BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050M11

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073284.1|  PREDICTED: succinate dehydrogenase assembly ...    147   1e-40   Sesamum indicum [beniseed]
ref|XP_010555590.1|  PREDICTED: uncharacterized protein LOC104825042    144   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_004235854.1|  PREDICTED: uncharacterized protein LOC101244854    142   8e-39   Solanum lycopersicum
gb|KFK36749.1|  hypothetical protein AALP_AA4G165000                    139   1e-37   Arabis alpina [alpine rockcress]
ref|NP_199917.1|  succinate dehydrogenase assembly factor 2             139   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341465.1|  PREDICTED: uncharacterized protein LOC102604677    139   2e-37   Solanum tuberosum [potatoes]
gb|AAM64715.1|  unknown                                                 139   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001032052.1|  succinate dehydrogenase assembly factor 2          139   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127327.1|  PREDICTED: succinate dehydrogenase assembly ...    138   5e-37   Brassica rapa
ref|XP_006281168.1|  hypothetical protein CARUB_v10027202mg             138   6e-37   Capsella rubella
emb|CDY16340.1|  BnaA02g11440D                                          138   6e-37   Brassica napus [oilseed rape]
emb|CDX91564.1|  BnaC02g15960D                                          137   8e-37   
gb|KDO57641.1|  hypothetical protein CISIN_1g039261mg                   136   2e-36   Citrus sinensis [apfelsine]
ref|XP_002864092.1|  hypothetical protein ARALYDRAFT_495170             136   2e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_009140882.1|  PREDICTED: uncharacterized protein LOC103864866    136   2e-36   Brassica rapa
emb|CDY05831.1|  BnaA10g05890D                                          136   3e-36   
ref|XP_007038172.1|  Uncharacterized protein TCM_014776                 135   5e-36   
emb|CDX71677.1|  BnaC09g27180D                                          133   6e-36   
ref|XP_006436982.1|  hypothetical protein CICLE_v10032866mg             135   7e-36   Citrus clementina [clementine]
ref|XP_010482431.1|  PREDICTED: uncharacterized protein LOC104761094    134   1e-35   Camelina sativa [gold-of-pleasure]
emb|CDO98294.1|  unnamed protein product                                134   2e-35   Coffea canephora [robusta coffee]
emb|CBI35625.3|  unnamed protein product                                132   6e-35   Vitis vinifera
gb|EYU21765.1|  hypothetical protein MIMGU_mgv1a014754mg                132   6e-35   Erythranthe guttata [common monkey flower]
ref|XP_008441916.1|  PREDICTED: uncharacterized protein LOC103485912    133   7e-35   
ref|XP_010646726.1|  PREDICTED: succinate dehydrogenase assembly ...    132   1e-34   Vitis vinifera
ref|XP_006402032.1|  hypothetical protein EUTSA_v10014773mg             131   2e-34   Eutrema salsugineum [saltwater cress]
ref|NP_001190509.1|  succinate dehydrogenase assembly factor 2          132   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152841.1|  PREDICTED: uncharacterized protein LOC101212517    131   2e-34   Cucumis sativus [cucumbers]
ref|XP_010667021.1|  PREDICTED: succinate dehydrogenase assembly ...    130   3e-34   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ53118.1|  JHL07K02.8                                             131   3e-34   Jatropha curcas
gb|KJB07930.1|  hypothetical protein B456_001G053700                    130   4e-34   Gossypium raimondii
ref|XP_002511076.1|  conserved hypothetical protein                     130   5e-34   Ricinus communis
gb|KHG15768.1|  Succinate dehydrogenase assembly factor 2, mitoch...    130   5e-34   Gossypium arboreum [tree cotton]
gb|KGN61232.1|  hypothetical protein Csa_2G072460                       132   6e-34   Cucumis sativus [cucumbers]
ref|XP_010250490.1|  PREDICTED: uncharacterized protein LOC104592726    129   8e-34   Nelumbo nucifera [Indian lotus]
ref|XP_003602736.1|  Succinate dehydrogenase assembly factor            128   2e-33   Medicago truncatula
ref|XP_011082843.1|  PREDICTED: succinate dehydrogenase assembly ...    128   3e-33   Sesamum indicum [beniseed]
ref|XP_002322310.1|  hypothetical protein POPTR_0015s11970g             128   3e-33   Populus trichocarpa [western balsam poplar]
ref|NP_001236603.1|  uncharacterized protein LOC100527478               127   7e-33   Glycine max [soybeans]
ref|XP_009373661.1|  PREDICTED: uncharacterized protein LOC103962643    127   9e-33   Pyrus x bretschneideri [bai li]
ref|XP_009786126.1|  PREDICTED: uncharacterized protein LOC104234290    127   1e-32   Nicotiana sylvestris
gb|KHG14755.1|  Succinate dehydrogenase assembly factor 2, mitoch...    126   1e-32   Gossypium arboreum [tree cotton]
ref|XP_007209673.1|  hypothetical protein PRUPE_ppa012247mg             126   2e-32   Prunus persica
gb|AFJ66165.1|  hypothetical protein 11M19.9                            125   2e-32   Arabidopsis halleri
gb|AFK43220.1|  unknown                                                 125   3e-32   Medicago truncatula
gb|KHN31242.1|  Succinate dehydrogenase assembly factor 2, mitoch...    125   4e-32   Glycine soja [wild soybean]
ref|XP_009339021.1|  PREDICTED: uncharacterized protein LOC103931...    125   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_008392686.1|  PREDICTED: uncharacterized protein LOC103454872    125   5e-32   
ref|XP_009339020.1|  PREDICTED: uncharacterized protein LOC103931...    125   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_009770861.1|  PREDICTED: uncharacterized protein LOC104221491    121   7e-32   Nicotiana sylvestris
gb|EPS59121.1|  hypothetical protein M569_15690                         124   8e-32   Genlisea aurea
gb|KCW58840.1|  hypothetical protein EUGRSUZ_H01475                     124   9e-32   Eucalyptus grandis [rose gum]
ref|XP_009622307.1|  PREDICTED: uncharacterized protein LOC104113746    121   1e-31   
ref|XP_010070209.1|  PREDICTED: uncharacterized protein LOC104456996    124   1e-31   Eucalyptus grandis [rose gum]
ref|XP_007137824.1|  hypothetical protein PHAVU_009G158800g             124   1e-31   Phaseolus vulgaris [French bean]
ref|XP_004300377.1|  PREDICTED: succinate dehydrogenase assembly ...    124   1e-31   Fragaria vesca subsp. vesca
ref|XP_004979384.1|  PREDICTED: uncharacterized protein LOC101756720    122   4e-31   Setaria italica
gb|AFK44704.1|  unknown                                                 122   5e-31   Lotus japonicus
ref|XP_008385758.1|  PREDICTED: uncharacterized protein LOC103448287    121   1e-30   Malus domestica [apple tree]
ref|NP_001235179.1|  uncharacterized protein LOC100500495               120   4e-30   Glycine max [soybeans]
gb|KHN09698.1|  Succinate dehydrogenase assembly factor 2, mitoch...    120   4e-30   Glycine soja [wild soybean]
ref|NP_001288385.1|  uncharacterized LOC103654411                       119   9e-30   Zea mays [maize]
gb|ACG25754.1|  TPR repeat region family protein                        119   1e-29   Zea mays [maize]
ref|XP_002449598.1|  hypothetical protein SORBIDRAFT_05g019780          119   1e-29   Sorghum bicolor [broomcorn]
gb|ABK26064.1|  unknown                                                 119   1e-29   Picea sitchensis
ref|XP_008670754.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    117   3e-29   Zea mays [maize]
gb|AFK36017.1|  unknown                                                 117   4e-29   Medicago truncatula
gb|KJB07931.1|  hypothetical protein B456_001G053700                    116   8e-29   Gossypium raimondii
ref|XP_006662965.1|  PREDICTED: uncharacterized protein LOC102700188    116   1e-28   Oryza brachyantha
gb|EMT20783.1|  hypothetical protein F775_28401                         112   5e-28   
ref|XP_008797117.1|  PREDICTED: succinate dehydrogenase assembly ...    114   5e-28   Phoenix dactylifera
ref|XP_003577516.1|  PREDICTED: succinate dehydrogenase assembly ...    114   6e-28   Brachypodium distachyon [annual false brome]
ref|XP_009413497.1|  PREDICTED: uncharacterized protein LOC103994785    113   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ90590.1|  predicted protein                                      113   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88942.1|  predicted protein                                      112   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS54449.1|  hypothetical protein TRIUR3_02167                       110   3e-27   Triticum urartu
ref|XP_010929714.1|  PREDICTED: uncharacterized protein LOC105051113    112   4e-27   Elaeis guineensis
ref|XP_008239648.1|  PREDICTED: uncharacterized protein LOC103338241    108   5e-27   
ref|XP_006844641.1|  hypothetical protein AMTR_s00016p00232260          111   8e-27   Amborella trichopoda
gb|KHG13985.1|  Carbonyl reductase [NADPH] 1                            114   2e-26   Gossypium arboreum [tree cotton]
ref|NP_001068002.1|  Os11g0528300                                       110   2e-26   
gb|KHG13984.1|  Carbonyl reductase [NADPH] 1                            114   2e-26   Gossypium arboreum [tree cotton]
gb|EAY81147.1|  hypothetical protein OsI_36329                          109   7e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001235051.1|  uncharacterized protein LOC100527878               107   2e-25   Glycine max [soybeans]
ref|XP_004503818.1|  PREDICTED: uncharacterized protein LOC101502675    107   4e-25   Cicer arietinum [garbanzo]
tpg|DAA42045.1|  TPA: hypothetical protein ZEAMMB73_302044              102   3e-24   
ref|XP_002973356.1|  hypothetical protein SELMODRAFT_98920              103   3e-24   
gb|KHN16894.1|  (+)-neomenthol dehydrogenase                            107   5e-24   Glycine soja [wild soybean]
gb|AFJ66194.1|  hypothetical protein 7G9.12                             103   1e-23   Boechera stricta
gb|AFJ66223.1|  hypothetical protein 34G24.28                         91.3    2e-19   Capsella rubella
ref|XP_001752564.1|  predicted protein                                84.0    6e-17   
ref|XP_010112900.1|  hypothetical protein L484_017736                 83.2    3e-16   
ref|XP_001694005.1|  predicted protein                                82.0    6e-16   Chlamydomonas reinhardtii
ref|XP_011040389.1|  PREDICTED: uncharacterized protein LOC105136661  75.1    3e-13   Populus euphratica
ref|XP_001415883.1|  predicted protein                                71.2    9e-13   Ostreococcus lucimarinus CCE9901
ref|XP_002956425.1|  hypothetical protein VOLCADRAFT_66963            68.6    1e-11   Volvox carteri f. nagariensis
ref|XP_005644390.1|  hypothetical protein COCSUDRAFT_67604            68.9    1e-11   Coccomyxa subellipsoidea C-169
ref|XP_003074399.1|  unnamed protein product                          69.3    1e-11   Ostreococcus tauri
ref|XP_007515400.1|  predicted protein                                65.1    7e-10   Bathycoccus prasinos
ref|XP_003056014.1|  predicted protein                                64.3    9e-10   Micromonas pusilla CCMP1545
ref|XP_002507517.1|  hypothetical protein MICPUN_113604               62.4    3e-09   Micromonas commoda
ref|XP_011082852.1|  PREDICTED: succinate dehydrogenase assembly ...  55.8    5e-07   
ref|XP_005845121.1|  hypothetical protein CHLNCDRAFT_137510           55.8    6e-07   Chlorella variabilis
gb|KIZ01550.1|  hypothetical protein MNEG_6410                        56.2    1e-06   Monoraphidium neglectum
gb|KCW58842.1|  hypothetical protein EUGRSUZ_H01475                   55.1    1e-06   Eucalyptus grandis [rose gum]



