BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050K21

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP21813.1|  hypothetical protein JCGZ_00600                         140   6e-36   Jatropha curcas
ref|XP_010113031.1|  hypothetical protein L484_022756                   139   2e-35   
ref|XP_002264842.2|  PREDICTED: uncharacterized protein LOC100243...    138   3e-35   Vitis vinifera
ref|XP_006362325.1|  PREDICTED: uncharacterized protein LOC102585892    135   3e-34   Solanum tuberosum [potatoes]
ref|XP_002519981.1|  conserved hypothetical protein                     132   5e-33   Ricinus communis
ref|XP_011101977.1|  PREDICTED: uncharacterized protein LOC105180...    132   5e-33   Sesamum indicum [beniseed]
ref|XP_009804785.1|  PREDICTED: uncharacterized protein LOC104249949    131   8e-33   Nicotiana sylvestris
gb|KDO37186.1|  hypothetical protein CISIN_1g030723mg                   125   1e-32   Citrus sinensis [apfelsine]
ref|XP_009337845.1|  PREDICTED: uncharacterized protein LOC103930264    130   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_004249013.1|  PREDICTED: uncharacterized protein LOC101255446    130   2e-32   Solanum lycopersicum
ref|XP_009615227.1|  PREDICTED: uncharacterized protein LOC104107982    130   2e-32   Nicotiana tomentosiformis
emb|CDP06352.1|  unnamed protein product                                130   2e-32   Coffea canephora [robusta coffee]
ref|XP_011006222.1|  PREDICTED: uncharacterized protein LOC105112277    130   2e-32   Populus euphratica
gb|KJB27583.1|  hypothetical protein B456_005G0011001                   127   4e-32   Gossypium raimondii
ref|XP_002323111.2|  hypothetical protein POPTR_0016s15030g             129   4e-32   
gb|KJB27581.1|  hypothetical protein B456_005G0011001                   127   5e-32   Gossypium raimondii
ref|XP_011101979.1|  PREDICTED: uncharacterized protein LOC105180...    129   7e-32   Sesamum indicum [beniseed]
ref|XP_008370316.1|  PREDICTED: uncharacterized protein LOC103433803    129   7e-32   
ref|XP_004302492.1|  PREDICTED: uncharacterized protein LOC101292427    129   7e-32   Fragaria vesca subsp. vesca
ref|XP_007032238.1|  Uncharacterized protein isoform 1                  129   8e-32   
ref|XP_009370848.1|  PREDICTED: uncharacterized protein LOC103960157    128   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_011101978.1|  PREDICTED: uncharacterized protein LOC105180...    128   1e-31   Sesamum indicum [beniseed]
gb|KHG16695.1|  Retinal-binding                                         127   2e-31   Gossypium arboreum [tree cotton]
ref|XP_006429679.1|  hypothetical protein CICLE_v10011748mg             126   4e-31   Citrus clementina [clementine]
ref|XP_010036049.1|  PREDICTED: uncharacterized protein LOC104425150    125   9e-31   Eucalyptus grandis [rose gum]
ref|XP_008244213.1|  PREDICTED: uncharacterized protein LOC103342365    125   2e-30   Prunus mume [ume]
dbj|BAH57287.1|  AT5G01010                                              117   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EYU42067.1|  hypothetical protein MIMGU_mgv1a006657mg                124   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_004169546.1|  PREDICTED: uncharacterized protein LOC101223675    116   3e-30   
ref|XP_007205211.1|  hypothetical protein PRUPE_ppa005889mg             124   4e-30   
ref|XP_006279346.1|  hypothetical protein CARUB_v10012733mg             123   6e-30   Capsella rubella
gb|AFW77521.1|  hypothetical protein ZEAMMB73_436424                    123   7e-30   
gb|KHN24577.1|  hypothetical protein glysoja_014181                     123   8e-30   Glycine soja [wild soybean]
ref|XP_009125386.1|  PREDICTED: uncharacterized protein LOC103850397    123   9e-30   Brassica rapa
ref|XP_008649463.1|  PREDICTED: uncharacterized protein LOC103630...    123   1e-29   Zea mays [maize]
