   Cucumis sativus [cucumbers]
ref|XP_008458835.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       101   4e-22   Cucumis melo [Oriental melon]
ref|XP_003524729.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    102   4e-22   Glycine max [soybeans]
ref|XP_002298557.2|  hypothetical protein POPTR_0001s35660g             101   4e-22   
ref|XP_010492244.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    101   4e-22   Camelina sativa [gold-of-pleasure]
gb|KHN14880.1|  E3 ubiquitin-protein ligase RGLG2                     99.8    6e-22   Glycine soja [wild soybean]
ref|XP_004236287.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       100   6e-22   Solanum lycopersicum
ref|XP_006351421.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    100   7e-22   Solanum tuberosum [potatoes]
gb|KHN34573.1|  E3 ubiquitin-protein ligase RGLG1                     99.8    9e-22   Glycine soja [wild soybean]
ref|XP_003548557.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    100   9e-22   Glycine max [soybeans]
gb|KHN27569.1|  E3 ubiquitin-protein ligase RGLG2                       100   9e-22   Glycine soja [wild soybean]
ref|XP_010524289.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    100   1e-21   Tarenaya hassleriana [spider flower]
gb|KHN00030.1|  E3 ubiquitin-protein ligase RGLG1                     99.8    1e-21   Glycine soja [wild soybean]
emb|CDX78576.1|  BnaA03g04880D                                          100   1e-21   
ref|XP_003555130.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  99.8    2e-21   Glycine max [soybeans]
ref|XP_003553280.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    100   2e-21   Glycine max [soybeans]
ref|XP_008340126.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     99.8    2e-21   Malus domestica [apple tree]
ref|XP_010029085.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    100   2e-21   Eucalyptus grandis [rose gum]
ref|XP_010029080.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    100   2e-21   
ref|XP_008446129.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  99.0    3e-21   Cucumis melo [Oriental melon]
ref|XP_009608151.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  99.0    3e-21   Nicotiana tomentosiformis
ref|XP_009795957.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  99.0    3e-21   Nicotiana sylvestris
ref|XP_010033345.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.8    4e-21   Eucalyptus grandis [rose gum]
gb|KDP26671.1|  hypothetical protein JCGZ_17829                       99.0    4e-21   Jatropha curcas
ref|NP_001145987.1|  uncharacterized protein LOC100279516             99.0    5e-21   Zea mays [maize]
ref|XP_004304674.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     99.0    5e-21   Fragaria vesca subsp. vesca
ref|XP_010033344.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  98.2    5e-21   
ref|XP_002315654.1|  hypothetical protein POPTR_0010s05940g           97.8    6e-21   
gb|KJB11578.1|  hypothetical protein B456_001G266800                  98.2    6e-21   Gossypium raimondii
gb|KJB61002.1|  hypothetical protein B456_009G335200                  98.6    7e-21   Gossypium raimondii
emb|CDY09854.1|  BnaC09g43070D                                        98.6    7e-21   Brassica napus [oilseed rape]
ref|XP_007044867.1|  Copine family isoform 1                          98.2    8e-21   
emb|CDX70564.1|  BnaC03g06480D                                        98.2    8e-21   
gb|KHN30970.1|  E3 ubiquitin-protein ligase RGLG2                     95.1    9e-21   Glycine soja [wild soybean]
ref|XP_010033343.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.8    9e-21   Eucalyptus grandis [rose gum]
ref|XP_008807474.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.8    1e-20   
ref|XP_002511290.1|  copine, putative                                 97.4    1e-20   Ricinus communis
ref|XP_009121662.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.8    1e-20   Brassica rapa
ref|XP_002873665.1|  hypothetical protein ARALYDRAFT_488284           97.8    1e-20   
ref|XP_009131405.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.4    1e-20   Brassica rapa
gb|KDO69443.1|  hypothetical protein CISIN_1g012303mg                 96.3    1e-20   Citrus sinensis [apfelsine]
ref|XP_009131403.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.4    1e-20   Brassica rapa
ref|XP_006483979.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.4    1e-20   
gb|KCW59704.1|  hypothetical protein EUGRSUZ_H02465                   97.4    1e-20   Eucalyptus grandis [rose gum]
ref|XP_007137991.1|  hypothetical protein PHAVU_009G171800g           97.1    1e-20   Phaseolus vulgaris [French bean]
gb|KEH35020.1|  E3 ubiquitin-protein ligase RGLG2-like protein        97.1    2e-20   Medicago truncatula
ref|XP_010927546.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  96.3    2e-20   
ref|XP_006438208.1|  hypothetical protein CICLE_v10031509mg           97.4    2e-20   Citrus clementina [clementine]
gb|KDP46390.1|  hypothetical protein JCGZ_10230                       97.1    2e-20   Jatropha curcas
gb|AFN89139.1|  RING-type ubiquitin ligase                            97.4    2e-20   Mesembryanthemum crystallinum
ref|XP_002515058.1|  copine, putative                                 97.4    2e-20   
ref|XP_010026602.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  97.4    2e-20   
ref|XP_009333912.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  96.7    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_006439963.1|  hypothetical protein CICLE_v10020205mg           96.7    2e-20   Citrus clementina [clementine]
ref|XP_007151612.1|  hypothetical protein PHAVU_004G061800g           97.4    2e-20   Phaseolus vulgaris [French bean]
gb|KDO69441.1|  hypothetical protein CISIN_1g012303mg                 96.7    2e-20   Citrus sinensis [apfelsine]
ref|XP_006476915.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  96.7    2e-20   Citrus sinensis [apfelsine]
emb|CDX69581.1|  BnaA10g19300D                                        97.1    2e-20   
ref|XP_006476914.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  96.7    2e-20   Citrus sinensis [apfelsine]
gb|KDO69439.1|  hypothetical protein CISIN_1g012303mg                 96.7    3e-20   Citrus sinensis [apfelsine]
ref|XP_008389744.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  96.7    3e-20   
ref|NP_001240870.1|  uncharacterized protein LOC100809850             96.3    3e-20   Glycine max [soybeans]
gb|KHG01454.1|  E3 ubiquitin-protein ligase RGLG2 -like protein       96.7    3e-20   Gossypium arboreum [tree cotton]
gb|KDO69440.1|  hypothetical protein CISIN_1g012303mg                 96.7    3e-20   Citrus sinensis [apfelsine]
ref|XP_002282202.2|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     96.3    4e-20   Vitis vinifera
emb|CDY49067.1|  BnaC05g48950D                                        92.4    4e-20   Brassica napus [oilseed rape]
ref|XP_002271885.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  96.3    4e-20   Vitis vinifera
gb|EYU34755.1|  hypothetical protein MIMGU_mgv1a006209mg              95.9    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_010524288.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.5    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_006446649.1|  hypothetical protein CICLE_v10015247mg           95.5    5e-20   
ref|XP_006379955.1|  hypothetical protein POPTR_0008s18400g           95.5    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004135284.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.1    9e-20   Cucumis sativus [cucumbers]
ref|XP_006591484.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.1    9e-20   Glycine max [soybeans]
dbj|BAH19894.1|  AT5G14420                                            95.1    9e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196946.1|  E3 ubiquitin-protein ligase RGLG2                   95.1    9e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538591.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.1    9e-20   Glycine max [soybeans]
ref|XP_011034033.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.5    9e-20   Populus euphratica
ref|XP_010904547.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     95.1    1e-19   Elaeis guineensis
ref|XP_011034031.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.1    1e-19   Populus euphratica
ref|XP_003526988.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  94.7    1e-19   Glycine max [soybeans]
ref|XP_008367487.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.1    1e-19   Malus domestica [apple tree]
ref|XP_011042369.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  95.1    1e-19   Populus euphratica
ref|XP_002279018.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     94.7    1e-19   Vitis vinifera
gb|KJB33861.1|  hypothetical protein B456_006G034900                  95.1    1e-19   Gossypium raimondii
ref|XP_010435648.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  94.7    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010248698.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     94.4    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_008374368.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  94.4    2e-19   
gb|KHN43980.1|  E3 ubiquitin-protein ligase RGLG2                     94.4    2e-19   Glycine soja [wild soybean]
ref|XP_006601923.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  94.4    2e-19   Glycine max [soybeans]
ref|XP_006601922.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  94.4    2e-19   Glycine max [soybeans]
ref|XP_003551971.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  94.4    2e-19   Glycine max [soybeans]
ref|XP_010102933.1|  E3 ubiquitin-protein ligase RGLG2                92.0    2e-19   
ref|XP_007037786.1|  RING domain ligase2 isoform 1                    94.0    2e-19   
ref|XP_004489546.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  93.6    3e-19   Cicer arietinum [garbanzo]
ref|XP_008239359.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  93.6    3e-19   Prunus mume [ume]
ref|XP_007209145.1|  hypothetical protein PRUPE_ppa005852mg           93.6    3e-19   Prunus persica
emb|CDY37509.1|  BnaA05g33740D                                        93.6    3e-19   Brassica napus [oilseed rape]
emb|CDY49066.1|  BnaC05g48940D                                        93.6    4e-19   Brassica napus [oilseed rape]
ref|XP_006585247.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  93.6    4e-19   Glycine max [soybeans]
ref|XP_003531323.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  93.6    4e-19   Glycine max [soybeans]
ref|XP_009147449.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  93.6    4e-19   Brassica rapa
ref|XP_011040451.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  93.2    4e-19   Populus euphratica
gb|EMT24645.1|  E3 ubiquitin-protein ligase RGLG2                     92.4    4e-19   
ref|XP_002318092.2|  hypothetical protein POPTR_0012s09190g           93.2    4e-19   
emb|CDX74310.1|  BnaA03g27370D                                        93.6    4e-19   
ref|XP_009147448.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  93.6    4e-19   Brassica rapa
ref|XP_009134597.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     93.2    4e-19   Brassica rapa
ref|XP_010485387.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  93.2    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002884269.1|  hypothetical protein ARALYDRAFT_896079           92.8    5e-19   
ref|XP_010100348.1|  E3 ubiquitin-protein ligase RGLG2                92.8    5e-19   Morus notabilis
ref|XP_010250991.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.8    6e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006470207.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.8    6e-19   Citrus sinensis [apfelsine]
ref|XP_010250995.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.8    6e-19   Nelumbo nucifera [Indian lotus]
ref|XP_007163690.1|  hypothetical protein PHAVU_001G255900g           92.8    6e-19   Phaseolus vulgaris [French bean]
ref|XP_009419388.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.8    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550166.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.8    6e-19   Tarenaya hassleriana [spider flower]
ref|XP_010496283.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     92.8    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007163691.1|  hypothetical protein PHAVU_001G255900g           92.8    6e-19   Phaseolus vulgaris [French bean]
ref|XP_011005612.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.8    7e-19   Populus euphratica
gb|KJB31093.1|  hypothetical protein B456_005G175700                  92.4    7e-19   Gossypium raimondii
ref|XP_004299159.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.8    7e-19   Fragaria vesca subsp. vesca
ref|XP_006408532.1|  hypothetical protein EUTSA_v10020651mg           92.8    8e-19   Eutrema salsugineum [saltwater cress]
dbj|BAJ96252.1|  predicted protein                                    92.4    9e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU44846.1|  hypothetical protein MIMGU_mgv1a009476mg              91.3    9e-19   Erythranthe guttata [common monkey flower]
gb|KDP31007.1|  hypothetical protein JCGZ_11383                       92.0    1e-18   Jatropha curcas
ref|XP_009412691.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007159686.1|  hypothetical protein PHAVU_002G258600g           92.4    1e-18   Phaseolus vulgaris [French bean]
gb|KEH20743.1|  E3 ubiquitin-protein ligase RGLG2-like protein        92.4    1e-18   Medicago truncatula
gb|KHN06536.1|  E3 ubiquitin-protein ligase RGLG2                     92.0    1e-18   Glycine soja [wild soybean]
ref|XP_010519134.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  91.7    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010682336.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  92.0    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682339.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  91.7    2e-18   
ref|XP_009359243.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     91.7    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_010682022.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  91.7    2e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU44848.1|  hypothetical protein MIMGU_mgv1a005375mg              91.7    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_007031645.1|  RING domain ligase2 isoform 1                    91.7    2e-18   
emb|CDX91935.1|  BnaC03g32370D                                        91.3    3e-18   
ref|XP_004141118.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  90.9    3e-18   Cucumis sativus [cucumbers]
ref|XP_004158327.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  90.9    3e-18   
ref|XP_008464939.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  90.9    3e-18   Cucumis melo [Oriental melon]
ref|XP_011071160.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     90.9    3e-18   Sesamum indicum [beniseed]
ref|XP_004504141.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  90.5    4e-18   Cicer arietinum [garbanzo]
ref|XP_004504140.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  90.9    4e-18   Cicer arietinum [garbanzo]
gb|KJB51130.1|  hypothetical protein B456_008G202700                  89.4    5e-18   Gossypium raimondii
ref|XP_002321646.1|  hypothetical protein POPTR_0015s09780g           89.7    6e-18   
gb|KJB75966.1|  hypothetical protein B456_012G065700                  90.1    8e-18   Gossypium raimondii
gb|KHG01850.1|  E3 ubiquitin-protein ligase RGLG2                     89.7    8e-18   Gossypium arboreum [tree cotton]
ref|XP_003524251.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  89.7    8e-18   Glycine max [soybeans]
gb|KHG01848.1|  E3 ubiquitin-protein ligase RGLG2                     89.7    9e-18   Gossypium arboreum [tree cotton]
gb|KJB51125.1|  hypothetical protein B456_008G202700                  89.0    9e-18   Gossypium raimondii
gb|KHG01849.1|  E3 ubiquitin-protein ligase RGLG2                     90.1    9e-18   Gossypium arboreum [tree cotton]
ref|NP_186814.1|  E3 ubiquitin-protein ligase RGLG1                   89.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044533.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  89.4    1e-17   Eucalyptus grandis [rose gum]
gb|EYU22544.1|  hypothetical protein MIMGU_mgv1a006738mg              89.4    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_010044531.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  89.4    1e-17   Eucalyptus grandis [rose gum]
ref|XP_002312658.1|  hypothetical protein POPTR_0008s18400g           89.0    1e-17   
gb|KJB51124.1|  hypothetical protein B456_008G202700                  89.0    1e-17   Gossypium raimondii
ref|XP_010044532.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  89.4    1e-17   Eucalyptus grandis [rose gum]
gb|KJB51129.1|  hypothetical protein B456_008G202700                  89.0    1e-17   Gossypium raimondii
gb|KHG28566.1|  E3 ubiquitin-protein ligase RGLG2                     89.0    1e-17   Gossypium arboreum [tree cotton]
emb|CDP12686.1|  unnamed protein product                              89.0    1e-17   Coffea canephora [robusta coffee]
ref|XP_004502384.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  89.0    2e-17   Cicer arietinum [garbanzo]
gb|KHG28565.1|  E3 ubiquitin-protein ligase RGLG2                     89.0    2e-17   Gossypium arboreum [tree cotton]
ref|XP_004502383.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  89.4    2e-17   Cicer arietinum [garbanzo]
ref|XP_009403629.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     88.6    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004138080.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  88.2    2e-17   Cucumis sativus [cucumbers]
gb|KGN63523.1|  hypothetical protein Csa_1G002920                     88.6    2e-17   Cucumis sativus [cucumbers]
gb|AFK35251.1|  unknown                                               88.6    2e-17   Medicago truncatula
ref|XP_003601891.1|  E3 ubiquitin-protein ligase RGLG2                88.6    3e-17   Medicago truncatula
gb|EPS73512.1|  hypothetical protein M569_01244                       87.8    3e-17   Genlisea aurea
gb|AES72144.2|  E3 ubiquitin-protein ligase RGLG2-like protein        88.2    3e-17   Medicago truncatula
gb|AES72143.2|  E3 ubiquitin-protein ligase RGLG2-like protein        88.2    3e-17   Medicago truncatula
ref|XP_003601893.1|  E3 ubiquitin-protein ligase RGLG2                88.6    3e-17   
ref|XP_003601892.1|  E3 ubiquitin-protein ligase RGLG2                88.6    3e-17   
ref|XP_008464499.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  87.0    7e-17   Cucumis melo [Oriental melon]
ref|XP_010912939.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  87.4    7e-17   Elaeis guineensis
ref|XP_008786705.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  87.4    7e-17   Phoenix dactylifera
ref|XP_010026980.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  86.7    9e-17   Eucalyptus grandis [rose gum]
gb|EYU44842.1|  hypothetical protein MIMGU_mgv1a024648mg              85.9    9e-17   Erythranthe guttata [common monkey flower]
ref|XP_007031647.1|  RING domain ligase2 isoform 3                    87.0    9e-17   
ref|XP_009105330.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     85.5    3e-16   Brassica rapa
gb|EEC69114.1|  hypothetical protein OsI_38028                        85.9    3e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_011071995.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  84.7    4e-16   Sesamum indicum [beniseed]
ref|XP_010511738.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  84.3    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010511739.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  84.3    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010470708.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  84.3    7e-16   
ref|XP_010470709.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  84.0    7e-16   Camelina sativa [gold-of-pleasure]
gb|EEE58278.1|  hypothetical protein OsJ_09296                        81.3    7e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010415367.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  84.0    1e-15   Camelina sativa [gold-of-pleasure]
emb|CDY01855.1|  BnaC06g28950D                                        84.0    1e-15   
ref|XP_010415369.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  83.6    1e-15   Camelina sativa [gold-of-pleasure]
emb|CDY56212.1|  BnaAnng14100D                                        83.6    1e-15   Brassica napus [oilseed rape]
ref|XP_010470707.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  84.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010246555.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  82.4    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_002977516.1|  hypothetical protein SELMODRAFT_176218           82.0    3e-15   Selaginella moellendorffii
ref|XP_002972204.1|  hypothetical protein SELMODRAFT_148275           82.0    3e-15   Selaginella moellendorffii
gb|ABK24359.1|  unknown                                               81.6    5e-15   Picea sitchensis
gb|EYU22209.1|  hypothetical protein MIMGU_mgv1a006782mg              81.3    8e-15   Erythranthe guttata [common monkey flower]
ref|XP_010531508.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  81.3    9e-15   
ref|XP_006664503.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  80.9    1e-14   
ref|XP_010250085.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  80.1    1e-14   Nelumbo nucifera [Indian lotus]
ref|NP_001066593.1|  Os12g0288400                                     81.3    1e-14   
ref|XP_010928043.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  79.0    2e-14   Elaeis guineensis
ref|XP_002888625.1|  hypothetical protein ARALYDRAFT_475885           79.7    2e-14   
ref|XP_010252862.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  79.7    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008794750.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  79.3    3e-14   Phoenix dactylifera