>ref|XP_011073284.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Sesamum indicum]
Length=179

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ETGIK+LVHVLD+ENPDLWKWLTGQE  P+ +  NPVF SV  ++ NNLD HAAPETRAT
Sbjct  96   ETGIKSLVHVLDLENPDLWKWLTGQEQPPEAVNANPVFASVKERVTNNLDNHAAPETRAT  155

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQSWVRGWDDFKRGRDSPIAGNQ
Sbjct  156  PGQSWVRGWDDFKRGRDSPIAGNQ  179



>ref|XP_010555590.1| PREDICTED: uncharacterized protein LOC104825042 [Tarenaya hassleriana]
Length=187

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+KAL+HVLD+ENPDLWKWLT QE AP+ +RTNPVF+++H K+M NL+KHAAPETRA 
Sbjct  104  ENGVKALIHVLDLENPDLWKWLTDQEQAPEAVRTNPVFSALHDKVMKNLNKHAAPETRAV  163

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFK+GRD+PIAGNQ
Sbjct  164  PGQPWVKGWDDFKKGRDAPIAGNQ  187



>ref|XP_004235854.1| PREDICTED: uncharacterized protein LOC101244854 [Solanum lycopersicum]
Length=184

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LVHVLD+ENPDLWKWLTGQE  PD I TNPVF++VH K+MNNL+ H +PETRA 
Sbjct  101  ENGIKSLVHVLDLENPDLWKWLTGQEQPPDAISTNPVFSAVHEKVMNNLNNHTSPETRAV  160

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD KRGRD+PIAGNQ
Sbjct  161  PGKPWVRGWDDIKRGRDAPIAGNQ  184



>gb|KFK36749.1| hypothetical protein AALP_AA4G165000 [Arabis alpina]
Length=187

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ET +K+L+HVLD+ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  104  ETTVKSLIHVLDLENPDLWKWLTDQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAA  163

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  164  AGQPWVRGWDDFKRGRDAPISGNQ  187



>ref|NP_199917.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
 sp|Q9FI44.1|SDAF2_ARATH RecName: Full=Succinate dehydrogenase assembly factor 2, mitochondrial; 
Short=SDH assembly factor 2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08750.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABF58960.1| At5g51040 [Arabidopsis thaliana]
 dbj|BAF01071.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96024.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
Length=188

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+K+L+HVL++ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  105  ENGVKSLIHVLNLENPDLWKWLTEQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAA  164

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  165  AGQPWVRGWDDFKRGRDAPISGNQ  188



>ref|XP_006341465.1| PREDICTED: uncharacterized protein LOC102604677 [Solanum tuberosum]
Length=184

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LVHVLD+ENPDLWKWLTGQE  PD I TNPVF++V  K+MNNL+ H++PETRA 
Sbjct  101  ENGIKSLVHVLDLENPDLWKWLTGQEQPPDAISTNPVFSAVREKVMNNLNNHSSPETRAV  160

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD K+GRD+PIAGNQ
Sbjct  161  PGKPWVRGWDDIKKGRDAPIAGNQ  184



>gb|AAM64715.1| unknown [Arabidopsis thaliana]
Length=188

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+K+L+HVL++ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  105  ENGVKSLIHVLNLENPDLWKWLTEQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAA  164

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  165  AGQPWVRGWDDFKRGRDTPISGNQ  188



>ref|NP_001032052.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
 dbj|BAH19854.1| AT5G51040 [Arabidopsis thaliana]
 gb|AED96025.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
Length=184

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+K+L+HVL++ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  101  ENGVKSLIHVLNLENPDLWKWLTEQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAA  160

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  161  AGQPWVRGWDDFKRGRDAPISGNQ  184



>ref|XP_009127327.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
[Brassica rapa]
Length=181

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ET +K+L+HVLD+ENPDLWKWLT QE  P+ + +NPVF ++H K+M NL+KHAAPETRA 
Sbjct  98   ETAVKSLIHVLDLENPDLWKWLTAQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAA  157

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  158  AGQPWVKGWDDFKRGRDAPISGNQ  181



>ref|XP_006281168.1| hypothetical protein CARUB_v10027202mg [Capsella rubella]
 gb|EOA14066.1| hypothetical protein CARUB_v10027202mg [Capsella rubella]
Length=185

 Score =   138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+G+K+L+HVL++ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  102  ESGVKSLIHVLNLENPDLWKWLTEQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAA  161

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  162  AGQPWVKGWDDFKRGRDAPISGNQ  185



>emb|CDY16340.1| BnaA02g11440D [Brassica napus]
Length=181

 Score =   138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ET +K+L+HVLD+ENPDLWKWLT QE  P+ + +NPVF ++H K+M NL+KHAAPETRA 
Sbjct  98   ETAVKSLIHVLDLENPDLWKWLTAQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAA  157

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  158  AGQPWVKGWDDFKRGRDAPISGNQ  181



>emb|CDX91564.1| BnaC02g15960D [Brassica napus]
Length=191

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ET +K+L+HVLD+ENPDLWKWLT QE  P+ + +NPVF ++H K+M NL+KHAAPETRA 
Sbjct  108  ETAVKSLIHVLDLENPDLWKWLTSQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAA  167

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  168  AGQPWVKGWDDFKRGRDAPISGNQ  191



>gb|KDO57641.1| hypothetical protein CISIN_1g039261mg [Citrus sinensis]
Length=182