ref|XP_008649464.1|  PREDICTED: uncharacterized protein LOC103630...    123   1e-29   Zea mays [maize]
ref|XP_010496822.1|  PREDICTED: uncharacterized protein LOC104773850    122   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008463317.1|  PREDICTED: uncharacterized protein LOC103501...    122   2e-29   Cucumis melo [Oriental melon]
dbj|BAD43397.1|  unnamed protein product                                120   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24699.1|  hypothetical protein AALP_AA8G013300                    121   3e-29   Arabis alpina [alpine rockcress]
gb|EPS68255.1|  hypothetical protein M569_06516                         121   3e-29   Genlisea aurea
ref|XP_008463316.1|  PREDICTED: uncharacterized protein LOC103501...    121   4e-29   Cucumis melo [Oriental melon]
ref|XP_010490476.1|  PREDICTED: uncharacterized protein LOC104768...    121   4e-29   Camelina sativa [gold-of-pleasure]
ref|NP_001190197.1|  uncharacterized protein                            121   4e-29   
ref|XP_010490477.1|  PREDICTED: uncharacterized protein LOC104768...    121   4e-29   Camelina sativa [gold-of-pleasure]
ref|NP_001154687.1|  uncharacterized protein                            121   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521546.1|  PREDICTED: uncharacterized protein LOC100778...    121   4e-29   Glycine max [soybeans]
dbj|BAD43927.1|  unnamed protein product                                120   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398547.1|  hypothetical protein EUTSA_v10013603mg             121   4e-29   Eutrema salsugineum [saltwater cress]
dbj|BAD43795.1|  unknown protein                                        120   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195721.5|  uncharacterized protein                               120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43433.1|  unknown protein                                        120   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006599750.1|  PREDICTED: uncharacterized protein LOC100795...    119   1e-28   Glycine max [soybeans]
ref|XP_003548341.1|  PREDICTED: uncharacterized protein LOC100795...    119   1e-28   Glycine max [soybeans]
gb|EYU42068.1|  hypothetical protein MIMGU_mgv1a006657mg                119   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_010278895.1|  PREDICTED: uncharacterized protein LOC104612935    119   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_004510081.1|  PREDICTED: uncharacterized protein LOC101493...    119   2e-28   Cicer arietinum [garbanzo]
ref|XP_010673452.1|  PREDICTED: uncharacterized protein LOC104889827    119   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004147520.1|  PREDICTED: uncharacterized protein LOC101218161    119   3e-28   Cucumis sativus [cucumbers]
ref|XP_009130613.1|  PREDICTED: uncharacterized protein LOC103855...    118   4e-28   Brassica rapa
ref|XP_007134600.1|  hypothetical protein PHAVU_010G060400g             117   7e-28   Phaseolus vulgaris [French bean]
emb|CDY11168.1|  BnaA03g00040D                                          117   9e-28   Brassica napus [oilseed rape]
ref|XP_010938085.1|  PREDICTED: uncharacterized protein LOC105057...    117   1e-27   Elaeis guineensis
ref|XP_010543127.1|  PREDICTED: uncharacterized protein LOC104816...    116   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010543126.1|  PREDICTED: uncharacterized protein LOC104816...    116   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010938084.1|  PREDICTED: uncharacterized protein LOC105057...    116   2e-27   Elaeis guineensis
ref|XP_003568677.1|  PREDICTED: uncharacterized protein LOC100826...    116   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_006654248.1|  PREDICTED: uncharacterized protein LOC102707586    115   3e-27   Oryza brachyantha