ref|XP_003578709.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  79.7    4e-14   Brachypodium distachyon [annual false brome]
ref|XP_006301528.1|  hypothetical protein CARUB_v10021966mg           79.0    4e-14   
ref|XP_010928040.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  79.0    4e-14   Elaeis guineensis
ref|XP_010248244.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  76.6    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010248243.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  76.6    5e-14   Nelumbo nucifera [Indian lotus]
emb|CAE53908.1|  putative RING protein                                76.6    6e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006349743.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  78.6    6e-14   Solanum tuberosum [potatoes]
ref|XP_006349745.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  78.6    6e-14   Solanum tuberosum [potatoes]
ref|XP_004247214.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     78.6    6e-14   Solanum lycopersicum
ref|XP_010928039.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  78.6    6e-14   Elaeis guineensis
gb|KEH35604.1|  E3 ubiquitin-protein ligase RGLG2-like protein        78.6    7e-14   Medicago truncatula
dbj|BAJ99595.1|  predicted protein                                    79.0    7e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006373569.1|  hypothetical protein POPTR_0016s00470g           77.8    7e-14   
gb|AES72894.2|  E3 ubiquitin-protein ligase RGLG2-like protein        78.6    7e-14   Medicago truncatula
ref|XP_003602643.1|  E3 ubiquitin-protein ligase mib1                 78.6    7e-14   
ref|XP_006391217.1|  hypothetical protein EUTSA_v10019546mg           78.6    7e-14   
ref|XP_010649352.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  77.4    7e-14   Vitis vinifera
gb|EYU20648.1|  hypothetical protein MIMGU_mgv1a007011mg              78.2    8e-14   Erythranthe guttata [common monkey flower]
gb|KEH35605.1|  E3 ubiquitin-protein ligase RGLG2-like protein        78.6    8e-14   Medicago truncatula
ref|XP_011005762.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  77.8    8e-14   Populus euphratica
ref|XP_010942537.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  77.8    9e-14   Elaeis guineensis
ref|XP_002963397.1|  hypothetical protein SELMODRAFT_141864           77.8    1e-13   Selaginella moellendorffii
ref|XP_003631930.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  77.4    1e-13   Vitis vinifera
ref|XP_008356226.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  74.3    1e-13   
ref|XP_010649350.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  77.4    1e-13   Vitis vinifera
ref|XP_002266834.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  77.4    1e-13   Vitis vinifera
ref|XP_010649348.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  77.4    1e-13   Vitis vinifera
ref|XP_004962600.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  78.2    1e-13   
ref|XP_008356225.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  74.7    1e-13   
gb|ACR36132.1|  unknown                                               77.8    2e-13   
ref|XP_008227410.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  76.6    2e-13   
ref|XP_009395842.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  77.0    2e-13   
emb|CAN77261.1|  hypothetical protein VITISV_024760                   77.4    2e-13   
gb|EMT09647.1|  E3 ubiquitin-protein ligase RGLG1                     77.0    2e-13   
dbj|BAJ90048.1|  predicted protein                                    76.6    2e-13   
ref|XP_002443815.1|  hypothetical protein SORBIDRAFT_07g002700        76.6    2e-13   
ref|XP_008227408.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  76.6    3e-13   
ref|XP_010247786.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  76.6    3e-13   
ref|XP_002308745.1|  hypothetical protein POPTR_0006s00450g           76.3    3e-13   
ref|XP_009420559.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     76.3    3e-13   
emb|CDP04648.1|  unnamed protein product                              76.6    3e-13   
ref|XP_010270329.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     76.3    3e-13   
ref|XP_002489260.1|  hypothetical protein SORBIDRAFT_0011s003340      71.6    4e-13   
ref|XP_003525130.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  76.3    4e-13   
ref|NP_001150002.1|  copine family protein                            76.6    5e-13   
ref|NP_849857.1|  Copine (Calcium-dependent phospholipid-binding ...  76.3    5e-13   
ref|NP_564907.1|  Copine (Calcium-dependent phospholipid-binding ...  75.9    5e-13   
ref|XP_007212315.1|  hypothetical protein PRUPE_ppa006783mg           75.5    5e-13   
gb|EEE56046.1|  hypothetical protein OsJ_04843                        76.6    5e-13   
ref|XP_002444822.1|  hypothetical protein SORBIDRAFT_07g028640        75.9    5e-13   
ref|XP_007048454.1|  Copine family isoform 5                          75.5    5e-13   
ref|XP_011099706.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     75.9    5e-13   
gb|AFW83898.1|  hypothetical protein ZEAMMB73_890555                  73.2    5e-13   
ref|XP_007048456.1|  Copine (Calcium-dependent phospholipid-bindi...  75.5    6e-13   
ref|XP_007212316.1|  hypothetical protein PRUPE_ppa006783mg           75.5    6e-13   
gb|AFW83897.1|  hypothetical protein ZEAMMB73_890555                  73.2    7e-13   
ref|XP_004502959.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  75.5    7e-13   
ref|XP_011022915.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  75.1    7e-13   
ref|XP_002309925.1|  hypothetical protein POPTR_0007s04370g           75.1    7e-13   
ref|XP_004502961.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  75.5    7e-13   
ref|XP_007048450.1|  Copine family isoform 1                          75.5    7e-13   
ref|XP_007048455.1|  Copine family isoform 6                          75.5    7e-13   
ref|XP_008781601.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  75.1    7e-13   
ref|XP_010027626.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  75.1    7e-13   
ref|XP_008781600.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  75.1    8e-13   
ref|XP_007149161.1|  hypothetical protein PHAVU_005G046500g           74.7    8e-13   
ref|XP_010647336.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  75.1    9e-13   
ref|XP_011465074.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  74.7    9e-13   
gb|EYU27597.1|  hypothetical protein MIMGU_mgv1a006468mg              75.1    1e-12   
ref|XP_006307664.1|  hypothetical protein CARUB_v10009290mg           75.1    1e-12   
ref|XP_009385432.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  75.1    1e-12   
ref|XP_007137784.1|  hypothetical protein PHAVU_009G155300g           75.1    1e-12   
ref|XP_010930718.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  74.7    1e-12   
ref|XP_007137785.1|  hypothetical protein PHAVU_009G155300g           75.1    1e-12   
ref|XP_009340215.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  74.7    1e-12   
ref|XP_003574693.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  74.7    1e-12   
ref|XP_009340213.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  74.7    1e-12   
ref|XP_004288136.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  74.7    1e-12   
emb|CDY27585.1|  BnaA09g28220D                                        71.2    1e-12   
ref|XP_010907788.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     74.3    1e-12   
ref|XP_010052495.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  74.3    2e-12   
ref|XP_007159860.1|  hypothetical protein PHAVU_002G273900g           74.3    2e-12   
ref|NP_001147447.1|  copine-1                                         74.3    2e-12   
ref|XP_008778640.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  73.6    2e-12   
gb|ACR37848.1|  unknown                                               70.9    2e-12   
ref|XP_010419371.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  73.2    2e-12   
ref|XP_006382872.1|  hypothetical protein POPTR_0005s06680g           73.9    2e-12   
ref|XP_006578783.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  73.9    2e-12   
ref|XP_006578782.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  73.9    3e-12   
ref|XP_002306262.2|  hypothetical protein POPTR_0005s06680g           73.6    3e-12   
ref|XP_003523218.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  73.9    3e-12   
gb|KHN31170.1|  E3 ubiquitin-protein ligase RGLG1                     73.9    3e-12   
gb|ACN30862.1|  unknown                                               72.0    3e-12   
ref|XP_002316157.2|  hypothetical protein POPTR_0010s18200g           73.6    3e-12   
gb|KCW67748.1|  hypothetical protein EUGRSUZ_F014791                  73.2    3e-12   
ref|NP_001169415.1|  uncharacterized protein LOC100383284             70.9    3e-12   
gb|KDP35547.1|  hypothetical protein JCGZ_08985                       73.6    3e-12   
ref|XP_010674439.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     73.2    3e-12   
ref|NP_001062128.1|  Os08g0494300                                     73.2    4e-12   
ref|NP_565206.1|  ubiquitin ligase                                    73.2    4e-12   
ref|XP_008778633.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  73.2    4e-12   
ref|XP_010060866.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  73.2    4e-12   
ref|XP_006465084.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  73.6    4e-12   
ref|NP_001183253.1|  hypothetical protein                             73.2    4e-12   
ref|XP_010060865.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  73.2    4e-12   
ref|XP_002525032.1|  copine, putative                                 72.8    5e-12   
ref|XP_010478000.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  73.2    5e-12   
ref|XP_002974682.1|  hypothetical protein SELMODRAFT_102156           72.8    5e-12   
ref|XP_004965913.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  73.2    6e-12   
ref|XP_008650441.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  72.8    6e-12   
ref|XP_010429821.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  72.8    6e-12   
gb|EMT33255.1|  E3 ubiquitin-protein ligase RGLG1                     72.8    7e-12   
ref|XP_003565120.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1     72.4    7e-12   
ref|XP_004973794.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  72.8    7e-12   
gb|EMS57413.1|  E3 ubiquitin-protein ligase RGLG2                     72.4    7e-12   
ref|NP_001045467.1|  Os01g0960500                                     72.4    7e-12   
ref|XP_009387980.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  72.4    8e-12   
ref|XP_008778038.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  71.6    8e-12   
ref|XP_011040112.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  72.4    9e-12   
ref|XP_006415815.1|  hypothetical protein EUTSA_v10007950mg           72.0    9e-12   
ref|XP_004488557.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  72.0    1e-11   
ref|XP_010537822.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     71.6    1e-11   
ref|XP_011096142.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  72.0    1e-11   
ref|XP_010521164.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  71.2    1e-11   
ref|XP_009113808.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  71.6    1e-11   
ref|XP_010521155.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  71.6    1e-11   
gb|KEH38211.1|  E3 ubiquitin-protein ligase RGLG2-like protein        71.6    1e-11   
dbj|BAJ98751.1|  predicted protein                                    71.6    1e-11   
ref|XP_009589140.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  71.6    1e-11   
ref|XP_011014300.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  71.2    2e-11   
ref|XP_011014272.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  71.6    2e-11   
ref|XP_002890706.1|  hypothetical protein ARALYDRAFT_890218           71.6    2e-11   
gb|KJB48933.1|  hypothetical protein B456_008G094400                  70.9    2e-11   
ref|XP_006645358.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  71.2    2e-11   
ref|XP_008462648.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  70.9    2e-11   
ref|XP_009130428.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  70.9    2e-11   
dbj|BAJ90588.1|  predicted protein                                    71.2    2e-11   
ref|XP_004166406.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  70.9    2e-11   
ref|XP_008462645.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  70.9    2e-11   
ref|XP_010419372.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  68.6    2e-11   
emb|CDX84957.1|  BnaC05g20980D                                        70.9    2e-11   
ref|XP_006280668.1|  hypothetical protein CARUB_v10026627mg           70.5    2e-11   
gb|KJB48931.1|  hypothetical protein B456_008G094400                  70.5    2e-11   
ref|XP_002527586.1|  copine, putative                                 68.9    3e-11   
gb|KJB48932.1|  hypothetical protein B456_008G094400                  70.5    3e-11   
ref|XP_004971340.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  70.9    3e-11   
gb|KGN48315.1|  hypothetical protein Csa_6G476060                     70.5    3e-11   
ref|XP_004972924.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.9    3e-11   
ref|XP_009363320.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     70.9    3e-11   
gb|KJB48935.1|  hypothetical protein B456_008G094400                  70.5    3e-11   
gb|KJB48934.1|  hypothetical protein B456_008G094400                  70.5    3e-11   
ref|XP_011013282.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.5    3e-11   
ref|XP_008371961.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     70.9    3e-11   
ref|XP_010472792.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     70.5    3e-11   
gb|AES77117.2|  calcium-dependent phospholipid-binding copine fam...  70.5    3e-11   
ref|XP_004971338.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  70.5    4e-11   
gb|KFK42342.1|  hypothetical protein AALP_AA2G243800                  70.1    4e-11   
ref|XP_009769351.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  70.5    4e-11   
ref|XP_008648442.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.1    4e-11   
ref|XP_002311280.2|  hypothetical protein POPTR_0008s08080g           69.7    4e-11   
ref|XP_006394220.1|  hypothetical protein EUTSA_v10004448mg           70.1    4e-11   
gb|EEC82864.1|  hypothetical protein OsI_27723                        70.1    4e-11   
ref|XP_010260804.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.1    5e-11   
ref|NP_001060941.1|  Os08g0135400                                     70.1    5e-11   
ref|XP_008655372.1|  PREDICTED: hypothetical protein isoform X2       70.1    5e-11   
ref|XP_010499161.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.1    5e-11   
ref|XP_009417357.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.1    5e-11   
ref|XP_010460441.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.1    5e-11   
ref|XP_006422302.1|  hypothetical protein CICLE_v10005036mg           69.3    5e-11   
ref|NP_201202.2|  ring domain ligase 3                                69.7    5e-11   
ref|XP_004516813.1|  PREDICTED: uncharacterized protein LOC101514263  70.5    5e-11   
ref|XP_003563639.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  70.1    5e-11   
gb|KDP31456.1|  hypothetical protein JCGZ_15336                       70.1    5e-11   
ref|XP_009417355.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.7    6e-11   
ref|XP_010484164.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.7    6e-11   
ref|XP_010484162.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.7    7e-11   
ref|XP_006598028.1|  PREDICTED: nuclear-pore anchor-like isoform X3   69.7    7e-11   
ref|XP_010484163.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  69.7    7e-11   
ref|XP_001757898.1|  predicted protein                                69.7    7e-11   
ref|XP_010547672.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  69.3    7e-11   
gb|KHN46289.1|  Nuclear-pore anchor                                   69.7    7e-11   
ref|XP_011095831.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.7    7e-11   
gb|KEH19336.1|  MYND finger protein                                   70.1    7e-11   
ref|XP_009402658.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.7    7e-11   
emb|CDY39835.1|  BnaC02g42830D                                        69.3    7e-11   
ref|XP_004239841.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     69.7    7e-11   
emb|CDX67997.1|  BnaA07g20370D                                        69.3    7e-11   
ref|XP_010461242.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.3    8e-11   
ref|XP_010461228.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.3    8e-11   
ref|XP_009402653.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.7    8e-11   
gb|ACA04848.1|  copine III-like protein                               67.0    8e-11   
ref|XP_006422304.1|  hypothetical protein CICLE_v10005036mg           69.3    8e-11   
ref|XP_006598027.1|  PREDICTED: nuclear-pore anchor-like isoform X2   69.7    8e-11   
ref|XP_006365459.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  69.7    8e-11   
ref|XP_009782421.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     69.7    8e-11   
gb|KDO61520.1|  hypothetical protein CISIN_1g042398mg                 69.3    8e-11   
ref|XP_003571359.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     69.3    9e-11   
ref|XP_006422305.1|  hypothetical protein CICLE_v10005036mg           69.3    9e-11   
ref|XP_003620899.1|  E3 ubiquitin-protein ligase RGLG2                69.3    9e-11   
ref|XP_006598026.1|  PREDICTED: nuclear-pore anchor-like isoform X1   69.3    9e-11   
emb|CBI24136.3|  unnamed protein product                              70.5    1e-10   
ref|XP_011031153.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  68.9    1e-10   
gb|KEH38209.1|  calcium-dependent phospholipid-binding copine fam...  68.9    1e-10   
ref|XP_011031152.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  69.3    1e-10   
ref|XP_011031151.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  69.3    1e-10   
dbj|BAJ95185.1|  predicted protein                                    69.3    1e-10   
ref|XP_006659095.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  68.9    1e-10   
emb|CDX79314.1|  BnaC06g19890D                                        68.9    1e-10   
gb|ACN85314.1|  copine-1                                              69.3    1e-10   
ref|XP_006656233.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  68.9    1e-10   
ref|XP_007133450.1|  hypothetical protein PHAVU_011G179600g           69.3    1e-10   
ref|XP_007133449.1|  hypothetical protein PHAVU_011G179600g           69.3    1e-10   
ref|XP_006389895.1|  hypothetical protein EUTSA_v10018670mg           68.6    1e-10   
ref|XP_006300360.1|  hypothetical protein CARUB_v10022131mg           68.6    1e-10   
ref|XP_002887783.1|  hypothetical protein ARALYDRAFT_477103           68.6    2e-10   
ref|XP_009607653.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     68.2    2e-10   
ref|XP_006365458.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  68.6    2e-10   
gb|ABK24478.1|  unknown                                               68.2    2e-10   
emb|CDP11374.1|  unnamed protein product                              68.2    2e-10   
ref|XP_003620806.1|  E3 ubiquitin-protein ligase mib1                 67.8    3e-10   
ref|XP_008456279.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     68.2    3e-10   
emb|CDX84471.1|  BnaC03g50290D                                        67.8    3e-10   
ref|XP_007022765.1|  Ca(2)-dependent phospholipid-binding protein...  67.8    3e-10   
ref|XP_007022766.1|  Ca(2)-dependent phospholipid-binding protein...  67.8    3e-10   
ref|XP_007133448.1|  hypothetical protein PHAVU_011G179600g           68.2    3e-10   
gb|EPS71527.1|  hypothetical protein M569_03231                       67.4    3e-10   
gb|KJB26961.1|  hypothetical protein B456_004G268600                  67.8    3e-10   
gb|KHG19303.1|  E3 ubiquitin-protein ligase RGLG1                     67.8    3e-10   
ref|XP_009150462.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  67.4    4e-10   
ref|XP_008777949.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  67.0    4e-10   
dbj|BAK07422.1|  predicted protein                                    67.8    4e-10   
ref|XP_009150461.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  67.4    4e-10   
ref|XP_002265556.2|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  67.4    4e-10   
ref|XP_010645087.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  67.0    5e-10   
ref|XP_009368612.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  67.4    5e-10   
ref|XP_008777948.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...  67.0    5e-10   
ref|XP_009340139.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  67.0    5e-10   
gb|ACN85268.1|  copine-1                                              67.4    5e-10   
ref|XP_009368611.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  67.4    5e-10   
ref|XP_009106659.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2     67.0    5e-10   
emb|CDX88533.1|  BnaC06g39770D                                        67.0    5e-10   
gb|EEC80951.1|  hypothetical protein OsI_23663                        67.4    5e-10   
ref|NP_001058043.1|  Os06g0608800                                     67.4    5e-10   
ref|XP_003532904.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  67.4    5e-10   
gb|KEH19334.1|  calcium-dependent phospholipid-binding copine fam...  67.0    6e-10   
gb|AFK47453.1|  unknown                                               67.0    6e-10   
ref|XP_011460563.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  66.6    6e-10   
ref|XP_004293813.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...  67.0    6e-10   