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALV VL++ENPDLWKWLTGQE  P+ ++TNPVF+++H K+MNNL+ +A+PETR+ 
Sbjct  99   ENGIKALVDVLNLENPDLWKWLTGQEQPPEAVKTNPVFSALHNKVMNNLNSYASPETRSE  158

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFK+GRDSP++GNQ
Sbjct  159  PGQPWVRGWDDFKKGRDSPLSGNQ  182



>ref|XP_002864092.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40351.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+K+L+HVL++ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  102  ENGVKSLIHVLNLENPDLWKWLTEQEQPPEEVSSNPVFSALHEKVMKNLNKHAAPETRAA  161

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  162  AGQPWVKGWDDFKRGRDAPISGNQ  185



>ref|XP_009140882.1| PREDICTED: uncharacterized protein LOC103864866 [Brassica rapa]
Length=187

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  +K+L+HVLD+ENPDLWKWLTGQE  P+ + +NPVF ++H K+M NL+KHAAPETRA 
Sbjct  104  ENTVKSLIHVLDLENPDLWKWLTGQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAE  163

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  164  AGQPWVKGWDDFKRGRDAPISGNQ  187



>emb|CDY05831.1| BnaA10g05890D [Brassica napus]
Length=187

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  +K+L+HVLD+ENPDLWKWLTGQE  P+ + +NPVF ++H K+M NL+KHAAPETRA 
Sbjct  104  ENTVKSLIHVLDLENPDLWKWLTGQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPETRAE  163

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  164  AGQPWVKGWDDFKRGRDAPISGNQ  187



>ref|XP_007038172.1| Uncharacterized protein TCM_014776 [Theobroma cacao]
 gb|EOY22673.1| Uncharacterized protein TCM_014776 [Theobroma cacao]
Length=178

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALVHVLD+ENPDLWKWLTGQE  P+ +  NPVF++V  K++ NL+ H+APETRAT
Sbjct  95   ENGIKALVHVLDLENPDLWKWLTGQEQPPETVSINPVFSTVQEKVLKNLNSHSAPETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+GRDSPI GNQ
Sbjct  155  PGQPWVRGWDDIKKGRDSPITGNQ  178



>emb|CDX71677.1| BnaC09g27180D [Brassica napus]
Length=118

 Score =   133 bits (335),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  +K+L+HVLD+ENPDLWKWLTGQE  P+ + +NPVF ++H K+M NL+KHAAP+TRA 
Sbjct  35   ENTVKSLIHVLDLENPDLWKWLTGQEQPPEIVSSNPVFLALHKKVMTNLNKHAAPKTRAE  94

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  95   AGQPWVKGWDDFKRGRDAPISGNQ  118



>ref|XP_006436982.1| hypothetical protein CICLE_v10032866mg [Citrus clementina]
 ref|XP_006485065.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
[Citrus sinensis]
 gb|ESR50222.1| hypothetical protein CICLE_v10032866mg [Citrus clementina]
Length=182

 Score =   135 bits (339),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            + GIKALV VL++ENPDLWKWLTGQE  P+ ++TNPVF+++H K+MNNL+ +A+PETR+ 
Sbjct  99   KNGIKALVDVLNLENPDLWKWLTGQEQPPEAVKTNPVFSALHNKVMNNLNSYASPETRSE  158

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFK+GRDSP++GNQ
Sbjct  159  PGQPWVRGWDDFKKGRDSPLSGNQ  182



>ref|XP_010482431.1| PREDICTED: uncharacterized protein LOC104761094 [Camelina sativa]
Length=185

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+G+++L+HVL++ENPDLW WLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  102  ESGVQSLIHVLNLENPDLWNWLTEQEQPPEAVSSNPVFSALHEKVMKNLNKHAAPETRAA  161

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  162  AGQPWVKGWDDFKRGRDAPISGNQ  185



>emb|CDO98294.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALVHVLD+ENPDLWKWLTGQ   P+ +R NPVF  V  +++NNL+ HA+PETRAT
Sbjct  98   ENGIKALVHVLDLENPDLWKWLTGQGQPPEAVRMNPVFADVQKRVVNNLNSHASPETRAT  157

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFK+GRD P  GNQ
Sbjct  158  PGQPWVRGWDDFKKGRDGPAVGNQ  181



>emb|CBI35625.3| unnamed protein product [Vitis vinifera]
Length=174

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTG  403
            GIK+LVHVLD+ENPDLWKWLTGQE  P+ +  NPVF +V  K+MNNL+ H+APETRA  G
Sbjct  93   GIKSLVHVLDLENPDLWKWLTGQEQPPEAVSINPVFCAVREKVMNNLNSHSAPETRAMPG  152

Query  402  QSWVRGWDDFKRGRDSPIAGNQ  337
            + WVRGWDD K+GRDSP++GNQ
Sbjct  153  KPWVRGWDDIKKGRDSPVSGNQ  174



>gb|EYU21765.1| hypothetical protein MIMGU_mgv1a014754mg [Erythranthe guttata]
Length=179

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+GIK+LVHVLD+ENPDLW WLTGQE  P+ +  NPVF +V  K+  NL+K +AP+TRAT
Sbjct  97   ESGIKSLVHVLDLENPDLWNWLTGQEQPPEAVNVNPVFVAVREKVAKNLEK-SAPQTRAT  155

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
            TGQSWVRGWDD K+GRDSPIAGNQ
Sbjct  156  TGQSWVRGWDDVKKGRDSPIAGNQ  179



>ref|XP_008441916.1| PREDICTED: uncharacterized protein LOC103485912 [Cucumis melo]
 ref|XP_008441917.1| PREDICTED: uncharacterized protein LOC103485912 [Cucumis melo]
Length=200

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTG  403
            GI+ L++VLD+ENPDLWKWLTGQE  P+ ++TNPVFT V  K+MNNL+KHA+PETR   G
Sbjct  119  GIRDLINVLDLENPDLWKWLTGQEQPPEALKTNPVFTGVKEKVMNNLNKHASPETRTPPG  178

Query  402  QSWVRGWDDFKRGRDSPIAGNQ  337
            Q WVRGWDDFK+GRD PI GNQ
Sbjct  179  QQWVRGWDDFKKGRDGPITGNQ  200



>ref|XP_010646726.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Vitis vinifera]
Length=187

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTG  403
            GIK+LVHVLD+ENPDLWKWLTGQE  P+ +  NPVF +V  K+MNNL+ H+APETRA  G
Sbjct  106  GIKSLVHVLDLENPDLWKWLTGQEQPPEAVSINPVFCAVREKVMNNLNSHSAPETRAMPG  165

Query  402  QSWVRGWDDFKRGRDSPIAGNQ  337
            + WVRGWDD K+GRDSP++GNQ
Sbjct  166  KPWVRGWDDIKKGRDSPVSGNQ  187



>ref|XP_006402032.1| hypothetical protein EUTSA_v10014773mg [Eutrema salsugineum]
 gb|ESQ43485.1| hypothetical protein EUTSA_v10014773mg [Eutrema salsugineum]
Length=187

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  +K+L+ VL +ENPDLWKWLTGQE  P+ + +NPVF ++H K+M NL+KHAAPETRA 
Sbjct  104  ENAVKSLIDVLGLENPDLWKWLTGQEQPPEAVSSNPVFMALHEKVMKNLNKHAAPETRAA  163

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDDFK+GRD+PI+GNQ
Sbjct  164  AGEPWVRGWDDFKKGRDAPISGNQ  187



>ref|NP_001190509.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
 gb|AED96026.1| succinate dehydrogenase assembly factor 2 [Arabidopsis thaliana]
Length=197

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 9/93 (10%)
 Frame = -1

Query  588  ETGIKALVHVLDV---------ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDK  436
            E G+K+L+HVL++         ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+K
Sbjct  105  ENGVKSLIHVLNLVESEATKLLENPDLWKWLTEQEQPPEAVSSNPVFSALHEKVMKNLNK  164

Query  435  HAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  337
            HAAPETRA  GQ WVRGWDDFKRGRD+PI+GNQ
Sbjct  165  HAAPETRAAAGQPWVRGWDDFKRGRDAPISGNQ  197



>ref|XP_004152841.1| PREDICTED: uncharacterized protein LOC101212517 [Cucumis sativus]
 ref|XP_004170864.1| PREDICTED: uncharacterized LOC101212517 [Cucumis sativus]
Length=198

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTG  403
            GI+AL++VLD+ENPDLWKWLTGQE  P+ ++TNPVFT V  K+++NL+KHA+PETR   G
Sbjct  117  GIRALINVLDLENPDLWKWLTGQEQPPEALKTNPVFTGVKEKVIDNLNKHASPETRTPPG  176