ref|XP_003626627.1|  hypothetical protein MTR_8g005040                  115   5e-27   Medicago truncatula
ref|NP_001055152.1|  Os05g0306000                                       115   5e-27   
ref|XP_008793391.1|  PREDICTED: uncharacterized protein LOC103709...    114   8e-27   
ref|XP_008793389.1|  PREDICTED: uncharacterized protein LOC103709...    114   1e-26   Phoenix dactylifera
ref|XP_010921253.1|  PREDICTED: uncharacterized protein LOC105044...    114   1e-26   
ref|XP_010921254.1|  PREDICTED: uncharacterized protein LOC105044...    113   1e-26   
ref|XP_008782734.1|  PREDICTED: uncharacterized protein LOC103702...    112   2e-26   
ref|XP_010921250.1|  PREDICTED: uncharacterized protein LOC105044...    113   2e-26   Elaeis guineensis
ref|XP_008782731.1|  PREDICTED: uncharacterized protein LOC103702...    113   3e-26   Phoenix dactylifera
ref|XP_010921251.1|  PREDICTED: uncharacterized protein LOC105044...    112   4e-26   Elaeis guineensis
dbj|BAH57023.1|  AT5G01010                                              112   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842639.1|  hypothetical protein AMTR_s00077p00188630          110   3e-25   Amborella trichopoda
dbj|BAJ93195.1|  predicted protein                                      109   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007032241.1|  Uncharacterized protein isoform 4                  108   1e-24   
ref|XP_010653095.1|  PREDICTED: uncharacterized protein LOC100243...    107   3e-24   Vitis vinifera
ref|XP_006429677.1|  hypothetical protein CICLE_v10011748mg             105   2e-23   
ref|XP_009391656.1|  PREDICTED: uncharacterized protein LOC103977773    105   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004962482.1|  PREDICTED: uncharacterized protein LOC101772...    103   5e-23   Setaria italica
ref|XP_004962481.1|  PREDICTED: uncharacterized protein LOC101772...    103   5e-23   Setaria italica
ref|XP_004962483.1|  PREDICTED: uncharacterized protein LOC101772...    103   5e-23   
gb|KDO37187.1|  hypothetical protein CISIN_1g030723mg                 99.4    1e-22   Citrus sinensis [apfelsine]
gb|KJB27580.1|  hypothetical protein B456_005G0011001                 98.6    1e-21   Gossypium raimondii
ref|XP_006429676.1|  hypothetical protein CICLE_v10011748mg           99.4    2e-21   
ref|NP_001154688.1|  uncharacterized protein                          99.4    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872981.1|  hypothetical protein ARALYDRAFT_486867           99.0    3e-21   
ref|XP_006296412.1|  hypothetical protein CARUB_v10025590mg           91.7    7e-21   
ref|XP_002980642.1|  hypothetical protein SELMODRAFT_154057           96.7    2e-20   
ref|XP_002991009.1|  hypothetical protein SELMODRAFT_161364           96.7    2e-20   
ref|XP_007032239.1|  Uncharacterized protein isoform 2                95.9    5e-20   
ref|XP_006429678.1|  hypothetical protein CICLE_v10011748mg           93.6    3e-19   
gb|EEE63181.1|  hypothetical protein OsJ_17990                        92.8    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001765571.1|  predicted protein                                92.8    7e-19   
ref|XP_010231533.1|  PREDICTED: uncharacterized protein LOC100826...  91.3    2e-18   
gb|EFN84723.1|  SEC14-like protein 2                                  53.5    2e-06   Harpegnathos saltator
ref|XP_011139122.1|  PREDICTED: SEC14-like protein 2                  53.1    9e-06   
ref|XP_008793390.1|  PREDICTED: uncharacterized protein LOC103709...  52.8    4e-05   
ref|XP_002602154.1|  hypothetical protein BRAFLDRAFT_234283           47.4    4e-04   Branchiostoma floridae
ref|XP_006398545.1|  hypothetical protein EUTSA_v10013603mg           49.3    5e-04   