>ref|XP_002526974.1| copine, putative [Ricinus communis]
 gb|EEF35461.1| copine, putative [Ricinus communis]
Length=461

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P+AP S YDNQLCPICLSNPKDMAFGCGHQTCC+CG+ L LCPICRSSIQ RIKLY
Sbjct  405  APTAPSSNYDNQLCPICLSNPKDMAFGCGHQTCCECGESLQLCPICRSSIQMRIKLY  461



>gb|AAX20031.1| RING-finger protein [Capsicum annuum]
Length=484

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -2

Query  438  APVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            AP STYDNQ+CPICL+NPKDMAFGCGHQTCCDCG+ L+ CPICRSSIQTRIKLY
Sbjct  431  APSSTYDNQVCPICLTNPKDMAFGCGHQTCCDCGRALENCPICRSSIQTRIKLY  484



>emb|CDP16621.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 2/67 (3%)
 Frame = -2

Query  471  YYDPRG--EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSI  298
            YYD     +  PSAP STY++QLCPICLSN KDMAFGCGHQTCCDCG++L +CPICRS I
Sbjct  398  YYDHSSSFDAAPSAPSSTYESQLCPICLSNSKDMAFGCGHQTCCDCGQDLHVCPICRSPI  457

Query  297  QTRIKLY  277
            QTRIKLY
Sbjct  458  QTRIKLY  464



>ref|XP_006646587.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Oryza brachyantha]
Length=397

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +Y+     TP+AP STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L  CPICR+ I T
Sbjct  333  HYESAQSATPAAPSSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQTLGTCPICRTPIST  392

Query  291  RIKLY  277
            RIKLY
Sbjct  393  RIKLY  397



>ref|XP_011101825.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Sesamum indicum]
Length=372

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            YY+       + P+STY++Q+CPICLSNPKDMAFGCGHQTCCDCG++L LCPICRS IQT
Sbjct  308  YYEHNVPVDAAPPISTYEHQICPICLSNPKDMAFGCGHQTCCDCGQDLQLCPICRSPIQT  367

Query  291  RIKLY  277
            RIKLY
Sbjct  368  RIKLY  372



>ref|XP_009370343.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
 ref|XP_009370344.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
Length=463

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+IQTRIKLY
Sbjct  407  APPAPSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQSCPICRSAIQTRIKLY  463



>gb|EYU44849.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
 gb|EYU44850.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
Length=460

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P+AP STY++Q+CPICLSNPKDMAFGCGHQTCC+CG++L LCPICRS I+TRIKLY
Sbjct  404  APTAPSSTYEHQICPICLSNPKDMAFGCGHQTCCECGQDLQLCPICRSRIETRIKLY  460



>ref|XP_006338634.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Solanum tuberosum]
Length=485

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +AP STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG+ L+ CPICRSSIQTRIKLY
Sbjct  431  TAPSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGRALENCPICRSSIQTRIKLY  485



>ref|XP_008230495.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Prunus mume]
Length=460

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+IQTRIKLY
Sbjct  404  APPAPSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQSCPICRSAIQTRIKLY  460



>ref|NP_001266128.1| E3 ubiquitin-protein ligase RGLG2-like [Solanum lycopersicum]
 ref|XP_010315864.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Solanum lycopersicum]
 gb|AGL95793.1| RING-finger protein [Solanum lycopersicum]
Length=492

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +AP STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG+ L+ CPICRSSIQTRIKLY
Sbjct  438  TAPSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGRALENCPICRSSIQTRIKLY  492



>ref|XP_009371747.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Pyrus x bretschneideri]
Length=463

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+IQTRIKLY
Sbjct  407  APPAPSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQSCPICRSAIQTRIKLY  463



>ref|XP_011101822.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
 ref|XP_011101823.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
 ref|XP_011101824.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
Length=464

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            YY+       + P+STY++Q+CPICLSNPKDMAFGCGHQTCCDCG++L LCPICRS IQT
Sbjct  400  YYEHNVPVDAAPPISTYEHQICPICLSNPKDMAFGCGHQTCCDCGQDLQLCPICRSPIQT  459

Query  291  RIKLY  277
            RIKLY
Sbjct  460  RIKLY  464



>ref|XP_008341364.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
 ref|XP_008341365.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
 ref|XP_008341366.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
Length=463

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+IQTRIKLY
Sbjct  407  APPAPSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQSCPICRSAIQTRIKLY  463



>ref|XP_011097361.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
 ref|XP_011097362.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
 ref|XP_011097363.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
Length=474

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  456  GEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             +  PSAP STY++Q+CPICLS+PKDMAFGCGHQTCC+CG+EL LCPICRS I+TRIKLY
Sbjct  415  ADAAPSAPSSTYEHQICPICLSSPKDMAFGCGHQTCCECGRELQLCPICRSPIETRIKLY  474



>ref|XP_010089180.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
 gb|EXB37451.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
Length=472

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP STYDNQ+CPICLSNPKDMAFGCGHQTCC+CG++L+ CPICRS + TRIKLY
Sbjct  416  APPAPTSTYDNQVCPICLSNPKDMAFGCGHQTCCECGRDLETCPICRSPVNTRIKLY  472



>ref|XP_003622329.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES78547.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=445

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP STYDNQLCPICL+N KDMAFGCGHQTCC+CGKEL  CPICRS I TRIKLY
Sbjct  389  APSAPSSTYDNQLCPICLTNTKDMAFGCGHQTCCECGKELKSCPICRSCINTRIKLY  445



>ref|XP_010420077.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010420078.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
Length=464

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P P+A  S  DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTR
Sbjct  401  YQVRSNPAPTATSSASDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTR  460

Query  288  IKLY  277
            IKLY
Sbjct  461  IKLY  464



>ref|XP_008797006.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008797015.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=454

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD      P+AP ++ DNQLCPIC +NPKDMAFGCGHQTCCDCG+ L+LCPICRS I TR
Sbjct  391  YDTTPRTAPTAPSASTDNQLCPICFTNPKDMAFGCGHQTCCDCGQSLELCPICRSQIHTR  450

Query  288  IKLY  277
            IKLY
Sbjct  451  IKLY  454



>ref|XP_007215340.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 ref|XP_007215341.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 gb|EMJ16539.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 gb|EMJ16540.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
Length=465

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP S+YDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+IQTRIKLY
Sbjct  409  APPAPSSSYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQSCPICRSAIQTRIKLY  465



>ref|XP_006287684.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 gb|EOA20582.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
Length=466

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P P+A  S  DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTR
Sbjct  403  YQVRSSPAPTATNSASDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTR  462

Query  288  IKLY  277
            IKLY
Sbjct  463  IKLY  466



>tpg|DAA56239.1| TPA: hypothetical protein ZEAMMB73_877987 [Zea mays]
Length=461

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TP+AP STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPICR+ I TRIKLY
Sbjct  405  TPAAPSSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQSLESCPICRTPITTRIKLY  461



>tpg|DAA56240.1| TPA: hypothetical protein ZEAMMB73_877987 [Zea mays]
Length=460

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TP+AP STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPICR+ I TRIKLY
Sbjct  404  TPAAPSSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQSLESCPICRTPITTRIKLY  460



>ref|NP_001045146.1| Os01g0908700 [Oryza sativa Japonica Group]
 dbj|BAD82758.1| copine III-like [Oryza sativa Japonica Group]
 dbj|BAD82322.1| copine III-like [Oryza sativa Japonica Group]
 dbj|BAF07060.1| Os01g0908700 [Oryza sativa Japonica Group]
Length=446

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +Y+     +P+ P STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPICRS I T
Sbjct  382  HYETAQSSSPAVPSSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQSLESCPICRSPIST  441

Query  291  RIKLY  277
            RIKLY
Sbjct  442  RIKLY  446



>ref|NP_001146212.1| uncharacterized protein LOC100279782 [Zea mays]
 gb|ACL53475.1| unknown [Zea mays]
 gb|ACL54587.1| unknown [Zea mays]
Length=460

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TP+AP STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPICR+ I TRIKLY
Sbjct  404  TPAAPSSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQSLESCPICRTPITTRIKLY  460



>ref|XP_007222138.1| hypothetical protein PRUPE_ppa005724mg [Prunus persica]
 gb|EMJ23337.1| hypothetical protein PRUPE_ppa005724mg [Prunus persica]
Length=446

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD  G  TPS   + YD+Q+CPICL+NPKDMAFGCGHQTCCDCG+ L+LCPICRSSIQTR
Sbjct  385  YDNAGASTPS--YTGYDSQVCPICLTNPKDMAFGCGHQTCCDCGEYLELCPICRSSIQTR  442

Query  288  IKLY  277
            I+LY
Sbjct  443  IRLY  446



>ref|XP_002458953.1| hypothetical protein SORBIDRAFT_03g043290 [Sorghum bicolor]
 gb|EES04073.1| hypothetical protein SORBIDRAFT_03g043290 [Sorghum bicolor]
Length=459

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +Y+     TP AP STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPICR+ I T
Sbjct  395  HYETPHTATPVAPSSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQSLESCPICRTPITT  454

Query  291  RIKLY  277
            RIKLY
Sbjct  455  RIKLY  459



>ref|XP_011005559.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005560.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005561.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005562.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005563.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
Length=443

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = -2

Query  468  YDPRGEPTPSAPV---STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSI  298
            Y    +P  SAP    STYDNQLCPICLSN KDMAFGCGHQTCCDCG+ L LCPICRSSI
Sbjct  377  YQRDSQPFSSAPPATCSTYDNQLCPICLSNSKDMAFGCGHQTCCDCGETLQLCPICRSSI  436

Query  297  QTRIKLY  277
            +TRIKL+
Sbjct  437  ETRIKLF  443



>gb|ABG34341.1| copine-like protein [Oryza sativa Japonica Group]
Length=475

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +Y+     +P+ P STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPICRS I T
Sbjct  411  HYETAQSSSPAVPSSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQSLESCPICRSPIST  470

Query  291  RIKLY  277
            RIKLY
Sbjct  471  RIKLY  475



>ref|XP_008221938.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Prunus mume]
Length=445

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD  G  TPS   + YD+Q+CPICL+NPKDMAFGCGHQTCCDCG+ L+LCPICRSSIQTR
Sbjct  384  YDNAGASTPS--YTGYDSQVCPICLTNPKDMAFGCGHQTCCDCGEYLELCPICRSSIQTR  441

Query  288  IKLY  277
            I+LY
Sbjct  442  IRLY  445



>ref|XP_010932261.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
 ref|XP_010932262.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
Length=456

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD      P+AP ++ DNQLCPIC +NPKDMAFGCGHQTCCDCG+ L+LCPICRS I TR
Sbjct  393  YDTAPSAAPTAPSASLDNQLCPICFTNPKDMAFGCGHQTCCDCGQSLELCPICRSVIHTR  452

Query  288  IKLY  277
            I+LY
Sbjct  453  IRLY  456



>ref|XP_008357726.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RGLG2-like 
[Malus domestica]
Length=486

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PSAP STYD+Q+CPICL+N KDMAFGCGHQTCCDCG++L  CPICR++IQTRIKLY
Sbjct  431  PSAPSSTYDHQVCPICLTNSKDMAFGCGHQTCCDCGQDLHSCPICRTTIQTRIKLY  486



>ref|XP_010927544.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Elaeis guineensis]
Length=443

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD      P+AP ++ DNQLCPIC +NPKDMAFGCGHQTCCDCG+ L+LCPICRS I TR
Sbjct  380  YDTTPGRAPTAPSASLDNQLCPICFTNPKDMAFGCGHQTCCDCGEGLELCPICRSQIHTR  439

Query  288  IKLY  277
            IKLY
Sbjct  440  IKLY  443



>ref|XP_010927542.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010927543.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Elaeis guineensis]
Length=454

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD      P+AP ++ DNQLCPIC +NPKDMAFGCGHQTCCDCG+ L+LCPICRS I TR
Sbjct  391  YDTTPGRAPTAPSASLDNQLCPICFTNPKDMAFGCGHQTCCDCGEGLELCPICRSQIHTR  450

Query  288  IKLY  277
            IKLY
Sbjct  451  IKLY  454



>ref|XP_006399953.1| hypothetical protein EUTSA_v10013466mg [Eutrema salsugineum]
 gb|ESQ41406.1| hypothetical protein EUTSA_v10013466mg [Eutrema salsugineum]
Length=465

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P P A  S  DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTR
Sbjct  402  YPVRSSPMPPATTSASDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTR  461

Query  288  IKLY  277
            IKLY
Sbjct  462  IKLY  465



>ref|XP_008379181.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
 ref|XP_008379182.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
Length=484

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PSAP STYD+Q+CPICL+N KDMAFGCGHQTCCDCG++L  CPICR++IQTRIKLY
Sbjct  429  PSAPSSTYDHQVCPICLTNSKDMAFGCGHQTCCDCGQDLHSCPICRTTIQTRIKLY  484



>ref|XP_010453560.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
 ref|XP_010453561.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
 ref|XP_010453562.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
Length=464

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P P A  S  DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTR
Sbjct  401  YQVRSNPAPPATSSGSDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTR  460

Query  288  IKLY  277
            IKLY
Sbjct  461  IKLY  464



>ref|XP_009125973.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009125974.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009125975.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 emb|CDX85597.1| BnaA02g02160D [Brassica napus]
Length=451

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P P A  S  DNQ+CPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTR
Sbjct  388  YTVRSSPAPPATTSASDNQICPICLSNPKDMAFGCGHQTCCECGPDLQVCPICRAPIQTR  447