Query  402  QSWVRGWDDFKRGRDSPIAGNQ  337
            Q WVRGWDDFK+GRD PI GNQ
Sbjct  177  QQWVRGWDDFKKGRDGPITGNQ  198



>ref|XP_010667021.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010667022.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010667023.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010667024.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+L+ VLD+ENPDLW WL+GQE  P+ I  NPVFT+V  K+ +NL+ HAAPETRAT
Sbjct  98   ENGIKSLIQVLDLENPDLWNWLSGQEQPPESISVNPVFTAVREKVASNLNNHAAPETRAT  157

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG+DSP++GNQ
Sbjct  158  PGQPWVRGWDDIKRGKDSPVSGNQ  181



>dbj|BAJ53118.1| JHL07K02.8 [Jatropha curcas]
 gb|KDP22524.1| hypothetical protein JCGZ_26355 [Jatropha curcas]
Length=188

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALVH+LD+ENPDLWKWLT QE  P+ + TNPVF++V  K+MNNL++HAAPETRA 
Sbjct  105  ENGIKALVHLLDLENPDLWKWLTCQEQPPEAVSTNPVFSAVRDKVMNNLNRHAAPETRAI  164

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+   SP+AGNQ
Sbjct  165  PGQPWVRGWDDIKKSPGSPVAGNQ  188



>gb|KJB07930.1| hypothetical protein B456_001G053700 [Gossypium raimondii]
Length=178

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALV+VLD+ENPDLWKWLTGQE  P+ +  NPVF++V  K++ NL+ H++PETRAT
Sbjct  95   ENGIKALVNVLDLENPDLWKWLTGQEQPPEAVTINPVFSAVQQKVLKNLNNHSSPETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD K+GRDSPI GNQ
Sbjct  155  RGRPWVRGWDDIKKGRDSPITGNQ  178



>ref|XP_002511076.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51678.1| conserved hypothetical protein [Ricinus communis]
Length=188

 Score =   130 bits (327),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALVHVLD+ENPDLWKWLTGQE  P+ +  NPVF++V  KIMNNLD HA+PETRA 
Sbjct  105  ENGIKALVHVLDLENPDLWKWLTGQEQPPEAVNINPVFSAVRDKIMNNLDSHASPETRAI  164

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+   SP+ GNQ
Sbjct  165  PGQPWVRGWDDIKKNPGSPVGGNQ  188



>gb|KHG15768.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Gossypium 
arboreum]
Length=198

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALV VLD+ENPDLWKWLTGQE  P+ +  NPVF++V  +++ NL+ H++PETRAT
Sbjct  115  ENGIKALVKVLDLENPDLWKWLTGQEQPPEAVTVNPVFSAVQQRVLKNLNNHSSPETRAT  174

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+GRDSPI GNQ
Sbjct  175  PGQPWVRGWDDIKKGRDSPITGNQ  198



>gb|KGN61232.1| hypothetical protein Csa_2G072460 [Cucumis sativus]
Length=265

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTG  403
            GI+AL++VLD+ENPDLWKWLTGQE  P+ ++TNPVFT V  K+++NL+KHA+PETR   G
Sbjct  184  GIRALINVLDLENPDLWKWLTGQEQPPEALKTNPVFTGVKEKVIDNLNKHASPETRTPPG  243

Query  402  QSWVRGWDDFKRGRDSPIAGNQ  337
            Q WVRGWDDFK+GRD PI GNQ
Sbjct  244  QQWVRGWDDFKKGRDGPITGNQ  265



>ref|XP_010250490.1| PREDICTED: uncharacterized protein LOC104592726 [Nelumbo nucifera]
 ref|XP_010250491.1| PREDICTED: uncharacterized protein LOC104592726 [Nelumbo nucifera]
Length=183

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ET IKAL+ VLD+ENPDLW WLTGQ+  P+ +  NPVF+S+  K+MNNL+ H+APETRA 
Sbjct  100  ETRIKALIDVLDLENPDLWNWLTGQDQPPEAVNQNPVFSSLRDKVMNNLNSHSAPETRAI  159

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+GRDSPI+GNQ
Sbjct  160  PGQPWVRGWDDIKKGRDSPISGNQ  183



>ref|XP_003602736.1| Succinate dehydrogenase assembly factor [Medicago truncatula]
 gb|AES72987.1| flavinator of succinate dehydrogenase [Medicago truncatula]
Length=176

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKAL+HVLD+ENPDLWKW++GQE  P+ +  NPVF ++  K+M NLD H+APETRAT
Sbjct  93   ENRIKALIHVLDLENPDLWKWISGQEQPPESVDVNPVFAALRGKVMKNLDSHSAPETRAT  152

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+GRD+P +GNQ
Sbjct  153  LGQPWVRGWDDIKKGRDAPASGNQ  176



>ref|XP_011082843.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=177

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+GI++LVHVLD+ENPDLWKWLT Q   P+ ++ N VF ++  K+++NLD HAAPETRAT
Sbjct  94   ESGIRSLVHVLDLENPDLWKWLTCQGQPPEAVKKNLVFMALRAKVVSNLDNHAAPETRAT  153

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDDFK+GRD PI GNQ
Sbjct  154  PGQPWVRGWDDFKKGRDGPITGNQ  177



>ref|XP_002322310.1| hypothetical protein POPTR_0015s11970g [Populus trichocarpa]
 gb|EEF06437.1| hypothetical protein POPTR_0015s11970g [Populus trichocarpa]
Length=186

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+KAL+ VLD+ENPDLWKWLTGQE  P+ +  NPVF++V  KIMNNL  HAAPETRA 
Sbjct  103  ENGVKALIDVLDLENPDLWKWLTGQEQPPEAVSINPVFSAVRDKIMNNLSSHAAPETRAI  162

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+   SP+AGNQ
Sbjct  163  PGQPWVRGWDDIKKSAGSPVAGNQ  186



>ref|NP_001236603.1| uncharacterized protein LOC100527478 [Glycine max]
 gb|ACU16572.1| unknown [Glycine max]
Length=177

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKAL+HVLD+ENPDLWKW++GQE  P+ + TNPVF +V  ++M NLD H APE RAT
Sbjct  94   EIRIKALIHVLDLENPDLWKWISGQEQPPESVSTNPVFAAVRERVMKNLDNHPAPEVRAT  153

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P++GNQ
Sbjct  154  PGQPWVRGWDDIKKGQDGPVSGNQ  177



>ref|XP_009373661.1| PREDICTED: uncharacterized protein LOC103962643 [Pyrus x bretschneideri]
Length=178

 Score =   127 bits (318),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LV VLD+ENPDLWKWL+GQE  P+ ++TNPVFT+V  KIMNNL+ +A+PETRAT
Sbjct  95   EQGIKSLVDVLDLENPDLWKWLSGQEQPPEALQTNPVFTAVRNKIMNNLNSYASPETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+ +  P+ GNQ
Sbjct  155  PGQPWVRGWDDIKKSQGGPLTGNQ  178



>ref|XP_009786126.1| PREDICTED: uncharacterized protein LOC104234290 [Nicotiana sylvestris]
Length=182

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+K+LV+VLD+ENPDLWKWL+GQE  PD I TN VF++V  K+MNNL KHAAPETRA 
Sbjct  97   EDGVKSLVNVLDLENPDLWKWLSGQEQPPDAISTNSVFSAVREKVMNNLGKHAAPETRAA  156

Query  408  TGQ--SWVRGWDDFKRGRDSPIAGNQ  337
             G    WVRGWDDFK+ +D PIAGNQ
Sbjct  157  AGSLGPWVRGWDDFKKAQDGPIAGNQ  182



>gb|KHG14755.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Gossypium 
arboreum]
Length=178

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALV+VLD+ENPDLWKWLTGQE  P+ +  NPVF++V  K++ NL+ H++ ETRAT
Sbjct  95   ENGIKALVNVLDLENPDLWKWLTGQEQPPEAVTLNPVFSAVQQKVLKNLNNHSSLETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD K+GRDSPI GNQ
Sbjct  155  PGRPWVRGWDDIKKGRDSPITGNQ  178



>ref|XP_007209673.1| hypothetical protein PRUPE_ppa012247mg [Prunus persica]
 gb|EMJ10872.1| hypothetical protein PRUPE_ppa012247mg [Prunus persica]
Length=178

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LV VLD+ENP LWKWL GQE  P+ ++TNPVFT+V  K++NNL+ +AAPETRAT
Sbjct  95   ENGIKSLVDVLDLENPYLWKWLIGQEQPPEALKTNPVFTAVRNKVLNNLNSYAAPETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+  PI GNQ
Sbjct  155  PGQPWVRGWDDIKKGQGGPITGNQ  178