>gb|KDP21813.1| hypothetical protein JCGZ_00600 [Jatropha curcas]
Length=439

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY D SGKKT ILPY+RYESDQGNFCT MAGNYKL+WDNSYSSFF KV+RYKVD
Sbjct  363  DIGFSVEYVDPSGKKTLILPYQRYESDQGNFCTVMAGNYKLIWDNSYSSFFKKVIRYKVD  422

Query  338  CIPPVVESSASANQLEG  288
            CIPPVVE   S NQ+EG
Sbjct  423  CIPPVVEPMQSTNQVEG  439



>ref|XP_010113031.1| hypothetical protein L484_022756 [Morus notabilis]
 gb|EXC35202.1| hypothetical protein L484_022756 [Morus notabilis]
Length=503

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY +SSG+KT ILPYRRYE+DQGNFCTCMAGNYKL+WDNSY+SFF KVLR+KVD
Sbjct  427  DIGFSVEYTNSSGEKTLILPYRRYEADQGNFCTCMAGNYKLIWDNSYASFFKKVLRFKVD  486

Query  338  CIPPVVESSASANQLE  291
            CIPPVVES  S NQ+E
Sbjct  487  CIPPVVESPPSDNQVE  502



>ref|XP_002264842.2| PREDICTED: uncharacterized protein LOC100243295 isoform X1 [Vitis 
vinifera]
 emb|CBI31130.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFSMEY ++SG KT ILPYRRYESDQGNFCTCMAGNYKL+WDNSYS+FF KVLRYKVD
Sbjct  363  DIGFSMEYTNASGDKTLILPYRRYESDQGNFCTCMAGNYKLIWDNSYSTFFKKVLRYKVD  422

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE  A+A  ++
Sbjct  423  CIPPVVEPVAAATDVK  438



>ref|XP_006362325.1| PREDICTED: uncharacterized protein LOC102585892 [Solanum tuberosum]
Length=439

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFSMEY D SG+KT ILPYRRY +DQGNFCTC++GNYKL+WDNSYS+FF KVLRYKVD
Sbjct  363  DIGFSMEYTDPSGQKTQILPYRRYGADQGNFCTCLSGNYKLIWDNSYSTFFKKVLRYKVD  422

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE   S++Q++
Sbjct  423  CIPPVVEPELSSDQVD  438



>ref|XP_002519981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42305.1| conserved hypothetical protein [Ricinus communis]
Length=439

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY D SGK++ ILPYRRYESDQGNF T  AGNYKL+WDNSYS+FF KVLRYKVD
Sbjct  363  DIGFSVEYMDPSGKRSLILPYRRYESDQGNFSTVTAGNYKLIWDNSYSAFFKKVLRYKVD  422

Query  338  CIPPVVESSASANQLEG  288
            CIPPVVE   S +Q+EG
Sbjct  423  CIPPVVEPLQSTDQVEG  439



>ref|XP_011101977.1| PREDICTED: uncharacterized protein LOC105180011 isoform X1 [Sesamum 
indicum]
Length=437

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  527  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  348
            +LQDIGFS+E  D SGKKT ILPYRRYESDQGNFCTC++G+YKL+WDNSYSSFF KV+RY
Sbjct  361  SLQDIGFSVECTDLSGKKTLILPYRRYESDQGNFCTCVSGSYKLIWDNSYSSFFKKVMRY  420

Query  347  KVDCIPPVVESSASA  303
            KVDCIPPV ES+  A
Sbjct  421  KVDCIPPVAESATHA  435



>ref|XP_009804785.1| PREDICTED: uncharacterized protein LOC104249949 [Nicotiana sylvestris]
Length=439

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFSME+ D SG+KT ILPYRRY++DQGNFCT +AG+YKL+WDN+YS+FF KVLRYKVD
Sbjct  363  DIGFSMEFTDLSGQKTQILPYRRYDADQGNFCTVLAGHYKLIWDNAYSTFFKKVLRYKVD  422