Query  288  IKLY  277
            IKLY
Sbjct  448  IKLY  451



>ref|XP_004970988.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Setaria italica]
Length=464

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +Y+     TP AP STYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L  CPICR+ I T
Sbjct  400  HYENPHSATPVAPTSTYDNQVCPICLVNPKDMAFGCGHQTCCDCGQSLGSCPICRTPITT  459

Query  291  RIKLY  277
            RIKLY
Sbjct  460  RIKLY  464



>emb|CDX91062.1| BnaC02g05350D [Brassica napus]
Length=452

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P P A  S  DN++CPICLSNPKDMAFGCGHQTCCDCG +L +CPICR+ IQTR
Sbjct  389  YTVRSSPAPPATTSASDNRICPICLSNPKDMAFGCGHQTCCDCGPDLQVCPICRAPIQTR  448

Query  288  IKLY  277
            IKLY
Sbjct  449  IKLY  452



>ref|XP_004156734.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like, partial [Cucumis 
sativus]
Length=288

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 3/61 (5%)
 Frame = -2

Query  450  PTPSAP---VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKL  280
            PT +AP    STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+I TRIKL
Sbjct  228  PTSTAPPVASSTYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQTCPICRSTIHTRIKL  287

Query  279  Y  277
            Y
Sbjct  288  Y  288



>ref|XP_003618769.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES74987.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=486

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP STY+NQLCPICLSN KDMAFGCGHQTCC+CG++L  CPICRS I TRIKLY
Sbjct  430  APSAPSSTYENQLCPICLSNEKDMAFGCGHQTCCECGQDLQTCPICRSPINTRIKLY  486



>ref|XP_004309992.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Fragaria vesca 
subsp. vesca]
Length=433

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S P STYDNQ+CPICL+NPKDMAFGCGHQTCCDCG+ L  CPICRSSI+TRIKL+
Sbjct  379  SPPYSTYDNQVCPICLTNPKDMAFGCGHQTCCDCGEYLQACPICRSSIETRIKLF  433



>ref|XP_009778227.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 ref|XP_009778228.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 gb|AGL95792.1| RING-finger protein [Nicotiana tabacum]
Length=486

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = -2

Query  444  PSAPVS-TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PSA  S TYDNQ+CPICL+NPKDMAFGCGHQTCC+CG+ L+ CPICRSSIQTRIKLY
Sbjct  430  PSATTSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGRALENCPICRSSIQTRIKLY  486



>gb|AFW84239.1| hypothetical protein ZEAMMB73_082799 [Zea mays]
Length=485

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +Y+     TP+AP +TYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPICR+ I T
Sbjct  421  HYETPHTATPAAPSATYDNQVCPICLVNPKDMAFGCGHQTCCDCGQILESCPICRTPITT  480

Query  291  RIKLY  277
            RIKLY
Sbjct  481  RIKLY  485



>ref|XP_009599491.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nicotiana tomentosiformis]
 ref|XP_009599492.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nicotiana tomentosiformis]
Length=485

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = -2

Query  444  PSAPVS-TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PSA  S TYDNQ+CPICL+NPKDMAFGCGHQTCC+CG+ L+ CPICRSSIQTRIKLY
Sbjct  429  PSATTSSTYDNQVCPICLTNPKDMAFGCGHQTCCECGRALENCPICRSSIQTRIKLY  485



>ref|XP_003564886.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brachypodium distachyon]
Length=464

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TP+AP S YDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L  CPICR+ I TRIKLY
Sbjct  408  TPAAPSSAYDNQVCPICLVNPKDMAFGCGHQTCCDCGQTLQSCPICRTPISTRIKLY  464



>ref|XP_004142779.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 gb|KGN51346.1| hypothetical protein Csa_5G522920 [Cucumis sativus]
Length=447

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 3/61 (5%)
 Frame = -2

Query  450  PTPSAP---VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKL  280
            PT +AP    STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+I TRIKL
Sbjct  387  PTSTAPPVASSTYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQTCPICRSTIHTRIKL  446

Query  279  Y  277
            Y
Sbjct  447  Y  447



>ref|XP_008458835.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458837.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458838.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458839.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
Length=447

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 3/61 (5%)
 Frame = -2

Query  450  PTPSAP---VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKL  280
            PT +AP    STYDNQ+CPICL+NPKDMAFGCGHQTCC+CG++L  CPICRS+I TRIKL
Sbjct  387  PTSTAPPVASSTYDNQVCPICLTNPKDMAFGCGHQTCCECGQDLQTCPICRSAIHTRIKL  446

Query  279  Y  277
            Y
Sbjct  447  Y  447



>ref|XP_003524729.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Glycine 
max]
 ref|XP_006579982.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Glycine 
max]
 gb|KHN42754.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=491

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 53/67 (79%), Gaps = 2/67 (3%)
 Frame = -2

Query  471  YYDPRG--EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSI  298
            YYD R      P AP STYDNQLCPICL+N KDMAFGCGHQTCC+CG++L  CPICRS I
Sbjct  425  YYDNRDLVGTAPPAPSSTYDNQLCPICLTNSKDMAFGCGHQTCCECGQDLQSCPICRSPI  484

Query  297  QTRIKLY  277
             TRIKLY
Sbjct  485  NTRIKLY  491



>ref|XP_002298557.2| hypothetical protein POPTR_0001s35660g [Populus trichocarpa]
 gb|EEE83362.2| hypothetical protein POPTR_0001s35660g [Populus trichocarpa]
Length=447

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = -2

Query  468  YDPRGEPTPSAPV---STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSI  298
            Y    +P  SAP    STYDNQLCPICLSN KDMAFGCGHQTCC+CG+ L LCPICRS+I
Sbjct  381  YQRDSQPFSSAPPATCSTYDNQLCPICLSNSKDMAFGCGHQTCCECGETLQLCPICRSTI  440

Query  297  QTRIKLY  277
            +TRIKL+
Sbjct  441  ETRIKLF  447



>ref|XP_010492244.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492245.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492246.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492247.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
Length=470

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P  +A  S  DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTR
Sbjct  407  YQVRSNPAQTATNSANDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTR  466

Query  288  IKLY  277
            IKLY
Sbjct  467  IKLY  470



>gb|KHN14880.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=290

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -2

Query  465  DPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            DP G   P AP S+YDNQLCPICL+N KDMAFGCGHQTCC+CG++L  CPICRS I TRI
Sbjct  229  DPVGT-APPAPSSSYDNQLCPICLTNSKDMAFGCGHQTCCECGQDLQSCPICRSPINTRI  287

Query  285  KLY  277
            KLY
Sbjct  288  KLY  290



>ref|XP_004236287.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Solanum lycopersicum]
 ref|XP_010319032.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Solanum lycopersicum]
Length=437

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S P S+ DNQLCPIC++NPKDMAFGCGHQTCC+CG++L LCPICR SIQTRIKLY
Sbjct  383  SHPASSADNQLCPICITNPKDMAFGCGHQTCCECGQDLLLCPICRDSIQTRIKLY  437



>ref|XP_006351421.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Solanum tuberosum]
 ref|XP_006351422.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Solanum tuberosum]
Length=439

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S P S+ DNQLCPIC++NPKDMAFGCGHQTCC+CG++L LCPICR SIQTRI+LY
Sbjct  385  SHPASSADNQLCPICITNPKDMAFGCGHQTCCECGQDLQLCPICRDSIQTRIRLY  439



>gb|KHN34573.1| E3 ubiquitin-protein ligase RGLG1, partial [Glycine soja]
Length=348

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP STYDNQLCPICLSN KDMAFGCGHQTCC+CG++L  CP+ RS I TRIKLY
Sbjct  292  APSAPSSTYDNQLCPICLSNAKDMAFGCGHQTCCECGQDLQSCPMYRSPINTRIKLY  348



>ref|XP_003548557.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Glycine max]
Length=426

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP STYDNQLCPICLSN KDMAFGCGHQTCC+CG++L  CP+CRS I  RI+LY
Sbjct  370  APSAPSSTYDNQLCPICLSNAKDMAFGCGHQTCCECGQDLQSCPMCRSPINARIRLY  426



>gb|KHN27569.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=426

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP STYDNQLCPICLSN KDMAFGCGHQTCC+CG++L  CP+CRS I  RI+LY
Sbjct  370  APSAPSSTYDNQLCPICLSNAKDMAFGCGHQTCCECGQDLQSCPMCRSPINARIRLY  426



>ref|XP_010524289.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Tarenaya hassleriana]
Length=430

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P  P STYD+QLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICRS I TRI+LY
Sbjct  374  APPVPSSTYDDQLCPICLSNPKDMAFGCGHQTCCECGPDLHVCPICRSPIHTRIRLY  430



>gb|KHN00030.1| E3 ubiquitin-protein ligase RGLG1 [Glycine soja]
Length=428

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP ST DNQLCPICLSN KDMAFGCGHQTCC+CG++L  CP+CRS I TRIKLY
Sbjct  372  APSAPSSTSDNQLCPICLSNAKDMAFGCGHQTCCECGQDLQSCPMCRSPINTRIKLY  428



>emb|CDX78576.1| BnaA03g04880D [Brassica napus]
Length=471

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPTPS-APVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            Y  R  P P  A +S  DNQLCPICLS+PKDMAFGCGHQTCCDCG +L++CPICR+ IQT
Sbjct  407  YPVRSSPAPPPATISASDNQLCPICLSSPKDMAFGCGHQTCCDCGPDLEMCPICRAPIQT  466

Query  291  RIKLY  277
            RIKLY
Sbjct  467  RIKLY  471



>ref|XP_003555130.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006604100.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006604101.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 ref|XP_006604102.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Glycine max]
 ref|XP_006604103.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X5 
[Glycine max]
 ref|XP_006604104.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X6 
[Glycine max]
Length=428

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP ST DNQLCPICLSN KDMAFGCGHQTCC+CG++L  CP+CRS I TRIKLY
Sbjct  372  APSAPSSTSDNQLCPICLSNAKDMAFGCGHQTCCECGQDLQSCPMCRSPINTRIKLY  428



>ref|XP_003553280.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006603981.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006603982.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
Length=496

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -2

Query  465  DPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            DP G   P AP S+YDNQLCPICL+N KDMAFGCGHQTCC+CG++L  CPICRS I TRI
Sbjct  435  DPVGT-APPAPSSSYDNQLCPICLTNSKDMAFGCGHQTCCECGQDLQSCPICRSPINTRI  493

Query  285  KLY  277
            KLY
Sbjct  494  KLY  496



>ref|XP_008340126.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
Length=457

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -2

Query  435  PVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            P + YD+Q+CPICL+NPKDMAFGCGHQTCCDCGK+L+ CPICRS+IQTRI+LY
Sbjct  405  PYTGYDSQVCPICLTNPKDMAFGCGHQTCCDCGKDLESCPICRSNIQTRIRLY  457



>ref|XP_010029085.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
 gb|KCW55925.1| hypothetical protein EUGRSUZ_I01722 [Eucalyptus grandis]
Length=515

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = -2

Query  465  DPRGEPT-PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            D R  PT PSAP +T D+QLCPIC +N KDMAFGCGHQTCC+CG++L LCPICRSSI TR
Sbjct  452  DSRPTPTAPSAPSATNDDQLCPICFTNKKDMAFGCGHQTCCECGQDLQLCPICRSSIITR  511

Query  288  IKLY  277
            IKLY
Sbjct  512  IKLY  515



>ref|XP_010029080.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029081.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029082.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029084.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW55926.1| hypothetical protein EUGRSUZ_I01722 [Eucalyptus grandis]
Length=516

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = -2

Query  465  DPRGEPT-PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            D R  PT PSAP +T D+QLCPIC +N KDMAFGCGHQTCC+CG++L LCPICRSSI TR
Sbjct  453  DSRPTPTAPSAPSATNDDQLCPICFTNKKDMAFGCGHQTCCECGQDLQLCPICRSSIITR  512

Query  288  IKLY  277
            IKLY
Sbjct  513  IKLY  516



>ref|XP_008446129.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008446130.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
Length=435

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 3/58 (5%)
 Frame = -2

Query  450  PTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            P+ S+P   YDNQLCPIC++NPKDMAFGCGH TCCDCG+ L+LCPICRS IQTRI+LY
Sbjct  381  PSSSSP---YDNQLCPICITNPKDMAFGCGHMTCCDCGENLELCPICRSFIQTRIRLY  435



>ref|XP_009608151.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
tomentosiformis]
 ref|XP_009608152.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
tomentosiformis]
Length=432

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S P S+ DN LCPIC++NPKDMAFGCGHQTCC+CG++L LCPICR SIQTRI+LY
Sbjct  378  SHPASSADNHLCPICITNPKDMAFGCGHQTCCECGQDLQLCPICRDSIQTRIRLY  432



>ref|XP_009795957.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 ref|XP_009795958.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
Length=432

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S P S+ DN LCPIC++NPKDMAFGCGHQTCC+CG++L LCPICR SIQTRI+LY
Sbjct  378  SHPASSADNHLCPICITNPKDMAFGCGHQTCCECGQDLQLCPICRDSIQTRIRLY  432



>ref|XP_010033345.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
Length=368

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDNQ+CPICLSNPKDMAF CGHQTCC+CG++L LCPICRS IQTRIKLY
Sbjct  320  YDNQICPICLSNPKDMAFACGHQTCCECGEDLQLCPICRSPIQTRIKLY  368



>gb|KDP26671.1| hypothetical protein JCGZ_17829 [Jatropha curcas]
Length=466

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 2/60 (3%)
 Frame = -2

Query  450  PTPSAPVS--TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            P  +AP S  TYDNQ+CPICL+N KDMAFGCGHQTCC+CG++L LCPICRS IQTRI+LY
Sbjct  407  PVNTAPYSSSTYDNQVCPICLTNKKDMAFGCGHQTCCECGEDLQLCPICRSPIQTRIRLY  466



>ref|NP_001145987.1| uncharacterized protein LOC100279516 [Zea mays]
 gb|ACL52986.1| unknown [Zea mays]
Length=485

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +Y+     TP+AP +TYDNQ+CPICL NPKDMAFGCGHQTCCDCG+ L+ CPIC + I T
Sbjct  421  HYETPHTATPAAPSATYDNQVCPICLVNPKDMAFGCGHQTCCDCGQILESCPICPTPITT  480

Query  291  RIKLY  277
            RIKLY
Sbjct  481  RIKLY  485



>ref|XP_004304674.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468321.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Fragaria vesca 
subsp. vesca]
Length=483

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P A  STYDNQ+CPICL+N KDMAFGCGHQTCC+CG++L  CPICRS IQTRIKLY
Sbjct  427  APPATSSTYDNQVCPICLTNSKDMAFGCGHQTCCECGQDLQTCPICRSPIQTRIKLY  483



>ref|XP_010033344.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
Length=435

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 2/67 (3%)
 Frame = -2

Query  471  YYDPRGE--PTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSI  298
            YY+ +G    TP A  STYDNQ+CPICLSNPKDMAF CGHQTCC+CG++L LCPICRS I
Sbjct  369  YYESKGHVTATPPATTSTYDNQICPICLSNPKDMAFACGHQTCCECGEDLQLCPICRSPI  428

Query  297  QTRIKLY  277
            QTRIKLY
Sbjct  429  QTRIKLY  435



>ref|XP_002315654.1| hypothetical protein POPTR_0010s05940g [Populus trichocarpa]
 gb|EEF01825.1| hypothetical protein POPTR_0010s05940g [Populus trichocarpa]
Length=403

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  438  APVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +P S YDNQ+C ICL+NPKDMAFGCGHQTCCDCG++L LCPICR  IQTRI+LY
Sbjct  350  SPSSVYDNQVCVICLTNPKDMAFGCGHQTCCDCGEDLQLCPICRRPIQTRIRLY  403



>gb|KJB11578.1| hypothetical protein B456_001G266800 [Gossypium raimondii]
 gb|KJB11579.1| hypothetical protein B456_001G266800 [Gossypium raimondii]
Length=448

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  450  PTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PTPSAP+S YD+QLCPICL N KDMAFGCGHQTC  C K+L+ CPICRSSI T++KLY
Sbjct  390  PTPSAPISIYDSQLCPICLDNSKDMAFGCGHQTCEGCSKDLETCPICRSSIGTKLKLY  447



>gb|KJB61002.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61003.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61004.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61005.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61006.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61007.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61008.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61009.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
Length=468

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S YD+Q+CPICL NPKDMAFGCGHQTCCDCG++L +CPICRS+IQTRI+LY
Sbjct  418  SLYDHQICPICLGNPKDMAFGCGHQTCCDCGEDLQICPICRSAIQTRIRLY  468



>emb|CDY09854.1| BnaC09g43070D [Brassica napus]
Length=466

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPT-PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            Y  R  P  P+   S +DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ I T
Sbjct  402  YPVRSSPAQPATTTSAFDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIHT  461