>gb|AFJ66165.1| hypothetical protein 11M19.9 [Arabidopsis halleri]
Length=145

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 5/84 (6%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+K+L+HVL++ENPDLWKWLT QE  P+      VF+++H K+M NL+KHAAPETRA 
Sbjct  67   ENGVKSLIHVLNLENPDLWKWLTEQEQPPEA-----VFSALHEKVMKNLNKHAAPETRAA  121

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  122  AGQPWVKGWDDFKRGRDAPISGNQ  145



>gb|AFK43220.1| unknown [Medicago truncatula]
Length=176

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKAL+HVLD+ENPDLWKW++GQE   + +  NPVF ++  K+M NLD H+APETRAT
Sbjct  93   ENRIKALIHVLDLENPDLWKWISGQEQPSESVDVNPVFAALRGKVMKNLDSHSAPETRAT  152

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+GRD+P +GNQ
Sbjct  153  LGQPWVRGWDDIKKGRDAPASGNQ  176



>gb|KHN31242.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Glycine 
soja]
Length=177

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKAL+HVLD+ENPDLWKW++GQE  P+ + TNPVF +V  ++M NLD H+APE RAT
Sbjct  94   EIRIKALIHVLDLENPDLWKWISGQEQPPESVSTNPVFAAVRERVMKNLDNHSAPEVRAT  153

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+  P++GNQ
Sbjct  154  PGQPWVRGWDDIKKGQGGPVSGNQ  177



>ref|XP_009339021.1| PREDICTED: uncharacterized protein LOC103931302 isoform X2 [Pyrus 
x bretschneideri]
Length=178

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LV VLD+ENPDLWKWL GQE  P+ ++TNPVFT+V  KI NNL+ +AAPETRAT
Sbjct  95   EQGIKSLVDVLDLENPDLWKWLIGQEQPPEALQTNPVFTAVRNKITNNLNSYAAPETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+ +  PI GNQ
Sbjct  155  PGQPWVRGWDDIKKSQGGPITGNQ  178



>ref|XP_008392686.1| PREDICTED: uncharacterized protein LOC103454872 [Malus domestica]
Length=178

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LV VLD+ENPDLWKWL+GQE  P+ ++TNPVFT+V  KI NNL+ +AAPETRAT
Sbjct  95   ERGIKSLVDVLDLENPDLWKWLSGQEQPPEALQTNPVFTAVRNKIXNNLNSYAAPETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+ +  P+ GNQ
Sbjct  155  PGQPWVRGWDDIKKSQGGPLTGNQ  178



>ref|XP_009339020.1| PREDICTED: uncharacterized protein LOC103931302 isoform X1 [Pyrus 
x bretschneideri]
Length=185

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LV VLD+ENPDLWKWL GQE  P+ ++TNPVFT+V  KI NNL+ +AAPETRAT
Sbjct  102  EQGIKSLVDVLDLENPDLWKWLIGQEQPPEALQTNPVFTAVRNKITNNLNSYAAPETRAT  161

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+ +  PI GNQ
Sbjct  162  PGQPWVRGWDDIKKSQGGPITGNQ  185



>ref|XP_009770861.1| PREDICTED: uncharacterized protein LOC104221491, partial [Nicotiana 
sylvestris]
Length=71

 Score =   121 bits (303),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -1

Query  549  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  370
            ENPDLWKWLTGQE  PD I TNPVF++V  K+MNNLDKHA+PETRA  G+ WVRGWDD K
Sbjct  1    ENPDLWKWLTGQEQPPDAISTNPVFSAVREKVMNNLDKHASPETRAVPGKPWVRGWDDIK  60

Query  369  RGRDSPIAGNQ  337
            RGRD+PIAGNQ
Sbjct  61   RGRDAPIAGNQ  71



>gb|EPS59121.1| hypothetical protein M569_15690 [Genlisea aurea]
Length=153

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+GIK+L  VLD+ENPDLW WL+GQ+  P+ + TNPVF +V  K+  NLD +AAPETRA 
Sbjct  70   ESGIKSLARVLDLENPDLWAWLSGQDTPPEVVSTNPVFLAVREKVSKNLDSYAAPETRAV  129

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD+K+GRD PI+GNQ
Sbjct  130  PGQPWVRGWDDYKKGRDGPISGNQ  153



>gb|KCW58840.1| hypothetical protein EUGRSUZ_H01475 [Eucalyptus grandis]
Length=193

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTG  403
            GIKALV  LD ENPDLWKWLT QE  P+ ++ NPVF++V  K+MNNL+ H+APETRA  G
Sbjct  112  GIKALVDFLDWENPDLWKWLTNQEQPPEAVKMNPVFSAVQKKVMNNLNSHSAPETRALPG  171

Query  402  QSWVRGWDDFKRGRDSPIAGNQ  337
            Q WVRGWDD K+GRD PI GNQ
Sbjct  172  QPWVRGWDDIKKGRDGPITGNQ  193



>ref|XP_009622307.1| PREDICTED: uncharacterized protein LOC104113746 [Nicotiana tomentosiformis]
Length=78

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -1

Query  549  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  370
            ENPDLWKWLTGQE  PD I TNPVF++V  K+MNNLDKHA+PETRA  G+ WVRGWDD K
Sbjct  8    ENPDLWKWLTGQEQPPDAIITNPVFSAVREKVMNNLDKHASPETRAVPGKPWVRGWDDIK  67

Query  369  RGRDSPIAGNQ  337
            RGRD+PIAGNQ
Sbjct  68   RGRDAPIAGNQ  78



>ref|XP_010070209.1| PREDICTED: uncharacterized protein LOC104456996 [Eucalyptus grandis]
 gb|KCW58841.1| hypothetical protein EUGRSUZ_H01475 [Eucalyptus grandis]
Length=192

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTG  403
            GIKALV  LD ENPDLWKWLT QE  P+ ++ NPVF++V  K+MNNL+ H+APETRA  G
Sbjct  111  GIKALVDFLDWENPDLWKWLTNQEQPPEAVKMNPVFSAVQKKVMNNLNSHSAPETRALPG  170

Query  402  QSWVRGWDDFKRGRDSPIAGNQ  337
            Q WVRGWDD K+GRD PI GNQ
Sbjct  171  QPWVRGWDDIKKGRDGPITGNQ  192



>ref|XP_007137824.1| hypothetical protein PHAVU_009G158800g [Phaseolus vulgaris]
 gb|ESW09818.1| hypothetical protein PHAVU_009G158800g [Phaseolus vulgaris]
Length=182

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKAL+HVL++ENPDLWKW++GQE  P+ + TNPVF +VH ++M NLD H+APE RAT
Sbjct  99   ENRIKALIHVLNLENPDLWKWISGQEQPPESVSTNPVFAAVHERVMKNLDSHSAPEVRAT  158

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV GWDD ++G+  P++GNQ
Sbjct  159  PGQPWVSGWDDIQKGQHGPVSGNQ  182



>ref|XP_004300377.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=178

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+GIKALV VLDVENPDLWKWL+GQE  P  + TNPVFT+V  K+  NLD +AAPETRAT
Sbjct  95   ESGIKALVDVLDVENPDLWKWLSGQEQPPQALITNPVFTAVRNKVTKNLDSYAAPETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G  WVRGWDD K+ +  PI GNQ
Sbjct  155  PGNPWVRGWDDIKKYKGGPITGNQ  178



>ref|XP_004979384.1| PREDICTED: uncharacterized protein LOC101756720 [Setaria italica]
Length=175

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+ I+AL+ VLD+ENPDLWKW TGQE  P+ + +NPVFT++ +K+ +NL KHA+PETR+T
Sbjct  92   ESNIRALLQVLDLENPDLWKWFTGQEQPPEDLNSNPVFTAIKSKVTDNLSKHASPETRST  151

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P  GNQ
Sbjct  152  PGQPWVRGWDDIKKGKDGPKYGNQ  175



>gb|AFK44704.1| unknown [Lotus japonicus]
Length=179

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IK+L+HVLD+ENPDLWKWL+GQE  P+ I  NPVF ++  K+M NLD HAAPE RA 
Sbjct  96   ENRIKSLIHVLDLENPDLWKWLSGQEQPPESISANPVFAAIKEKLMKNLDSHAAPEVRAM  155

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G   P+ GNQ
Sbjct  156  PGQPWVRGWDDIKKGPGGPVTGNQ  179



>ref|XP_008385758.1| PREDICTED: uncharacterized protein LOC103448287 [Malus domestica]
Length=178