Query  291  RIKLY  277
            RIKLY
Sbjct  462  RIKLY  466



>ref|XP_007044867.1| Copine family isoform 1 [Theobroma cacao]
 ref|XP_007044868.1| Copine family isoform 1 [Theobroma cacao]
 ref|XP_007044869.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00699.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00700.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00701.1| Copine family isoform 1 [Theobroma cacao]
Length=467

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YD+Q+CPICL NPKDMAFGCGHQTCCDCG++L LCPICRS+IQTRI+LY
Sbjct  419  YDHQVCPICLGNPKDMAFGCGHQTCCDCGEDLQLCPICRSTIQTRIRLY  467



>emb|CDX70564.1| BnaC03g06480D [Brassica napus]
Length=471

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPTPS-APVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            Y  R  P P  A  S  +NQLCPICLSNPKDMAFGCGHQTCC+CG +L++CPICR+ IQT
Sbjct  407  YPVRSSPAPPPATTSASENQLCPICLSNPKDMAFGCGHQTCCECGPDLEMCPICRAPIQT  466

Query  291  RIKLY  277
            RIKLY
Sbjct  467  RIKLY  471



>gb|KHN30970.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=203

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQ+CPICL++PKDMAFGCGHQTCCDCG++L+LCPICRS+I TRIKLY
Sbjct  152  TSASDNQVCPICLTDPKDMAFGCGHQTCCDCGQDLELCPICRSTIDTRIKLY  203



>ref|XP_010033343.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW52956.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
 gb|KCW52957.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
Length=446

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDNQ+CPICLSNPKDMAF CGHQTCC+CG++L LCPICRS IQTRIKLY
Sbjct  398  YDNQICPICLSNPKDMAFACGHQTCCECGEDLQLCPICRSPIQTRIKLY  446



>ref|XP_008807474.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008807475.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008807476.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=468

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +DNQLCPICL++PKDMAFGCGHQTCCDCG+ LDLCPICRS I TRIKLY
Sbjct  420  WDNQLCPICLTSPKDMAFGCGHQTCCDCGQSLDLCPICRSQIYTRIKLY  468



>ref|XP_002511290.1| copine, putative [Ricinus communis]
 gb|EEF51892.1| copine, putative [Ricinus communis]
Length=433

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN LCPICL+N KDMAFGCGHQTCCDCG++L LCPICRSSI TRIKLY
Sbjct  383  STSDNHLCPICLTNAKDMAFGCGHQTCCDCGQDLQLCPICRSSINTRIKLY  433



>ref|XP_009121662.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
 ref|XP_009121663.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
 ref|XP_009121664.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
Length=466

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPTPSAPV-STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            Y  R  P P A   S  DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ I T
Sbjct  402  YSVRSSPAPPATTTSASDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIHT  461

Query  291  RIKLY  277
            RIKLY
Sbjct  462  RIKLY  466



>ref|XP_002873665.1| hypothetical protein ARALYDRAFT_488284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49924.1| hypothetical protein ARALYDRAFT_488284 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y  R  P P    S  DNQLCPICLSNPKDMAFGCGHQTCC+CG  L +CPICR+ I TR
Sbjct  403  YHVRSSPVPPPTNSASDNQLCPICLSNPKDMAFGCGHQTCCECGPGLQMCPICRAPIHTR  462

Query  288  IKLY  277
            IKLY
Sbjct  463  IKLY  466



>ref|XP_009131405.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Brassica 
rapa]
Length=471

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPTPS-APVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            Y  R  P P  A  S  DNQLCPICLS+PKDMAFGCGHQTCC+CG +L++CPICR+ IQT
Sbjct  407  YPVRSSPAPPPATTSASDNQLCPICLSSPKDMAFGCGHQTCCECGPDLEMCPICRAPIQT  466

Query  291  RIKLY  277
            RIKLY
Sbjct  467  RIKLY  471



>gb|KDO69443.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=333

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PKDMAFGCGHQTCC CG++LDLCPICRS IQTRIKLY
Sbjct  283  STSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY  333



>ref|XP_009131403.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Brassica 
rapa]
Length=472

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPTPS-APVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            Y  R  P P  A  S  DNQLCPICLS+PKDMAFGCGHQTCC+CG +L++CPICR+ IQT
Sbjct  408  YPVRSSPAPPPATTSASDNQLCPICLSSPKDMAFGCGHQTCCECGPDLEMCPICRAPIQT  467

Query  291  RIKLY  277
            RIKLY
Sbjct  468  RIKLY  472



>ref|XP_006483979.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
 ref|XP_006483980.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
Length=453

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T S+  S YDNQLCPICL NPKDMAFGCGHQTCC+CG++L  CPICR+ IQTRI+LY
Sbjct  397  TASSSSSFYDNQLCPICLGNPKDMAFGCGHQTCCECGEDLQSCPICRTPIQTRIRLY  453



>gb|KCW59704.1| hypothetical protein EUGRSUZ_H02465 [Eucalyptus grandis]
Length=456

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = -2

Query  447  TPSAPVSTY--DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +PSAP S+Y  +N  CPIC +NPKDMAFGCGHQTCC+CG  L+LCPICRSSI TRIKLY
Sbjct  398  SPSAPTSSYRNENHACPICFTNPKDMAFGCGHQTCCECGDGLELCPICRSSIHTRIKLY  456



>ref|XP_007137991.1| hypothetical protein PHAVU_009G171800g [Phaseolus vulgaris]
 gb|ESW09985.1| hypothetical protein PHAVU_009G171800g [Phaseolus vulgaris]
Length=428

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            +D R  P  +   S  DNQ+CPICL+NPKDMAFGCGHQTCC+CG++L+LCPICRS+I TR
Sbjct  368  HDVRSNPPAT---SASDNQVCPICLTNPKDMAFGCGHQTCCECGQDLELCPICRSTIDTR  424

Query  288  IKLY  277
            IKLY
Sbjct  425  IKLY  428



>gb|KEH35020.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=435

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S  DNQ CPICL+NPKDMAFGCGHQTCC+CG++L LCPICRSSI TRIKLY
Sbjct  385  SASDNQFCPICLTNPKDMAFGCGHQTCCECGQDLQLCPICRSSINTRIKLY  435



>ref|XP_010927546.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Elaeis guineensis]
Length=349

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDN-QLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +D   E   + P  ++DN QLCPIC +NPKDMAFGCGHQTCCDCG+ L+LCPICRS I T
Sbjct  285  WDMMKEFDDNIPARSFDNFQLCPICFTNPKDMAFGCGHQTCCDCGEGLELCPICRSQIHT  344

Query  291  RIKLY  277
            RIKLY
Sbjct  345  RIKLY  349



>ref|XP_006438208.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 ref|XP_006438210.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 ref|XP_006438211.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51448.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51450.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51451.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
Length=453

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T S+  S YDNQLCPICL NPKDMAFGCGHQTCC+CG++L  CPICR+ IQTRI+LY
Sbjct  397  TASSSSSFYDNQLCPICLGNPKDMAFGCGHQTCCECGEDLQSCPICRTPIQTRIRLY  453



>gb|KDP46390.1| hypothetical protein JCGZ_10230 [Jatropha curcas]
Length=464

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TYDNQLCPICL+N KDMAFGCGHQTCC+CG+ L LCPICRSSI+ RIKLY
Sbjct  415  TYDNQLCPICLTNVKDMAFGCGHQTCCECGESLQLCPICRSSIKVRIKLY  464



>gb|AFN89139.1| RING-type ubiquitin ligase [Mesembryanthemum crystallinum]
Length=472

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            P+   S YDN LCPICL+N KDMAFGCGHQTCC+CG++L  CPICRS+IQTRIKLY
Sbjct  417  PTGATSAYDNLLCPICLTNNKDMAFGCGHQTCCECGQDLQTCPICRSTIQTRIKLY  472



>ref|XP_002515058.1| copine, putative [Ricinus communis]
 gb|EEF47612.1| copine, putative [Ricinus communis]
Length=478

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            STYDNQ+CPICL+N KDMAFGCGHQTCC+CG++L LCPICRS IQTRI+LY
Sbjct  428  STYDNQVCPICLTNRKDMAFGCGHQTCCECGEDLQLCPICRSPIQTRIRLY  478



>ref|XP_010026602.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
Length=486

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = -2

Query  447  TPSAPVSTY--DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +PSAP S+Y  +N  CPIC +NPKDMAFGCGHQTCC+CG  L+LCPICRSSI TRIKLY
Sbjct  428  SPSAPTSSYRNENHACPICFTNPKDMAFGCGHQTCCECGDGLELCPICRSSIHTRIKLY  486



>ref|XP_009333912.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
 ref|XP_009343857.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
Length=446

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S  DNQ+CPICL++PK+MAFGCGHQTCCDCG++LDLCPICR+SI TRIKLY
Sbjct  396  SASDNQVCPICLTDPKNMAFGCGHQTCCDCGQDLDLCPICRTSIHTRIKLY  446



>ref|XP_006439963.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
 gb|ESR53203.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
Length=435

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PKDMAFGCGHQTCC CG++LDLCPICRS IQTRIKLY
Sbjct  385  STSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY  435



>ref|XP_007151612.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 ref|XP_007151613.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 gb|ESW23606.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 gb|ESW23607.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
Length=506

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = -2

Query  471  YYDPR--GEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSI  298
            YYD    G   P    STYDNQLCPICL+N KDMAFGCGHQTCC+CG +L  CPICRS I
Sbjct  440  YYDNNNVGGTAPPVSSSTYDNQLCPICLTNSKDMAFGCGHQTCCECGPDLQTCPICRSPI  499

Query  297  QTRIKLY  277
             TRIKLY
Sbjct  500  NTRIKLY  506



>gb|KDO69441.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
 gb|KDO69442.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=435

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PKDMAFGCGHQTCC CG++LDLCPICRS IQTRIKLY
Sbjct  385  STSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY  435



>ref|XP_006476915.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
 ref|XP_006476916.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Citrus sinensis]
 ref|XP_006476917.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Citrus sinensis]
Length=435

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PKDMAFGCGHQTCC CG++LDLCPICRS IQTRIKLY
Sbjct  385  STSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY  435



>emb|CDX69581.1| BnaA10g19300D [Brassica napus]
Length=466

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -2

Query  468  YDPRGEPTPSAPV-STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            Y  R  P P A   S  DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ I T
Sbjct  402  YPVRSSPAPPATTTSASDNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIHT  461

Query  291  RIKLY  277
            RIKLY
Sbjct  462  RIKLY  466



>ref|XP_006476914.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
Length=449

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PKDMAFGCGHQTCC CG++LDLCPICRS IQTRIKLY
Sbjct  399  STSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY  449



>gb|KDO69439.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=460

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PKDMAFGCGHQTCC CG++LDLCPICRS IQTRIKLY
Sbjct  410  STSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY  460



>ref|XP_008389744.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
Length=457

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -2

Query  441  SAPVST-YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            SAP  T YD+Q+CPICL+NPKDMAFGCGHQTCCDCG++L  CPICRS IQTRI+LY
Sbjct  402  SAPSYTDYDSQVCPICLTNPKDMAFGCGHQTCCDCGEDLQSCPICRSGIQTRIRLY  457



>ref|NP_001240870.1| uncharacterized protein LOC100809850 [Glycine max]
 ref|XP_006577852.1| PREDICTED: uncharacterized protein LOC100809850 isoform X1 [Glycine 
max]
 gb|ACU22839.1| unknown [Glycine max]
Length=427

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQ+CPICL++PKDMAFGCGHQTCCDCG++L+LCPICRS+I TRIKLY
Sbjct  376  TSASDNQVCPICLTDPKDMAFGCGHQTCCDCGQDLELCPICRSTIDTRIKLY  427



>gb|KHG01454.1| E3 ubiquitin-protein ligase RGLG2 -like protein [Gossypium arboreum]
Length=476

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP S YDNQLCPICLSN KDMAFGCGHQTC +C K+L  CPICRS IQT+IKLY
Sbjct  419  APPAPSSNYDNQLCPICLSNSKDMAFGCGHQTCEECSKDLQTCPICRSPIQTKIKLY  475



>gb|KDO69440.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=466

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PKDMAFGCGHQTCC CG++LDLCPICRS IQTRIKLY
Sbjct  416  STSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY  466



>ref|XP_002282202.2| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650735.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650741.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650743.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650748.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650751.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650756.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 emb|CBI16816.3| unnamed protein product [Vitis vinifera]
Length=442

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S YDN++CPICLSNPKDMAFGCGHQTCC+CG +L+ CPICRS IQTRIKLY
Sbjct  391  SLYDNKVCPICLSNPKDMAFGCGHQTCCECGVDLNSCPICRSPIQTRIKLY  441



>emb|CDY49067.1| BnaC05g48950D [Brassica napus]
Length=150

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 11/76 (14%)
 Frame = -2

Query  471  YYDP-RGEPTPS--APVSTY--------DNQLCPICLSNPKDMAFGCGHQTCCDCGKELD  325
            +++P +  PTPS    V TY        DNQLCPICLSNPK+MAFGCGHQTCC+CG  L 
Sbjct  75   FFNPSKASPTPSFEPSVPTYPMEGKDVDDNQLCPICLSNPKNMAFGCGHQTCCECGPGLT  134

Query  324  LCPICRSSIQTRIKLY  277
            +CPICR+ IQTRIKLY
Sbjct  135  VCPICRAPIQTRIKLY  150



>ref|XP_002271885.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Vitis 
vinifera]
 emb|CBI34842.3| unnamed protein product [Vitis vinifera]
Length=461

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P A  ST+DNQLCPICL+N K+MAFGCGHQTCC+CG +L+ CPICRS IQTRIKLY
Sbjct  405  APPATSSTFDNQLCPICLTNVKNMAFGCGHQTCCECGPDLETCPICRSPIQTRIKLY  461



>gb|EYU34755.1| hypothetical protein MIMGU_mgv1a006209mg [Erythranthe guttata]
Length=452

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PSAP S Y++Q+CPICLS+PK++AFGCGHQTC +CG+EL LCPICR  IQTRIKLY
Sbjct  397  PSAPNSNYEHQICPICLSDPKNLAFGCGHQTCFECGQELQLCPICRCPIQTRIKLY  452



>ref|XP_010524288.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Tarenaya hassleriana]
Length=431

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  447  TPSAPVSTYDNQ-LCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P  P STYD+Q LCPICLSNPKDMAFGCGHQTCC+CG +L +CPICRS I TRI+LY
Sbjct  374  APPVPSSTYDDQQLCPICLSNPKDMAFGCGHQTCCECGPDLHVCPICRSPIHTRIRLY  431



>ref|XP_006446649.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 ref|XP_006446650.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 ref|XP_006446651.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59889.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59890.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59891.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
Length=445

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 3/62 (5%)
 Frame = -2

Query  453  EPTPSAP---VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            +P  SAP    ST +NQLC ICL+N KDMAFGCGHQTCC+CG++L+LCP CRS+IQTRIK
Sbjct  384  QPVSSAPPATSSTNENQLCSICLTNVKDMAFGCGHQTCCECGQDLELCPFCRSTIQTRIK  443

Query  282  LY  277
            LY
Sbjct  444  LY  445



>ref|XP_006379955.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
 gb|ERP57752.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
Length=473

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S+  S YDNQ+CPICL+NPK+MAFGCGHQTCCDCG++L +CPICR  IQ RI+LY
Sbjct  419  SSSSSVYDNQVCPICLTNPKNMAFGCGHQTCCDCGEDLQVCPICRGPIQARIRLY  473



>ref|XP_004135284.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 ref|XP_004159664.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 gb|KGN51730.1| hypothetical protein Csa_5G593430 [Cucumis sativus]
Length=433

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  459  RGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKL  280
            +G  T  +  S+YDNQ CPIC++NPKDMAFGCGH TCC+CG  L+LCPICRS IQTRI+L
Sbjct  373  QGVGTNPSSSSSYDNQRCPICIANPKDMAFGCGHMTCCNCGGNLELCPICRSFIQTRIRL  432

Query  279  Y  277
            Y
Sbjct  433  Y  433



>ref|XP_006591484.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 gb|KHN44377.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=437

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  456  GEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            G  T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICRS+I TRI+LY
Sbjct  378  GVHTETSSSSLYDNKVCPICLTNAKDMAFGCGHQTCCECGEDLQFCPICRSTIHTRIRLY  437



>dbj|BAH19894.1| AT5G14420 [Arabidopsis thaliana]
Length=468

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  420  DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  421  DNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTRIKLY  468



>ref|NP_196946.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_850818.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_974779.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_974780.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 sp|Q9LY87.1|RGLG2_ARATH RecName: Full=E3 ubiquitin-protein ligase RGLG2; AltName: Full=RING 
domain ligase 2 [Arabidopsis thaliana]
 emb|CAB87781.1| putative protein [Arabidopsis thaliana]
 gb|AAM20448.1| putative protein [Arabidopsis thaliana]
 gb|AAN15568.1| putative protein [Arabidopsis thaliana]
 gb|AAZ14078.1| At5g14420 [Arabidopsis thaliana]
 gb|AED92028.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92029.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92030.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92031.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
Length=468

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  420  DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            DNQLCPICLSNPKDMAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  421  DNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTRIKLY  468



>ref|XP_003538591.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006591483.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=463

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  456  GEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            G  T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICRS+I TRI+LY
Sbjct  404  GVHTETSSSSLYDNKVCPICLTNAKDMAFGCGHQTCCECGEDLQFCPICRSTIHTRIRLY  463



>ref|XP_011034033.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Populus euphratica]
Length=472

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S+  S YDNQ+CPICL+NPK+MAFGCGHQTCCDCG++L +CPICR  IQ RI+LY
Sbjct  418  SSSSSVYDNQVCPICLTNPKNMAFGCGHQTCCDCGEDLQVCPICRGPIQARIRLY  472



>ref|XP_010904547.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Elaeis guineensis]
Length=468

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 3/62 (5%)
 Frame = -2

Query  462  PRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            P   PT SA   +++ Q+CP+CLSNP+DMAFGCGHQTCCDCG +L  CPICRSSIQTRIK
Sbjct  410  PTTAPTASA---SWEAQVCPVCLSNPRDMAFGCGHQTCCDCGPKLTSCPICRSSIQTRIK  466

Query  282  LY  277
            LY
Sbjct  467  LY  468



>ref|XP_011034031.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Populus euphratica]
 ref|XP_011034032.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Populus euphratica]
Length=473

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S+  S YDNQ+CPICL+NPK+MAFGCGHQTCCDCG++L +CPICR  IQ RI+LY
Sbjct  419  SSSSSVYDNQVCPICLTNPKNMAFGCGHQTCCDCGEDLQVCPICRGPIQARIRLY  473



>ref|XP_003526988.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Glycine max]
Length=428

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQ+CPICL++PKDMAFGCGHQTCC+CG++L+LCPICRS+I TRIKLY
Sbjct  377  TSASDNQVCPICLTDPKDMAFGCGHQTCCECGQDLELCPICRSTIDTRIKLY  428



>ref|XP_008367487.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
Length=446

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            ST DN +CPICL++PK+MAFGCGHQTCCDCG++LDLCPICR+SI TRIKLY
Sbjct  396  STSDNNVCPICLTDPKNMAFGCGHQTCCDCGQDLDLCPICRTSIITRIKLY  446



>ref|XP_011042369.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=460

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 3/58 (5%)
 Frame = -2

Query  450  PTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            P+PS PV  YDNQ+C ICL+NPKDMAFGCGHQTCCDCG++L LCPICR  I TRI+LY
Sbjct  406  PSPS-PV--YDNQVCVICLTNPKDMAFGCGHQTCCDCGEDLQLCPICRRQIHTRIRLY  460



>ref|XP_002279018.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010663074.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010663075.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 emb|CBI14914.3| unnamed protein product [Vitis vinifera]
Length=433

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -2

Query  441  SAPVSTY-DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            SAP S+  DN +CPICL+N KDMAFGCGHQTCC+CG +LDLCPICRS IQTRIKLY
Sbjct  378  SAPASSLADNNVCPICLTNKKDMAFGCGHQTCCECGPDLDLCPICRSPIQTRIKLY  433



>gb|KJB33861.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33862.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33863.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33864.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33865.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
Length=466

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             P AP S YDN+LCPICLSN KDMAFGCGHQTC +C K+L  CPICRS IQT+IKLY
Sbjct  409  APPAPSSNYDNRLCPICLSNSKDMAFGCGHQTCEECSKDLQTCPICRSPIQTKIKLY  465



>ref|XP_010435648.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
 ref|XP_010435649.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
 ref|XP_010435650.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
Length=450

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 3/65 (5%)
 Frame = -2

Query  462  PRGEPT-PSAPVSTY--DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            P  EP+ P+ P+ST   D+QLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQT
Sbjct  386  PSFEPSVPTYPISTGADDSQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQT  445

Query  291  RIKLY  277
            RIKLY
Sbjct  446  RIKLY  450



>ref|XP_010248698.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
 ref|XP_010248699.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
 ref|XP_010248701.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
Length=445

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            STYDNQ+CPICL+N KDMAFGCGHQTCC+CG +L  CPICRS I+TRIKLY
Sbjct  395  STYDNQVCPICLTNQKDMAFGCGHQTCCECGADLQSCPICRSPIETRIKLY  445



>ref|XP_008374368.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
Length=446

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T S   S  DN  CPICL++PK+MAFGCGHQTCCDCG++LDLCPICR+SI TRIKLY
Sbjct  390  TASPTGSASDNHXCPICLTDPKNMAFGCGHQTCCDCGQDLDLCPICRTSIHTRIKLY  446



>gb|KHN43980.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=433

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICRS+I TRI+LY
Sbjct  377  TETSSSSLYDNKVCPICLTNAKDMAFGCGHQTCCECGEDLQFCPICRSTIHTRIRLY  433



>ref|XP_006601923.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 ref|XP_006601924.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Glycine max]
Length=434

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICRS+I TRI+LY
Sbjct  378  TETSSSSLYDNKVCPICLTNAKDMAFGCGHQTCCECGEDLQFCPICRSTIHTRIRLY  434



>ref|XP_006601922.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=460

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICRS+I TRI+LY
Sbjct  404  TETSSSSLYDNKVCPICLTNAKDMAFGCGHQTCCECGEDLQFCPICRSTIHTRIRLY  460



>ref|XP_003551971.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
Length=459

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICRS+I TRI+LY
Sbjct  403  TETSSSSLYDNKVCPICLTNAKDMAFGCGHQTCCECGEDLQFCPICRSTIHTRIRLY  459



>ref|XP_010102933.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
 gb|EXB94451.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
Length=244

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -2

Query  411  LCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            LCPIC+SNPK+MAFGCGHQTCC+CG++LD+CPICRSSIQTRIKLY
Sbjct  200  LCPICISNPKNMAFGCGHQTCCECGEDLDVCPICRSSIQTRIKLY  244



>ref|XP_007037786.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007037787.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY22287.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY22288.1| RING domain ligase2 isoform 1 [Theobroma cacao]
Length=456

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD     TPSA  S  DN +CPICL NPKDMAFGCGHQTCC+CG++L LCPICRS+I TR
Sbjct  394  YDAPVRTTPSAS-SASDNHVCPICLCNPKDMAFGCGHQTCCECGQDLQLCPICRSTIDTR  452

Query  288  IKLY  277
            I+LY
Sbjct  453  IRLY  456



>ref|XP_004489546.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Cicer arietinum]
 ref|XP_004489547.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=460

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TY+NQLCPICLS+PKDMAFGCGHQTCC CG++L  CPICRS I TRIKLY
Sbjct  411  TYENQLCPICLSDPKDMAFGCGHQTCCGCGQDLQTCPICRSPINTRIKLY  460



>ref|XP_008239359.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Prunus mume]
Length=440

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S  DN +CPICL++PK+MAFGCGHQTCCDCG++L LCPICRS+I+TRIKLY
Sbjct  390  SASDNHVCPICLTDPKNMAFGCGHQTCCDCGQDLQLCPICRSTIETRIKLY  440



>ref|XP_007209145.1| hypothetical protein PRUPE_ppa005852mg [Prunus persica]
 gb|EMJ10344.1| hypothetical protein PRUPE_ppa005852mg [Prunus persica]
Length=440

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S  DN +CPICL++PK+MAFGCGHQTCCDCG++L LCPICRS+I+TRIKLY
Sbjct  390  SASDNHVCPICLTDPKNMAFGCGHQTCCDCGQDLQLCPICRSTIETRIKLY  440



>emb|CDY37509.1| BnaA05g33740D [Brassica napus]
Length=460

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  409  TSVDDNQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY  460



>emb|CDY49066.1| BnaC05g48940D [Brassica napus]
Length=460

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  409  TSVDDNQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY  460



>ref|XP_006585247.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006585248.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
Length=460

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S+  S+YDN++CPICL+N KDMAFGCGHQTCCDCG+ L+ CPICRS+I TRIKLY
Sbjct  406  SSSRSSYDNKVCPICLTNGKDMAFGCGHQTCCDCGENLECCPICRSTITTRIKLY  460



>ref|XP_003531323.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
Length=459

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S+  S+YDN++CPICL+N KDMAFGCGHQTCCDCG+ L+ CPICRS+I TRIKLY
Sbjct  405  SSSRSSYDNKVCPICLTNGKDMAFGCGHQTCCDCGENLECCPICRSTITTRIKLY  459



>ref|XP_009147449.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X2 
[Brassica rapa]
Length=456

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 11/76 (14%)
 Frame = -2

Query  471  YYDP-RGEPTPSAP--VSTY--------DNQLCPICLSNPKDMAFGCGHQTCCDCGKELD  325
            +++P +  PTPS    V TY        DNQLCPICLSNPK+MAFGCGHQTCC+CG  L 
Sbjct  381  FFNPSKASPTPSFEPSVPTYPMESKDVDDNQLCPICLSNPKNMAFGCGHQTCCECGPGLK  440

Query  324  LCPICRSSIQTRIKLY  277
            +CPICR+ IQTRIKLY
Sbjct  441  VCPICRAPIQTRIKLY  456



>ref|XP_011040451.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014652.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014653.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014654.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014655.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=433

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            +D  G   P++  S  DN LCPICL++PKDMAFGCGHQTCCDCG++L  CPICRS+I TR
Sbjct  372  HDVVGTALPASSAS--DNHLCPICLADPKDMAFGCGHQTCCDCGQDLQSCPICRSTIHTR  429

Query  288  IKLY  277
            IKLY
Sbjct  430  IKLY  433



>gb|EMT24645.1| E3 ubiquitin-protein ligase RGLG2 [Aegilops tauschii]
Length=359

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDNQ+CPICL NPKDMAFGCGHQTCC+CG+ L+ CPICRS I TRIKLY
Sbjct  311  YDNQVCPICLVNPKDMAFGCGHQTCCECGQTLESCPICRSPITTRIKLY  359



>ref|XP_002318092.2| hypothetical protein POPTR_0012s09190g [Populus trichocarpa]
 gb|EEE96312.2| hypothetical protein POPTR_0012s09190g [Populus trichocarpa]
Length=433

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            +D  G   P++  S  DN LCPICL++PKDMAFGCGHQTCCDCG++L  CPICRS+I TR
Sbjct  372  HDVVGTALPASSAS--DNHLCPICLTDPKDMAFGCGHQTCCDCGQDLQSCPICRSTIHTR  429

Query  288  IKLY  277
            IKLY
Sbjct  430  IKLY  433



>emb|CDX74310.1| BnaA03g27370D [Brassica napus]
Length=458

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  407  TSVDDNQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY  458



>ref|XP_009147448.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X1 
[Brassica rapa]
Length=489

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 11/76 (14%)
 Frame = -2

Query  471  YYDP-RGEPTPSAP--VSTY--------DNQLCPICLSNPKDMAFGCGHQTCCDCGKELD  325
            +++P +  PTPS    V TY        DNQLCPICLSNPK+MAFGCGHQTCC+CG  L 
Sbjct  414  FFNPSKASPTPSFEPSVPTYPMESKDVDDNQLCPICLSNPKNMAFGCGHQTCCECGPGLK  473

Query  324  LCPICRSSIQTRIKLY  277
            +CPICR+ IQTRIKLY
Sbjct  474  VCPICRAPIQTRIKLY  489



>ref|XP_009134597.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Brassica rapa]
 ref|XP_009134598.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Brassica rapa]
Length=458

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  407  TSVDDNQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY  458



>ref|XP_010485387.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
Length=462

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 3/65 (5%)
 Frame = -2

Query  462  PRGEPT-PSAPVSTY--DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            P  EP+ P+ P+S+   D+QLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQT
Sbjct  398  PSFEPSVPTYPISSGADDSQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQT  457

Query  291  RIKLY  277
            RIKLY
Sbjct  458  RIKLY  462



>ref|XP_002884269.1| hypothetical protein ARALYDRAFT_896079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60528.1| hypothetical protein ARALYDRAFT_896079 [Arabidopsis lyrata subsp. 
lyrata]
Length=430

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  420  DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            DNQLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  383  DNQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY  430



>ref|XP_010100348.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
 gb|EXB82482.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
Length=448

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S+YDN++CPICL+ PKDMAFGCGHQTC DCG+ L LCPICRSSI+TRI+LY
Sbjct  398  SSYDNRVCPICLTYPKDMAFGCGHQTCFDCGEVLQLCPICRSSIETRIRLY  448



>ref|XP_010250991.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010250992.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010250993.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
Length=451

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = -2

Query  462  PRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            P G   P++ +S  DNQ+CPICL+NP DMAFGCGH+TCC+CG +L LCPICRS IQTRI+
Sbjct  392  PMGTAPPASSIS--DNQVCPICLTNPNDMAFGCGHRTCCECGPDLQLCPICRSPIQTRIR  449

Query  282  LY  277
            LY
Sbjct  450  LY  451



>ref|XP_006470207.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
 ref|XP_006470208.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
Length=445

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 3/62 (5%)
 Frame = -2

Query  453  EPTPSAP---VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            +P  SAP    ST +NQLC ICL+N KDMAFGCGHQTCC+CG++L+LCP CR +IQTRI+
Sbjct  384  QPVSSAPPATSSTNENQLCSICLTNVKDMAFGCGHQTCCECGQDLELCPFCRRTIQTRIR  443

Query  282  LY  277
            LY
Sbjct  444  LY  445



>ref|XP_010250995.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Nelumbo nucifera]
Length=450

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = -2

Query  462  PRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            P G   P++ +S  DNQ+CPICL+NP DMAFGCGH+TCC+CG +L LCPICRS IQTRI+
Sbjct  391  PMGTAPPASSIS--DNQVCPICLTNPNDMAFGCGHRTCCECGPDLQLCPICRSPIQTRIR  448

Query  282  LY  277
            LY
Sbjct  449  LY  450



>ref|XP_007163690.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
 gb|ESW35684.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
Length=438

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICR +I TRIKLY
Sbjct  382  TEASASSLYDNKVCPICLTNSKDMAFGCGHQTCCECGEDLQYCPICRRTIHTRIKLY  438



>ref|XP_009419388.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Musa acuminata 
subsp. malaccensis]
Length=468

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDNQ+CPICL+NPKDMAFGCGHQTCC+CG  L  CPICRS I TRIKL+
Sbjct  420  YDNQICPICLTNPKDMAFGCGHQTCCECGPSLQTCPICRSEIHTRIKLF  468



>ref|XP_010550166.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550167.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550168.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550169.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
Length=452

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDNQ+CPICLSNPKDMAFGCGHQTCC+C  +L +CPICR+ I TRIKLY
Sbjct  404  YDNQMCPICLSNPKDMAFGCGHQTCCECAPDLQVCPICRAPIHTRIKLY  452



>ref|XP_010496283.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
 ref|XP_010496284.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
 ref|XP_010496285.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
Length=449

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 3/62 (5%)
 Frame = -2

Query  453  EPT-PSAPVSTY--DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            EP+ P+ P++T   D+QLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQTRIK
Sbjct  388  EPSVPTYPINTGADDSQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIK  447

Query  282  LY  277
            LY
Sbjct  448  LY  449



>ref|XP_007163691.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
 gb|ESW35685.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
Length=464

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T ++  S YDN++CPICL+N KDMAFGCGHQTCC+CG++L  CPICR +I TRIKLY
Sbjct  408  TEASASSLYDNKVCPICLTNSKDMAFGCGHQTCCECGEDLQYCPICRRTIHTRIKLY  464



>ref|XP_011005612.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=452

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S  DN LCPICL++PKDMAF CGHQTCCDCG++L LCPICRS+I TRIKLY
Sbjct  402  SASDNHLCPICLTDPKDMAFSCGHQTCCDCGQDLQLCPICRSTIHTRIKLY  452



>gb|KJB31093.1| hypothetical protein B456_005G175700 [Gossypium raimondii]
Length=439

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = -2

Query  432  VSTYDN-QLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +S+ DN Q+CPICL NPKDMAFGCGHQTCCDCG+ L LCPICR++IQTRI+LY
Sbjct  387  LSSLDNHQVCPICLVNPKDMAFGCGHQTCCDCGEHLQLCPICRTTIQTRIRLY  439



>ref|XP_004299159.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Fragaria vesca 
subsp. vesca]
Length=448

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  420  DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            DN +CPICL++PK+MAFGCGHQTCCDCG++L LCPICRS+I+TRIKLY
Sbjct  401  DNHVCPICLTDPKNMAFGCGHQTCCDCGQDLQLCPICRSTIETRIKLY  448



>ref|XP_006408532.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 ref|XP_006408533.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 ref|XP_006408534.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49985.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49986.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49987.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
Length=472