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIK+LV VL++ENPDLWKWL GQE  P+ ++TNPVFT+V  KI NNL+ +AA ETRAT
Sbjct  95   EQGIKSLVDVLNLENPDLWKWLIGQEQPPEALQTNPVFTAVRNKITNNLNSYAASETRAT  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+ +  PI GNQ
Sbjct  155  PGQPWVRGWDDIKKSQGCPITGNQ  178



>ref|NP_001235179.1| uncharacterized protein LOC100500495 [Glycine max]
 gb|ACU15595.1| unknown [Glycine max]
Length=182

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKAL+HVLD+ENPDLWKW++GQE  P+ +  N VF +V  ++  NLD H+APE RAT
Sbjct  99   ENRIKALIHVLDLENPDLWKWISGQEQPPESVSANLVFAAVRERVKKNLDIHSAPEVRAT  158

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P++GNQ
Sbjct  159  PGQPWVRGWDDIKKGQDGPVSGNQ  182



>gb|KHN09698.1| Succinate dehydrogenase assembly factor 2, mitochondrial [Glycine 
soja]
Length=182

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKAL+HVLD+ENPDLWKW++GQE  P+ +  N VF +V  ++  NLD H+APE RAT
Sbjct  99   ENRIKALIHVLDLENPDLWKWISGQEQPPESVSANLVFAAVRERVKKNLDIHSAPEVRAT  158

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P++GNQ
Sbjct  159  PGQPWVRGWDDIKKGQDGPVSGNQ  182



>ref|NP_001288385.1| uncharacterized LOC103654411 [Zea mays]
 gb|ACG26201.1| TPR repeat region family protein [Zea mays]
 gb|ACN35711.1| unknown [Zea mays]
 gb|AFW64962.1| TPR repeat region family protein [Zea mays]
Length=180

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF ++ +K+ +NL KHA+PETR+T
Sbjct  97   EANIRALLQVLDLENPDLWKWLTSQEQPPEDLNSNPVFAAIKSKVTDNLTKHASPETRST  156

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P  GNQ
Sbjct  157  PGQPWVRGWDDIKKGKDGPKYGNQ  180



>gb|ACG25754.1| TPR repeat region family protein [Zea mays]
Length=175

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF+++ +K+ +NL KHA+PETR+T
Sbjct  92   EPNIRALLQVLDLENPDLWKWLTSQEQPPEDLNSNPVFSAIKSKVTDNLIKHASPETRST  151

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P  GNQ
Sbjct  152  PGQPWVRGWDDIKKGKDGPSYGNQ  175



>ref|XP_002449598.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
 gb|EES08586.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
Length=179

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF ++ +K+ +NL KHA+PETR+T
Sbjct  96   EANIRALLQVLDLENPDLWKWLTSQEQPPEDLNSNPVFAAIKSKVTDNLTKHASPETRST  155

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P  GNQ
Sbjct  156  PGQPWVRGWDDIKKGKDGPKYGNQ  179



>gb|ABK26064.1| unknown [Picea sitchensis]
Length=190

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ET IKALV VL++ENPDLWKWL+ QEPAP+ +  NPVF+++H K++  L+ +A+PETRA 
Sbjct  108  ETHIKALVEVLNLENPDLWKWLSAQEPAPEAVFKNPVFSALHEKVLKKLNAYASPETRAA  167

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG   PIAGNQ
Sbjct  168  PGQPWVRGWDD-KRGLGGPIAGNQ  190



>ref|XP_008670754.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103648030 
[Zea mays]
Length=173

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF+++ +K+ +NL KHA+PETR+T
Sbjct  90   EPNIRALLQVLDLENPDLWKWLTSQEQPPEDLISNPVFSAIKSKVTDNLIKHASPETRST  149

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD K+G+D P  GNQ
Sbjct  150  PGQPWVRGWDDIKKGKDGPNYGNQ  173



>gb|AFK36017.1| unknown [Medicago truncatula]
 gb|KEH20959.1| TPR repeat region family protein [Medicago truncatula]
Length=180

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I++L+H+LDVENPDLWKWL+GQE  P+ I  NPVF +V   +M NLD H++PETRAT
Sbjct  97   ENHIRSLIHLLDVENPDLWKWLSGQEQPPESISINPVFAAVQEGVMKNLDSHSSPETRAT  156

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD ++ R  P AGNQ
Sbjct  157  PGKPWVRGWDDIQKFRGGPSAGNQ  180



>gb|KJB07931.1| hypothetical protein B456_001G053700 [Gossypium raimondii]
Length=171

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 7/84 (8%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALV+VLD+ENPDLWKWLTGQE  P+ +  NP       K++ NL+ H++PETRAT
Sbjct  95   ENGIKALVNVLDLENPDLWKWLTGQEQPPEAVTINP-------KVLKNLNNHSSPETRAT  147

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD K+GRDSPI GNQ
Sbjct  148  RGRPWVRGWDDIKKGRDSPITGNQ  171



>ref|XP_006662965.1| PREDICTED: uncharacterized protein LOC102700188 [Oryza brachyantha]
Length=178

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I++L+HVLD+ENPDLWKWLTGQE  P+ + +NPVF +V +K+ +NL KH++PETR+ 
Sbjct  96   EANIRSLLHVLDLENPDLWKWLTGQEQPPEAVNSNPVFIAVKSKVTDNLSKHSSPETRSA  155

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG D P  GNQ
Sbjct  156  PGQPWVRGWDD-KRGIDGPKYGNQ  178



>gb|EMT20783.1| hypothetical protein F775_28401 [Aegilops tauschii]
Length=113

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I++L+ +LD+ENPDLWKWLTGQE AP+ + +NPVF ++ +K+ +NL KH++PETR+ 
Sbjct  29   EANIRSLLQILDLENPDLWKWLTGQEQAPETVNSNPVFAAIKSKVTDNLSKHSSPETRSA  88

Query  408  TGQSWVRGWDDF-KRGRDSPIAGNQ  337
             GQ WVRGWDD  KRG D P  GNQ
Sbjct  89   PGQPWVRGWDDKDKRGLDGPKYGNQ  113



>ref|XP_008797117.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Phoenix dactylifera]
Length=166

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLTGQE  P+ +  NPVFT+V +++M NL+ HAAPETRA 
Sbjct  83   ELRIRALMDVLDLENPDLWKWLTGQEQPPEAVHNNPVFTAVQSRVMGNLNSHAAPETRAN  142

Query  408  TGQSWVRGWDDFKRGRD-SPIAGNQ  337
             GQ WVRGWDD KRG+D  P  GNQ
Sbjct  143  PGQPWVRGWDD-KRGQDGGPKYGNQ  166



>ref|XP_003577516.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial 
[Brachypodium distachyon]
Length=177

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I++L+ VLD+ENPDLWKWLTGQE  P+ + +NPVF ++ +K+ +NL KHA+PETR+ 
Sbjct  95   EANIRSLLQVLDLENPDLWKWLTGQEQPPEAVNSNPVFIAIKSKVTDNLSKHASPETRSA  154

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG D P  GNQ
Sbjct  155  PGQPWVRGWDD-KRGIDGPKYGNQ  177



>ref|XP_009413497.1| PREDICTED: uncharacterized protein LOC103994785 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -1

Query  579  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  400
            I+AL+ VLD+ENPDLWKWLTGQE  P+ ++ NPVF ++ +K+M+NL+ HAAPETRA  GQ
Sbjct  92   IRALMDVLDLENPDLWKWLTGQEQPPEAVKINPVFCAIQSKVMSNLNSHAAPETRANPGQ  151

Query  399  SWVRGWDDFKRGRDSPIAGNQ  337
             WVRGWDD K     P  GNQ
Sbjct  152  PWVRGWDDKKGVEGGPTYGNQ  172



>dbj|BAJ90590.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I++L+ +LD+ENPDLWKWLTGQE  P+ + +NPVF ++ +K+ +NL KH++PETR+ 
Sbjct  93   EANIRSLLQILDLENPDLWKWLTGQEQPPETVNSNPVFAAIKSKVTDNLSKHSSPETRSA  152

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG D P  GNQ
Sbjct  153  PGQPWVRGWDD-KRGLDGPKYGNQ  175



>dbj|BAJ88942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=174

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I++L+ +LD+ENPDLWKWLTGQE  P+ + +NPVF ++ +K+ +NL KH++PETR+ 
Sbjct  92   EANIRSLLQILDLENPDLWKWLTGQEQPPETVNSNPVFAAIKSKVTDNLSKHSSPETRSA  151

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG D P  GNQ
Sbjct  152  PGQPWVRGWDD-KRGLDGPKYGNQ  174



>gb|EMS54449.1| hypothetical protein TRIUR3_02167 [Triticum urartu]
Length=113

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I++L+ +LD+ENPDLWKWLTGQE  P+ + +NPVF ++ +K+ +NL KH++PETR+ 
Sbjct  29   EANIRSLLQILDLENPDLWKWLTGQEQPPETVNSNPVFAAIKSKVTDNLSKHSSPETRSA  88

Query  408  TGQSWVRGWDDF-KRGRDSPIAGNQ  337
             GQ WVRGWDD  KRG D P  GNQ
Sbjct  89   PGQPWVRGWDDKDKRGLDGPKYGNQ  113



>ref|XP_010929714.1| PREDICTED: uncharacterized protein LOC105051113 [Elaeis guineensis]
Length=173

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLTGQE  P+ +  NPVFT+V +++M NL+ HAAPETRA 
Sbjct  90   ELHIRALMDVLDLENPDLWKWLTGQEQPPEAVNDNPVFTAVQSRVMGNLNSHAAPETRAN  149

Query  408  TGQSWVRGWDDFKRGRD-SPIAGNQ  337
             GQ WVRGWDD KRG++  P  GNQ
Sbjct  150  PGQPWVRGWDD-KRGQEGGPKYGNQ  173



>ref|XP_008239648.1| PREDICTED: uncharacterized protein LOC103338241, partial [Prunus 
mume]
Length=77

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -1

Query  549  ENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFK  370
            ENPDLWKWL GQE  P+ ++TNPVFT+V  K++NNL+ ++APETRAT GQ WVRGWDD K
Sbjct  7    ENPDLWKWLIGQEQPPEALKTNPVFTAVRNKVLNNLNSYSAPETRATPGQPWVRGWDDIK  66

Query  369  RGRDSPIAGNQ  337
            +G+  PI GNQ
Sbjct  67   KGQGGPITGNQ  77



>ref|XP_006844641.1| hypothetical protein AMTR_s00016p00232260 [Amborella trichopoda]
 gb|ERN06316.1| hypothetical protein AMTR_s00016p00232260 [Amborella trichopoda]
Length=178

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  IKALV VLD+ENPDLWKWLTGQE  PD +  NPVF++VHTKI  NL  +A+ ETRA 
Sbjct  96   EANIKALVEVLDLENPDLWKWLTGQEQPPDEVNRNPVFSAVHTKISGNLKSYASAETRAA  155

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG  +   GNQ
Sbjct  156  PGQPWVRGWDD-KRGLGTTPFGNQ  178



>gb|KHG13985.1| Carbonyl reductase [NADPH] 1 [Gossypium arboreum]
Length=476

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALVHVLD+ENPDL +WLTGQE  P+ +  NPVF++V  K++ NL+ H+APETRAT
Sbjct  382  ENGIKALVHVLDLENPDLRRWLTGQERPPEAVSGNPVFSAVQGKVLKNLN-HSAPETRAT  440

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ  VRGWDDF++G D PI G +
Sbjct  441  PGQPCVRGWDDFQKGHDVPITGGE  464



>ref|NP_001068002.1| Os11g0528300 [Oryza sativa Japonica Group]
 gb|ABA94029.1| TPR repeat region family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28365.1| Os11g0528300 [Oryza sativa Japonica Group]
 gb|EAZ18567.1| hypothetical protein OsJ_34096 [Oryza sativa Japonica Group]
Length=186

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF +V +K+ +NL KH++PETR+ 
Sbjct  104  EANIRALLQVLDLENPDLWKWLTSQEQPPEAVNSNPVFIAVKSKVTDNLSKHSSPETRSA  163

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG + P  GNQ
Sbjct  164  PGQPWVRGWDD-KRGIEGPKYGNQ  186



>gb|KHG13984.1| Carbonyl reductase [NADPH] 1 [Gossypium arboreum]
Length=489

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E GIKALVHVLD+ENPDL +WLTGQE  P+ +  NPVF++V  K++ NL+ H+APETRAT
Sbjct  395  ENGIKALVHVLDLENPDLRRWLTGQERPPEAVSGNPVFSAVQGKVLKNLN-HSAPETRAT  453

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ  VRGWDDF++G D PI G +
Sbjct  454  PGQPCVRGWDDFQKGHDVPITGGE  477



>gb|EAY81147.1| hypothetical protein OsI_36329 [Oryza sativa Indica Group]
Length=186

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  I+AL+ VLD+ENPDLWKWLT QE  P+ + +NPVF +V +K+  NL KH++PETR+ 
Sbjct  104  EANIRALLQVLDLENPDLWKWLTDQEQPPEAMNSNPVFIAVKSKVTENLSKHSSPETRSA  163

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRG + P  GNQ
Sbjct  164  PGQPWVRGWDD-KRGIEGPKYGNQ  186



>ref|NP_001235051.1| uncharacterized protein LOC100527878 [Glycine max]
 gb|ACU17081.1| unknown [Glycine max]
Length=175

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  ++AL+ +LD+ENPDLWKW++GQE  P+ I  NPVF +V   +M NL+ H+APETRAT
Sbjct  92   EYRVRALILLLDLENPDLWKWISGQEQPPESIHINPVFAAVREGVMKNLESHSAPETRAT  151

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD K+     I GNQ
Sbjct  152  PGKPWVRGWDDIKKFPGGSITGNQ  175



>ref|XP_004503818.1| PREDICTED: uncharacterized protein LOC101502675 [Cicer arietinum]
Length=202

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  579  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  400
            I +L+++LD+ENPDLWKWL+GQE  P+ I  NPVF +V   +M NL+ H+APETRAT GQ
Sbjct  122  IPSLIYLLDLENPDLWKWLSGQEEPPESISINPVFAAVREGVMKNLNSHSAPETRATPGQ  181

Query  399  SWVRGWDDFKRGRDSPIAGNQ  337
             WVRGWDD K+    P  GNQ
Sbjct  182  PWVRGWDDNKKFPGGPSTGNQ  202



>tpg|DAA42045.1| TPA: hypothetical protein ZEAMMB73_302044, partial [Zea mays]
Length=76

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  561  VLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGW  382
            ++  ENPDLWKWLT QE  P+ + +NPVF+++ +K+ +NL KHA+PETR+T GQ WVRGW
Sbjct  2    LIPQENPDLWKWLTSQEQPPEDLISNPVFSAIKSKVTDNLIKHASPETRSTPGQPWVRGW  61

Query  381  DDFKRGRDSPIAGNQ  337
            DD K+G+D P  GNQ
Sbjct  62   DDIKKGKDGPNYGNQ  76



>ref|XP_002973356.1| hypothetical protein SELMODRAFT_98920, partial [Selaginella moellendorffii]
 ref|XP_002976544.1| hypothetical protein SELMODRAFT_105340, partial [Selaginella 
moellendorffii]
 gb|EFJ22213.1| hypothetical protein SELMODRAFT_105340, partial [Selaginella 
moellendorffii]
 gb|EFJ25730.1| hypothetical protein SELMODRAFT_98920, partial [Selaginella moellendorffii]
Length=122

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -1

Query  579  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  400
            +++L+ VLD+ENPDLWKWLTGQ   P+ I  NPVF  +  +I  NL+ HAA ETRA  GQ
Sbjct  41   LESLIQVLDLENPDLWKWLTGQAEVPESITANPVFACIQKQISGNLENHAAVETRAKPGQ  100

Query  399  SWVRGWDDFKR-GRDSPIAGNQ  337
             WVRGWDDFK+ G ++   GNQ
Sbjct  101  PWVRGWDDFKKTGPNNAFLGNQ  122



>gb|KHN16894.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=452

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  ++AL+ +LD+ENPDLWKW++GQE  P+ I  NPVF +V   +M NL+ H+APETRAT
Sbjct  369  EYRVRALILLLDLENPDLWKWISGQEQPPESININPVFAAVREGVMKNLESHSAPETRAT  428

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD K+     I GNQ
Sbjct  429  PGKPWVRGWDDIKKFPGGSITGNQ  452



>gb|AFJ66194.1| hypothetical protein 7G9.12 [Boechera stricta]
Length=212

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E G+K+L+HVL++ENPDLWKWLT QE  P+ + +NPVF+++H K+M NL+KHAAPETRA 
Sbjct  104  ENGVKSLIHVLNLENPDLWKWLTEQEQPPEAVISNPVFSALHEKVMKNLNKHAAPETRAA  163

Query  408  TGQSWVRGWDDFKRGR  361
             GQ W +  D F +G+
Sbjct  164  AGQPWFQ--DKFGKGK  177



>gb|AFJ66223.1| hypothetical protein 34G24.28 [Capsella rubella]
Length=162

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 23/84 (27%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E+G+K+L+HVL                       N VF+++H K+M NL+KHAAPETRA 
Sbjct  102  ESGVKSLIHVL-----------------------NLVFSALHEKVMKNLNKHAAPETRAA  138