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 4/66 (6%)
 Frame = -2

Query  462  PRGEPT-PSAPVSTY---DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQ  295
            P  EP+ P+ P+ +    +NQLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQ
Sbjct  407  PSFEPSVPTYPIESKHMDENQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQ  466

Query  294  TRIKLY  277
            TRIKLY
Sbjct  467  TRIKLY  472



>dbj|BAJ96252.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDNQ+CPICL NPKDMAFGCGHQTCC+CG+ L+ CPICRS I TRIKLY
Sbjct  417  YDNQVCPICLVNPKDMAFGCGHQTCCECGQTLESCPICRSPITTRIKLY  465



>gb|EYU44846.1| hypothetical protein MIMGU_mgv1a009476mg [Erythranthe guttata]
Length=340

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PSAP ++Y++Q+CPIC++NP DMAFGCGHQTC +CG+EL  CPICR  ++ RIKL+
Sbjct  284  VPSAPSTSYEHQICPICIANPNDMAFGCGHQTCSECGQELTACPICRGDVEIRIKLH  340



>gb|KDP31007.1| hypothetical protein JCGZ_11383 [Jatropha curcas]
Length=429

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y   G   P++  S  DN +CPICL+N KD+AFGCGHQTCCDCG++L LCPICRS+I TR
Sbjct  368  YGAAGTAPPASSAS--DNHVCPICLTNAKDLAFGCGHQTCCDCGQDLQLCPICRSAINTR  425

Query  288  IKLY  277
            IKLY
Sbjct  426  IKLY  429



>ref|XP_009412691.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y+      PSAP S++++Q+CPICL+NP+DMAFGCGH TC DCG  L  CPICR  I TR
Sbjct  371  YETASSEHPSAPSSSFEDQVCPICLTNPRDMAFGCGHLTCSDCGPSLQTCPICRREIHTR  430

Query  288  IKLY  277
            IKLY
Sbjct  431  IKLY  434



>ref|XP_007159686.1| hypothetical protein PHAVU_002G258600g [Phaseolus vulgaris]
 gb|ESW31680.1| hypothetical protein PHAVU_002G258600g [Phaseolus vulgaris]
Length=462

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T S+    YDN++CPICL+N KDMAFGCGHQTCC+CG+ L+ CPICR++I TRIKLY
Sbjct  406  TASSSGGLYDNKVCPICLTNGKDMAFGCGHQTCCECGESLEFCPICRTTITTRIKLY  462



>gb|KEH20743.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=475

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDN++CPICL+N KDMAFGCGHQTCC+CG+ L+ CPICRS+I TRIKLY
Sbjct  427  YDNKVCPICLTNAKDMAFGCGHQTCCECGESLEFCPICRSTIDTRIKLY  475



>gb|KHN06536.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=435

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            YYD     + S  +  YDN++CPICL+N KDMAFGCGHQTCCDCG+ L+ CPICRS+I T
Sbjct  373  YYDNVNAESSSRNL--YDNKVCPICLTNDKDMAFGCGHQTCCDCGENLECCPICRSTITT  430

Query  291  RIKLY  277
            RIKLY
Sbjct  431  RIKLY  435



>ref|XP_010519134.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519135.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519136.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519137.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
Length=430

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 8/70 (11%)
 Frame = -2

Query  462  PRGEPTPSAPVSTY--------DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICR  307
            P    TPSAP ST         DN  CPICL++PKDMAFGCGHQTCC CG++L+ CPICR
Sbjct  361  PHNNYTPSAPSSTARPPVNLRTDNNDCPICLTDPKDMAFGCGHQTCCGCGQDLETCPICR  420

Query  306  SSIQTRIKLY  277
            S I+TRIKLY
Sbjct  421  SFIETRIKLY  430



>ref|XP_010682336.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682337.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682338.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=491

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            Y+NQLCPIC+++PK+MAFGCGHQTCCDCG+ LD CPICR SI+TRI+LY
Sbjct  443  YENQLCPICITSPKNMAFGCGHQTCCDCGEFLDACPICRRSIETRIRLY  491



>ref|XP_010682339.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682340.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            Y+NQLCPIC+++PK+MAFGCGHQTCCDCG+ LD CPICR SI+TRI+LY
Sbjct  419  YENQLCPICITSPKNMAFGCGHQTCCDCGEFLDACPICRRSIETRIRLY  467



>ref|XP_009359243.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Pyrus x bretschneideri]
Length=450

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            Y++Q+CPICL+NPKDMAFGCGHQTCCDCG++L  CPICR +IQTRI+LY
Sbjct  402  YNSQVCPICLTNPKDMAFGCGHQTCCDCGEDLKSCPICRINIQTRIRLY  450



>ref|XP_010682022.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Beta vulgaris 
subsp. vulgaris]
Length=471

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -2

Query  456  GEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            G+P   A  S YDN LCPIC +N KDMAFGCGHQTC +CG++L  CPICRS+IQTRIKLY
Sbjct  415  GQP---AATSDYDNLLCPICFTNNKDMAFGCGHQTCAECGQDLSNCPICRSTIQTRIKLY  471



>gb|EYU44848.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
Length=486

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 53/83 (64%), Gaps = 26/83 (31%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGH--------------------------QTCC  346
             P+AP STY++Q+CPICLSNPKDMAFGCGH                          QTCC
Sbjct  404  APTAPSSTYEHQICPICLSNPKDMAFGCGHQVNFFLLTYYQMVMLSRSVNIIFLLCQTCC  463

Query  345  DCGKELDLCPICRSSIQTRIKLY  277
            +CG++L LCPICRS I+TRIKLY
Sbjct  464  ECGQDLQLCPICRSRIETRIKLY  486



>ref|XP_007031645.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007031646.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007031648.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02571.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02572.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02574.1| RING domain ligase2 isoform 1 [Theobroma cacao]
Length=485

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TYD+QLCPICLSN KDMAFGCGHQTC DC K+L  CPICRS IQT+IKLY
Sbjct  435  TYDSQLCPICLSNSKDMAFGCGHQTCEDCAKDLQTCPICRSPIQTKIKLY  484



>emb|CDX91935.1| BnaC03g32370D [Brassica napus]
Length=457

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             S  DNQLCPICLSNPK+MAFGCGHQTC +CG +L +CPICR+ IQTRIKLY
Sbjct  406  TSVDDNQLCPICLSNPKNMAFGCGHQTCSECGPDLKVCPICRAPIQTRIKLY  457



>ref|XP_004141118.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis sativus]
Length=444

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            E   S  +S+YD++LC ICLSNPKD+AFGCGHQTC +CG++L +CP CRSSI TR+KLY
Sbjct  386  ETVRSVDLSSYDDKLCGICLSNPKDLAFGCGHQTCAECGQDLQICPFCRSSIHTRLKLY  444



>ref|XP_004158327.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis sativus]
 gb|KGN59719.1| hypothetical protein Csa_3G840450 [Cucumis sativus]
Length=456

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            E   S  +S+YD++LC ICLSNPKD+AFGCGHQTC +CG++L +CP CRSSI TR+KLY
Sbjct  398  ETVRSVDLSSYDDKLCGICLSNPKDLAFGCGHQTCAECGQDLQICPFCRSSIHTRLKLY  456



>ref|XP_008464939.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
 ref|XP_008464940.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
 ref|XP_008464941.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
Length=445

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            E   S  +S+YD++LC ICLSNPKD+AFGCGHQTC +CG++L +CP CRSSI TR+KLY
Sbjct  387  ETVRSVDLSSYDDKLCGICLSNPKDLAFGCGHQTCAECGQDLQICPFCRSSIHTRLKLY  445



>ref|XP_011071160.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Sesamum indicum]
Length=464

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T S+  S YD ++CPICLSN KDMAFGCGHQTCC+CG +L+ CPICRS+I T+IKLY
Sbjct  407  TASSSSSLYDRKVCPICLSNSKDMAFGCGHQTCCECGVDLEYCPICRSTITTKIKLY  463



>ref|XP_004504141.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=470

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDN++CPICL+N KDMAFGCGHQTCC+CG+ L+LCPICRS+I  R+KLY
Sbjct  422  YDNKVCPICLTNRKDMAFGCGHQTCCNCGESLELCPICRSTIDMRVKLY  470



>ref|XP_004504140.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Cicer arietinum]
Length=492

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YDN++CPICL+N KDMAFGCGHQTCC+CG+ L+LCPICRS+I  R+KLY
Sbjct  444  YDNKVCPICLTNRKDMAFGCGHQTCCNCGESLELCPICRSTIDMRVKLY  492



>gb|KJB51130.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=378

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -2

Query  459  RGEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            R  P  +AP   S  DN LCPIC+ N KDMAFGCGHQTCC+CG++L LCPICR +I TRI
Sbjct  316  REAPVQTAPPASSASDNHLCPICICNAKDMAFGCGHQTCCECGQDLQLCPICRGTIDTRI  375

Query  285  KLY  277
            +LY
Sbjct  376  RLY  378



>ref|XP_002321646.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
 gb|EEF05773.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
Length=414

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 5/55 (9%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +APV     QLCPICL++PKDMAF CGHQTCCDCG++L LCPICRS+I TRIKLY
Sbjct  365  AAPV-----QLCPICLTDPKDMAFSCGHQTCCDCGQDLQLCPICRSTIHTRIKLY  414



>gb|KJB75966.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
 gb|KJB75967.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
 gb|KJB75968.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
Length=480

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TYD+QLCPICLSN +DMAFGCGHQTC +C K+L+ CPICRS IQT+IKLY
Sbjct  430  TYDSQLCPICLSNSRDMAFGCGHQTCEECAKDLETCPICRSPIQTKIKLY  479



>gb|KHG01850.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=469

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TYD+QLCPICLSN +DMAFGCGHQTC +C K+L+ CPICRS IQT+IKLY
Sbjct  419  TYDSQLCPICLSNSRDMAFGCGHQTCEECAKDLETCPICRSPIQTKIKLY  468



>ref|XP_003524251.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006580246.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=460

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = -2

Query  471  YYDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            YYD     + S  +  YD+++CPICL+N KDMAFGCGHQTCCDCG+ L+ CPICRS+I T
Sbjct  398  YYDNVNAESSSRNL--YDSKVCPICLTNDKDMAFGCGHQTCCDCGENLECCPICRSTITT  455

Query  291  RIKLY  277
            RIKLY
Sbjct  456  RIKLY  460



>gb|KHG01848.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=480

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TYD+QLCPICLSN +DMAFGCGHQTC +C K+L+ CPICRS IQT+IKLY
Sbjct  430  TYDSQLCPICLSNSRDMAFGCGHQTCEECAKDLETCPICRSPIQTKIKLY  479



>gb|KJB51125.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=406

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -2

Query  459  RGEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            R  P  +AP   S  DN LCPIC+ N KDMAFGCGHQTCC+CG++L LCPICR +I TRI
Sbjct  344  REAPVQTAPPASSASDNHLCPICICNAKDMAFGCGHQTCCECGQDLQLCPICRGTIDTRI  403

Query  285  KLY  277
            +LY
Sbjct  404  RLY  406



>gb|KHG01849.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=503

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TYD+QLCPICLSN +DMAFGCGHQTC +C K+L+ CPICRS IQT+IKLY
Sbjct  453  TYDSQLCPICLSNSRDMAFGCGHQTCEECAKDLETCPICRSPIQTKIKLY  502



>ref|NP_186814.1| E3 ubiquitin-protein ligase RGLG1 [Arabidopsis thaliana]
 sp|Q9SS90.1|RGLG1_ARATH RecName: Full=E3 ubiquitin-protein ligase RGLG1; AltName: Full=RING 
domain ligase 1 [Arabidopsis thaliana]
 gb|AAF01562.1|AC009325_32 unknown protein [Arabidopsis thaliana]
 gb|AEE73699.1| E3 ubiquitin-protein ligase RGLG1 [Arabidopsis thaliana]
Length=489

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  450  PTPSAPVSTYDN-QLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            P  S  +S+ D+ QLCPICLSNPK+MAFGCGHQTCC+CG +L +CPICR+ IQTRIKLY
Sbjct  431  PFESKQMSSADDIQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY  489



>ref|XP_010044533.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010044535.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010044536.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 gb|KCW86618.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
 gb|KCW86619.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
 gb|KCW86620.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
Length=439

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            VS YDNQ CPIC+SNPKDMAFGCGH TC DCG+ L  CPIC+S+IQ RIKLY
Sbjct  388  VSAYDNQDCPICMSNPKDMAFGCGHLTCSDCGENLLSCPICQSTIQIRIKLY  439



>gb|EYU22544.1| hypothetical protein MIMGU_mgv1a006738mg [Erythranthe guttata]
Length=433

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  423  YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            YD++LCPICLSN KDMAFGCGHQTCC+CG +L+ CP+CRS+I TRIKLY
Sbjct  384  YDSKLCPICLSNLKDMAFGCGHQTCCECGTDLEYCPMCRSTISTRIKLY  432



>ref|XP_010044531.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
Length=465

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -2

Query  462  PRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            P     PS+ VS YDNQ CPIC+SNPKDMAFGCGH TC DCG+ L  CPIC+S+IQ RIK
Sbjct  405  PAFSKAPSS-VSAYDNQDCPICMSNPKDMAFGCGHLTCSDCGENLLSCPICQSTIQIRIK  463

Query  282  LY  277
            LY
Sbjct  464  LY  465



>ref|XP_002312658.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
 gb|EEE90025.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
Length=434

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S YD  +CPICL+NPK+MAFGCGHQTCCDCG++L +CPICR  IQ RI+LY
Sbjct  384  SAYDTPVCPICLTNPKNMAFGCGHQTCCDCGEDLQVCPICRGPIQARIRLY  434



>gb|KJB51124.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51131.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51132.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51133.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=437

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -2

Query  459  RGEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            R  P  +AP   S  DN LCPIC+ N KDMAFGCGHQTCC+CG++L LCPICR +I TRI
Sbjct  375  REAPVQTAPPASSASDNHLCPICICNAKDMAFGCGHQTCCECGQDLQLCPICRGTIDTRI  434

Query  285  KLY  277
            +LY
Sbjct  435  RLY  437



>ref|XP_010044532.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
Length=463

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  432  VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            VS YDNQ CPIC+SNPKDMAFGCGH TC DCG+ L  CPIC+S+IQ RIKLY
Sbjct  412  VSAYDNQDCPICMSNPKDMAFGCGHLTCSDCGENLLSCPICQSTIQIRIKLY  463



>gb|KJB51129.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=450

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -2

Query  459  RGEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            R  P  +AP   S  DN LCPIC+ N KDMAFGCGHQTCC+CG++L LCPICR +I TRI
Sbjct  388  REAPVQTAPPASSASDNHLCPICICNAKDMAFGCGHQTCCECGQDLQLCPICRGTIDTRI  447

Query  285  KLY  277
            +LY
Sbjct  448  RLY  450



>gb|KHG28566.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=456

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -2

Query  459  RGEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            R  P  +AP   S  DN LCPIC+ N KDMAFGCGHQTCC+CG++L LCPICR +I TRI
Sbjct  394  REAPVQTAPPASSASDNHLCPICICNAKDMAFGCGHQTCCECGQDLQLCPICRGTIDTRI  453

Query  285  KLY  277
            +LY
Sbjct  454  RLY  456



>emb|CDP12686.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S   S+ D+ LCPICL++PK+MAFGCGHQTCC+CG++L LCPICR +I TRIKLY
Sbjct  383  SQAASSSDSHLCPICLTDPKNMAFGCGHQTCCECGQDLQLCPICRDTISTRIKLY  437



>ref|XP_004502384.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=470

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD      PS+  S +DN++CPICL++ KDMAFGCGHQTCC CG++L  CPICRS+I T+
Sbjct  408  YDSNVNTEPSSS-SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLQFCPICRSTINTK  466

Query  288  IKLY  277
            IKLY
Sbjct  467  IKLY  470



>gb|KHG28565.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=463

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -2

Query  459  RGEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            R  P  +AP   S  DN LCPIC+ N KDMAFGCGHQTCC+CG++L LCPICR +I TRI
Sbjct  401  REAPVQTAPPASSASDNHLCPICICNAKDMAFGCGHQTCCECGQDLQLCPICRGTIDTRI  460

Query  285  KLY  277
            +LY
Sbjct  461  RLY  463



>ref|XP_004502383.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Cicer arietinum]
Length=504

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD      PS+  S +DN++CPICL++ KDMAFGCGHQTCC CG++L  CPICRS+I T+
Sbjct  442  YDSNVNTEPSSS-SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLQFCPICRSTINTK  500

Query  288  IKLY  277
            IKLY
Sbjct  501  IKLY  504



>ref|XP_009403629.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Musa acuminata 
subsp. malaccensis]
Length=460

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  420  DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            + Q CP+CLSNP++MAFGCGHQTC DCG  L  CPICRSSIQTRIKLY
Sbjct  413  ETQACPVCLSNPRNMAFGCGHQTCVDCGPRLSFCPICRSSIQTRIKLY  460