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WV+GWDDFKRGRD+PI+GNQ
Sbjct  139  AGQPWVKGWDDFKRGRDAPISGNQ  162



>ref|XP_001752564.1| predicted protein [Physcomitrella patens]
 gb|EDQ82803.1| predicted protein [Physcomitrella patens]
Length=134

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  ++ LV +L+ ENPDLW WLTGQ   P  +  N VF ++  +I  NL  +++P+TRA 
Sbjct  52   ENRLQELVDLLEGENPDLWNWLTGQAEVPAALAENSVFAAIKGQIAENLSTYSSPQTRAQ  111

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             G+ WVRGWDD  R    P AGNQ
Sbjct  112  PGKPWVRGWDD-NRKIGGPQAGNQ  134



>ref|XP_010112900.1| hypothetical protein L484_017736 [Morus notabilis]
 gb|EXC35035.1| hypothetical protein L484_017736 [Morus notabilis]
Length=177

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 50/84 (60%), Gaps = 23/84 (27%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            + GIKAL +VL                       N VFT+V  K+MNNL+ HA+PETRA 
Sbjct  117  DNGIKALSYVL-----------------------NLVFTAVSGKVMNNLNAHASPETRAK  153

Query  408  TGQSWVRGWDDFKRGRDSPIAGNQ  337
             GQ WVRGWDD KRGRDSPI GNQ
Sbjct  154  PGQPWVRGWDDIKRGRDSPITGNQ  177



>ref|XP_001694005.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02941.1| predicted protein [Chlamydomonas reinhardtii]
Length=173

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -1

Query  579  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  400
            +  +  VLD ENPDL+KWLTGQ  AP+ ++ NPVF ++ + +   L   A P+TRA  G+
Sbjct  88   LNQMAFVLDEENPDLFKWLTGQLQAPEHMQKNPVFVAIQSHVAQQLQDSAPPQTRAPAGR  147

Query  399  SWVRGWDDFKRGRD  358
             WVRGWDD  RG+ 
Sbjct  148  DWVRGWDDGWRGQQ  161



>ref|XP_011040389.1| PREDICTED: uncharacterized protein LOC105136661 [Populus euphratica]
Length=216

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = -1

Query  504  PDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGWDDFKRGRDSPIAGNQ  337
            P+ +R   VF++V  KIMNNL  HAAPETRA  GQ WVRGWDD K+   SP+AGNQ
Sbjct  163  PEDLRQ--VFSAVRDKIMNNLSSHAAPETRAIPGQPWVRGWDDIKKSAGSPVAGNQ  216



>ref|XP_001415883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94175.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=85

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  579  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  400
            + AL  VLDVENP+L+KWLT QE AP  +R N  + S+       LD+ ++  +RA  G+
Sbjct  12   LDALDAVLDVENPELFKWLTAQETAPREMRENEAYASLAAHCAKFLDEKSSEASRAAHGR  71

Query  399  SWVRGWDDFKRG  364
             W+RGW+D   G
Sbjct  72   EWIRGWNDSGAG  83



>ref|XP_002956425.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f. nagariensis]
 gb|EFJ42569.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f. nagariensis]
Length=110

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -1

Query  579  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  400
            +K +  VL+ ENPDL+KWLTGQ   PD +  N VF ++   +   L + A   TRA  G+
Sbjct  37   LKQMALVLEEENPDLFKWLTGQLQPPDRMSGNAVFEALRRHVAQQLSETAPATTRAALGR  96

Query  399  SWVRGWDD  376
             WVRGWDD
Sbjct  97   DWVRGWDD  104



>ref|XP_005644390.1| hypothetical protein COCSUDRAFT_67604 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19846.1| hypothetical protein COCSUDRAFT_67604 [Coccomyxa subellipsoidea 
C-169]
Length=124

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            ++ + A+  VLD ENPDL+KWLTGQE AP  ++ NP F  +   +   L  H      + 
Sbjct  37   DSQLAAMETVLDQENPDLFKWLTGQEEAPQAMQANPAFVDMKHNVEERLAAHRDNAAMSQ  96

Query  408  TGQSWVRGWDD  376
             G+ WVRGWDD
Sbjct  97   PGKDWVRGWDD  107



>ref|XP_003074399.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL50250.1| Flavinator of succinate dehydrogenase [Ostreococcus tauri]
Length=148

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -1

Query  579  IKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQ  400
            + A   VL  ENP+L+KWLTGQE AP  +  N  + S+       LD+ ++ +TRA  G+
Sbjct  75   LDAFDEVLRAENPELFKWLTGQERAPRAMAENAAYASLAEHCKKFLDEKSSADTRAAYGR  134

Query  399  SWVRGWDD  376
             W+RGW+D
Sbjct  135  EWIRGWND  142



>ref|XP_007515400.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14279.1| predicted protein [Bathycoccus prasinos]
Length=214

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = -1

Query  570  LVHVLDVENPDLWKWLTGQEPAPDGIRT-NPVFTSVHTKIMNNLDKHAAPETRATTGQSW  394
               VL+ ENPDL+ +LTGQ  AP  +R  N  + ++   +M  LD+ +  +TRA  G+ W
Sbjct  141  FAKVLEEENPDLYSYLTGQSEAPKYLREENEAYKALKAHVMKFLDEKSDEKTRAKFGKEW  200

Query  393  VRGWDDFKRGRDSPIAGNQ  337
            VRGW+D      S   GNQ
Sbjct  201  VRGWND-----GSSEGGNQ  214



>ref|XP_003056014.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59390.1| predicted protein [Micromonas pusilla CCMP1545]
Length=174

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRAT  409
            E  + +   VLD ENP+L+KWLTGQE  P  +  N  F S+   ++  +++ +    RA 
Sbjct  97   EEFMASFSEVLDEENPELFKWLTGQEYPPSRLANNLAFISLQVHVITIMNQKSHRGARAE  156

Query  408  TGQSWVRGWDD  376
             G SW+RGW D
Sbjct  157  AGHSWLRGWSD  167



>ref|XP_002507517.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
 gb|ACO68775.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
Length=157

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -1

Query  561  VLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGW  382
            +LD ENP+L++WLT QE  P  +  N  F S+H    + + +    ETRA  G  WVRGW
Sbjct  94   ILDEENPELFRWLTCQEQPPPRMTRNRAFISLHAYTSSLMRRKCDRETRALKGHHWVRGW  153

Query  381  DD  376
            DD
Sbjct  154  DD  155



>ref|XP_011082852.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
isoform X2 [Sesamum indicum]
 ref|XP_011082861.1| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=135

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  588  ETGIKALVHVLDVENPDLWKWLTGQEPAPDGIRTN  484
            E+GI++LVHVLD+ENPDLWKWLT Q   P+ ++ N
Sbjct  94   ESGIRSLVHVLDLENPDLWKWLTCQGQPPEAVKKN  128



>ref|XP_005845121.1| hypothetical protein CHLNCDRAFT_137510 [Chlorella variabilis]
 gb|EFN53019.1| hypothetical protein CHLNCDRAFT_137510 [Chlorella variabilis]
Length=141

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 1/63 (2%)
 Frame = -1

Query  561  VLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDK-HAAPETRATTGQSWVRG  385
            VL  ENPD++KWLT Q  AP+ +R N  F ++   +    D+ H+ P       + WVRG
Sbjct  53   VLGQENPDMFKWLTAQAEAPEELRHNRTFAALQAHVQALRDRHHSVPRAAGEAPKEWVRG  112

Query  384  WDD  376
            W D
Sbjct  113  WSD  115



>gb|KIZ01550.1| hypothetical protein MNEG_6410 [Monoraphidium neglectum]
Length=198

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -1

Query  561  VLDVENPDLWKWLTGQEPAPDGIRTNPVFTSVHTKIMNNLDKHAAPETRATTGQSWVRGW  382
            VLD ENPDL+KWLTGQ P P  +  N  + ++ + +   L  +      A  G+ WVRGW
Sbjct  103  VLDEENPDLFKWLTGQLPTPPHLAANQQYMALKSHVDAQLSDNLHRAAAAAAGRDWVRGW  162

Query  381  DD  376
            DD
Sbjct  163  DD  164



>gb|KCW58842.1| hypothetical protein EUGRSUZ_H01475 [Eucalyptus grandis]
Length=168

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  582  GIKALVHVLDVENPDLWKWLTGQEPAPDGIRTNPVFTSV  466
            GIKALV  LD ENPDLWKWLT QE  P+ ++ NPV +++
Sbjct  111  GIKALVDFLDWENPDLWKWLTNQEQPPEAVKMNPVSSNM  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925