>ref|XP_004138080.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 ref|XP_004169870.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
Length=432

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = -2

Query  456  GEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            G P  +AP   S  D   CPIC+SN KDMAFGCGHQTCC+CG++L LCPICRS I TRIK
Sbjct  371  GAPGRTAPPLSSVSDAHACPICISNAKDMAFGCGHQTCCECGQDLQLCPICRSFIDTRIK  430

Query  282  LY  277
            LY
Sbjct  431  LY  432



>gb|KGN63523.1| hypothetical protein Csa_1G002920 [Cucumis sativus]
Length=475

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = -2

Query  456  GEPTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            G P  +AP   S  D   CPIC+SN KDMAFGCGHQTCC+CG++L LCPICRS I TRIK
Sbjct  414  GAPGRTAPPLSSVSDAHACPICISNAKDMAFGCGHQTCCECGQDLQLCPICRSFIDTRIK  473

Query  282  LY  277
            LY
Sbjct  474  LY  475



>gb|AFK35251.1| unknown [Medicago truncatula]
Length=470

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            EP+ S   S +DN++CPICL++ KDMAFGCGHQTCC CG++L+ CPICRS+I T+IKLY
Sbjct  415  EPSTS---SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLEFCPICRSTITTKIKLY  470



>ref|XP_003601891.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES72142.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=467

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            EP+ S   S +DN++CPICL++ KDMAFGCGHQTCC CG++L+ CPICRS+I T+IKLY
Sbjct  412  EPSTS---SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLEFCPICRSTITTKIKLY  467



>gb|EPS73512.1| hypothetical protein M569_01244 [Genlisea aurea]
Length=425

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 48/69 (70%), Gaps = 7/69 (10%)
 Frame = -2

Query  462  PRGEPTPSAPVST-------YDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRS  304
            P G   P+AP           DN LCPIC++ PKDMAFGCGHQTCC+CG++L  CPICR 
Sbjct  357  PSGTFRPTAPFQNKSSSHSSSDNNLCPICITEPKDMAFGCGHQTCCECGRDLSTCPICRV  416

Query  303  SIQTRIKLY  277
             I+TRIKLY
Sbjct  417  PIETRIKLY  425



>gb|AES72144.2| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=470

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            EP+ S   S +DN++CPICL++ KDMAFGCGHQTCC CG++L+ CPICRS+I T+IKLY
Sbjct  415  EPSTS---SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLEFCPICRSTITTKIKLY  470



>gb|AES72143.2| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=470

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            EP+ S   S +DN++CPICL++ KDMAFGCGHQTCC CG++L+ CPICRS+I T+IKLY
Sbjct  415  EPSTS---SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLEFCPICRSTITTKIKLY  470



>ref|XP_003601893.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
Length=531

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            EP+ S   S +DN++CPICL++ KDMAFGCGHQTCC CG++L+ CPICRS+I T+IKLY
Sbjct  476  EPSTS---SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLEFCPICRSTITTKIKLY  531



>ref|XP_003601892.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
Length=521

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = -2

Query  453  EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            EP+ S   S +DN++CPICL++ KDMAFGCGHQTCC CG++L+ CPICRS+I T+IKLY
Sbjct  466  EPSTS---SLHDNKVCPICLTDAKDMAFGCGHQTCCGCGEDLEFCPICRSTITTKIKLY  521



>ref|XP_008464499.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008464500.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008464501.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
Length=430

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -2

Query  450  PTPSAP--VSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            P  +AP   S  D   CPIC+SN KDMAFGCGHQTCC+CG++L LCPICRS I TRIKLY
Sbjct  371  PVRTAPPLSSVSDAHACPICISNAKDMAFGCGHQTCCECGQDLQLCPICRSFIDTRIKLY  430



>ref|XP_010912939.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
Length=472

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            Y P     P+A  S  + Q+CPICLSNP+DMAFGCGHQTC DCG  L  CPICRS IQTR
Sbjct  410  YKPTQTTAPAASASG-EAQVCPICLSNPRDMAFGCGHQTCRDCGPNLVTCPICRSPIQTR  468

Query  288  IKLY  277
            IKLY
Sbjct  469  IKLY  472



>ref|XP_008786705.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=475

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T  A  ++ + Q+CP+CLSNP+DMAFGCGHQTCCDCG  L  CPICRS IQ RIKLY
Sbjct  419  TAPAASASGEAQVCPVCLSNPRDMAFGCGHQTCCDCGPNLVTCPICRSPIQARIKLY  475



>ref|XP_010026980.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 ref|XP_010026984.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 ref|XP_010026991.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 gb|KCW83242.1| hypothetical protein EUGRSUZ_B00181 [Eucalyptus grandis]
Length=438

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  441  SAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +A  ST DN  CPICL+N KDMAF CGHQTCC+CG +LD CPICR  I+TRIKLY
Sbjct  384  TASSSTSDNHDCPICLTNRKDMAFNCGHQTCCECGLDLDTCPICRGFIETRIKLY  438



>gb|EYU44842.1| hypothetical protein MIMGU_mgv1a024648mg, partial [Erythranthe 
guttata]
Length=376

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  447  TPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             PS P ++ + ++CPIC++N  +MAFGCGHQTCC+CG+ L LCPICRS+I  RIKLY
Sbjct  320  VPSVPSTSNEQEICPICINNANNMAFGCGHQTCCECGQNLPLCPICRSNIAIRIKLY  376



>ref|XP_007031647.1| RING domain ligase2 isoform 3 [Theobroma cacao]
 gb|EOY02573.1| RING domain ligase2 isoform 3 [Theobroma cacao]
Length=486

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  426  TYDNQ-LCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            TYD+Q LCPICLSN KDMAFGCGHQTC DC K+L  CPICRS IQT+IKLY
Sbjct  435  TYDSQQLCPICLSNSKDMAFGCGHQTCEDCAKDLQTCPICRSPIQTKIKLY  485



>ref|XP_009105330.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009105331.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009105333.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009105334.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
Length=441

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -2

Query  456  GEPTPSAPVSTY--DNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            G    +APVS    D QLCPICL  PK+MAF CGHQTC DCG++L +CPICRSSI  RIK
Sbjct  380  GVAAATAPVSNARNDGQLCPICLVIPKNMAFNCGHQTCSDCGEDLHVCPICRSSISVRIK  439

Query  282  LY  277
            LY
Sbjct  440  LY  441



>gb|EEC69114.1| hypothetical protein OsI_38028 [Oryza sativa Indica Group]
Length=573

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PS      + QLCP+CLS P+DMAFGCGHQTC +CG +++ CPICR  I TR+KLY
Sbjct  518  PSVDARAAEPQLCPVCLSKPRDMAFGCGHQTCAECGPQVEHCPICRRPIDTRVKLY  573



>ref|XP_011071995.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
Length=431

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -2

Query  468  YDPRGEPTPSAPVS-TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQT  292
            +DP   P  S P S   +N LCPIC+S PKDMAFGCGHQTCC+CG++L  CPICR  I+T
Sbjct  369  HDP--APRTSEPRSHASENHLCPICISEPKDMAFGCGHQTCCECGQDLLSCPICRMPIET  426

Query  291  RIKLY  277
            RIKLY
Sbjct  427  RIKLY  431



>ref|XP_010511738.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Camelina 
sativa]
Length=453

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD     + + P +  + Q+CP+CL +PK+MAF CGHQTC +CGK+L +CPICRSSI  R
Sbjct  390  YDDSSVSSATPPTARNEGQVCPVCLMSPKNMAFNCGHQTCSECGKDLTVCPICRSSISVR  449

Query  288  IKLY  277
            IKLY
Sbjct  450  IKLY  453



>ref|XP_010511739.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Camelina 
sativa]
 ref|XP_010511740.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Camelina 
sativa]
Length=433

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  468  YDPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTR  289
            YD     + + P +  + Q+CP+CL +PK+MAF CGHQTC +CGK+L +CPICRSSI  R
Sbjct  370  YDDSSVSSATPPTARNEGQVCPVCLMSPKNMAFNCGHQTCSECGKDLTVCPICRSSISVR  429

Query  288  IKLY  277
            IKLY
Sbjct  430  IKLY  433



>ref|XP_010470708.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Camelina sativa]
Length=451

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  465  DPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            D  G  + + P +  + Q+CP+CL +PK+MAF CGHQTC +CGK+L +CPICRSSI  RI
Sbjct  389  DDSGVSSATPPTARNEGQVCPVCLMSPKNMAFNCGHQTCSECGKDLTVCPICRSSISVRI  448

Query  285  KLY  277
            KLY
Sbjct  449  KLY  451



>ref|XP_010470709.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Camelina sativa]
 ref|XP_010470710.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Camelina sativa]
Length=433

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  465  DPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            D  G  + + P +  + Q+CP+CL +PK+MAF CGHQTC +CGK+L +CPICRSSI  RI
Sbjct  371  DDSGVSSATPPTARNEGQVCPVCLMSPKNMAFNCGHQTCSECGKDLTVCPICRSSISVRI  430

Query  285  KLY  277
            KLY
Sbjct  431  KLY  433



>gb|EEE58278.1| hypothetical protein OsJ_09296 [Oryza sativa Japonica Group]
Length=174

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PS      + QLCP+CLS P+DMAFGCGHQTC +CG +++ CPICR  I TR+KLY
Sbjct  119  PSVDARAAEPQLCPVCLSKPRDMAFGCGHQTCAECGPQVEHCPICRRPIDTRVKLY  174



>ref|XP_010415367.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Camelina sativa]
Length=454

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = -2

Query  468  YDPRG--EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQ  295
            YD  G    TPS   +    Q+CP+CL +PK+MAF CGHQTC +CGK+L +CPICRSSI 
Sbjct  389  YDDSGISSATPSTARNEGQQQVCPVCLMSPKNMAFNCGHQTCSECGKDLTVCPICRSSIS  448

Query  294  TRIKLY  277
             RIKLY
Sbjct  449  VRIKLY  454



>emb|CDY01855.1| BnaC06g28950D [Brassica napus]
Length=441

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -2

Query  456  GEPTPSAPV--STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            G    +APV  +  D QLCPICL  PK+MAF CGHQTC DCG++L +CPICRSSI  RIK
Sbjct  380  GVAAATAPVPNARNDGQLCPICLVIPKNMAFNCGHQTCSDCGEDLHVCPICRSSISVRIK  439

Query  282  LY  277
            LY
Sbjct  440  LY  441



>ref|XP_010415369.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Camelina sativa]
 ref|XP_010415370.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Camelina sativa]
Length=434

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = -2

Query  468  YDPRG--EPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQ  295
            YD  G    TPS   +    Q+CP+CL +PK+MAF CGHQTC +CGK+L +CPICRSSI 
Sbjct  369  YDDSGISSATPSTARNEGQQQVCPVCLMSPKNMAFNCGHQTCSECGKDLTVCPICRSSIS  428

Query  294  TRIKLY  277
             RIKLY
Sbjct  429  VRIKLY  434



>emb|CDY56212.1| BnaAnng14100D [Brassica napus]
Length=441

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -2

Query  456  GEPTPSAPV--STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            G    +APV  +  D QLCPICL  PK+MAF CGHQTC DCG++L +CPICRSSI  RIK
Sbjct  380  GVAAATAPVPNARNDGQLCPICLVIPKNMAFNCGHQTCSDCGEDLHVCPICRSSISVRIK  439

Query  282  LY  277
            LY
Sbjct  440  LY  441



>ref|XP_010470707.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Camelina sativa]
Length=631

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  465  DPRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRI  286
            D  G  + + P +  + Q+CP+CL +PK+MAF CGHQTC +CGK+L +CPICRSSI  RI
Sbjct  569  DDSGVSSATPPTARNEGQVCPVCLMSPKNMAFNCGHQTCSECGKDLTVCPICRSSISVRI  628

Query  285  KLY  277
            KLY
Sbjct  629  KLY  631



>ref|XP_010246555.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nelumbo nucifera]
 ref|XP_010246556.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nelumbo nucifera]
 ref|XP_010246558.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nelumbo nucifera]
Length=422

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  438  APVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +P + ++NQ CP+C  + KD+AFGCGHQTC DCG+EL  CPICR++I TRIKLY
Sbjct  369  SPHNNHNNQTCPVCFWSAKDLAFGCGHQTCYDCGRELTSCPICRANITTRIKLY  422



>ref|XP_002977516.1| hypothetical protein SELMODRAFT_176218 [Selaginella moellendorffii]
 gb|EFJ21520.1| hypothetical protein SELMODRAFT_176218 [Selaginella moellendorffii]
Length=399

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             Y++QLCPICLS  KD+AFGCGHQTC DCGK L  CPICR  I TRI+LY
Sbjct  350  NYEHQLCPICLSERKDLAFGCGHQTCRDCGKSLANCPICRQRITTRIRLY  399



>ref|XP_002972204.1| hypothetical protein SELMODRAFT_148275 [Selaginella moellendorffii]
 gb|EFJ27121.1| hypothetical protein SELMODRAFT_148275 [Selaginella moellendorffii]
Length=399

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
             Y++QLCPICLS  KD+AFGCGHQTC DCGK L  CPICR  I TRI+LY
Sbjct  350  NYEHQLCPICLSERKDLAFGCGHQTCRDCGKSLANCPICRQRITTRIRLY  399



>gb|ABK24359.1| unknown [Picea sitchensis]
Length=423

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  426  TYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            T D Q+CPICL N KD+AFGCGHQTC DCG+ +  CPICRS I TRIKLY
Sbjct  374  TQDAQMCPICLMNAKDLAFGCGHQTCYDCGQNIVTCPICRSDITTRIKLY  423



>gb|EYU22209.1| hypothetical protein MIMGU_mgv1a006782mg [Erythranthe guttata]
Length=432

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = -2

Query  453  EPTPSAPVSTYD---NQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            +P P +P  + D   N LCPIC++ PK+MAF CGHQTCC CG+ + LCPICR  I+TRI+
Sbjct  371  DPVPRSPSRSNDASENHLCPICITEPKNMAFVCGHQTCCGCGETISLCPICRVPIETRIR  430

Query  282  LY  277
            LY
Sbjct  431  LY  432



>ref|XP_010531508.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RGLG2 
[Tarenaya hassleriana]
Length=449

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 3/58 (5%)
 Frame = -2

Query  441  SAPVSTYDN---QLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            +AP ST +N   Q+CP+C  N K+MAF CGHQTCC+CG++L  CPICRSSI  RIKLY
Sbjct  392  TAPPSTSNNDTQQVCPVCFGNQKNMAFNCGHQTCCECGEDLRTCPICRSSISIRIKLY  449



>ref|XP_006664503.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Oryza brachyantha]
Length=449

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PS      + QLCP+CLS P+DMAFGCGHQTC +CG +++ CPICR  I TR+KLY
Sbjct  394  PSTDARASEPQLCPVCLSKPRDMAFGCGHQTCAECGPQVEHCPICRRPIDTRVKLY  449



>ref|XP_010250085.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Nelumbo nucifera]
Length=376

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  462  PRGEPTPSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIK  283
            P  +P  S    ++D+  CPICLSNP++MAF CGHQTC +CG+ ++ CPICRS I +R++
Sbjct  315  PSVQPETSNSFQSFDHSTCPICLSNPRNMAFNCGHQTCGECGRRINNCPICRSPIGSRLR  374

Query  282  LY  277
            LY
Sbjct  375  LY  376



>ref|NP_001066593.1| Os12g0288400 [Oryza sativa Japonica Group]
 gb|ABA97133.2| copine, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29612.1| Os12g0288400 [Oryza sativa Japonica Group]
 dbj|BAG92271.1| unnamed protein product [Oryza sativa Japonica Group]
Length=546

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PS      + QLCP+CLS P+DMAFGCGHQTC +CG +++ CPICR  I TR+KLY
Sbjct  491  PSVDARAAEPQLCPVCLSKPRDMAFGCGHQTCAECGPQVEHCPICRRPIDTRVKLY  546



>ref|XP_010928043.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Elaeis guineensis]
Length=343

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  429  STYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            S  D ++CPICL   KD+AFGCGHQTC +CGK+L +CPIC+S I TRI+LY
Sbjct  293  SVQDKEICPICLWQAKDLAFGCGHQTCHECGKDLKVCPICQSQIATRIRLY  343



>ref|XP_002888625.1| hypothetical protein ARALYDRAFT_475885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64884.1| hypothetical protein ARALYDRAFT_475885 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  444  PSAPVSTYDNQLCPICLSNPKDMAFGCGHQTCCDCGKELDLCPICRSSIQTRIKLY  277
            PS   +    Q+CP+CL +PK++AF CGHQTC +CG++L++CPICRSSI  RIKLY
Sbjct  397  PSTTRNESQQQVCPVCLVSPKNLAFNCGHQTCSECGEDLNICPICRSSISVRIKLY  452



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115