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE + S++Q++
Sbjct  423  CIPPVVEPALSSDQVD  438



>gb|KDO37186.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=172

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY+VD
Sbjct  97   DIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRYRVD  156

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE     N+ E
Sbjct  157  CIPPVVEPMQPTNEAE  172



>ref|XP_009337845.1| PREDICTED: uncharacterized protein LOC103930264 [Pyrus x bretschneideri]
Length=440

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY +SSG+K+ ILPY+RY+SDQGNFCTC AGNYKL+WDNSYS+FF KVLR+KVD
Sbjct  364  DIGFSVEYTNSSGEKSLILPYQRYDSDQGNFCTCEAGNYKLIWDNSYSNFFKKVLRFKVD  423

Query  338  CIPPVVESSASANQLE  291
            CIPPV ES   AN++E
Sbjct  424  CIPPVAESVQPANEVE  439



>ref|XP_004249013.1| PREDICTED: uncharacterized protein LOC101255446 [Solanum lycopersicum]
Length=435

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFSMEY D SG+KT ILPYRRY +DQGNFCTC++GNYKL+WDNSYS+FF KVLR+KVD
Sbjct  363  DIGFSMEYTDPSGQKTQILPYRRYGADQGNFCTCLSGNYKLIWDNSYSTFFKKVLRFKVD  422

Query  338  CIPPVVESSASAN  300
            CIPPVVE   S++
Sbjct  423  CIPPVVEPVLSSD  435



>ref|XP_009615227.1| PREDICTED: uncharacterized protein LOC104107982 [Nicotiana tomentosiformis]
Length=439

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFSME+ + SG+KT ILPYRRY++DQGNFCT +AG+YKL+WDNSYS+FF KVLRYKVD
Sbjct  363  DIGFSMEFTNLSGQKTQILPYRRYDADQGNFCTVLAGHYKLIWDNSYSTFFKKVLRYKVD  422

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE + S++Q++
Sbjct  423  CIPPVVEPALSSDQVD  438



>emb|CDP06352.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY D++G+KT ILPY RYESDQGNFCTCMAGNY+LVWDNS+S+FF KVLRYKVD
Sbjct  363  DIGFSVEYTDAAGQKTLILPYGRYESDQGNFCTCMAGNYRLVWDNSFSAFFGKVLRYKVD  422

Query  338  CIPPVVESSAS  306
            CIPPVVE  +S
Sbjct  423  CIPPVVEPVSS  433



>ref|XP_011006222.1| PREDICTED: uncharacterized protein LOC105112277 [Populus euphratica]
Length=435

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E  D SGKKT ILPYRRYESDQGNF TC++GNYKL+WDNSYS+FF KVLRYKVD
Sbjct  359  DIGFSVECTDPSGKKTLILPYRRYESDQGNFSTCVSGNYKLIWDNSYSAFFKKVLRYKVD  418

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE   SA ++E
Sbjct  419  CIPPVVEPVQSAGEME  434



>gb|KJB27583.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=294

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF K LRYKVD
Sbjct  215  DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRYKVD  274

Query  338  CIPPVVESSASANQ  297
            CIPPV+E S   ++
Sbjct  275  CIPPVLEESEKGSE  288



>ref|XP_002323111.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
 gb|EEF04872.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
Length=435

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E  D +GKKT ILPYRRYESDQGNF TC++GNYKL+WDNSYS+FF KVLRYKVD
Sbjct  359  DIGFSVECTDPTGKKTLILPYRRYESDQGNFSTCVSGNYKLIWDNSYSAFFKKVLRYKVD  418

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE   SA ++E
Sbjct  419  CIPPVVEPVQSAGEME  434



>gb|KJB27581.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
 gb|KJB27582.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=301

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF K LRYKVD
Sbjct  222  DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRYKVD  281

Query  338  CIPPVVESSASANQ  297
            CIPPV+E S   ++
Sbjct  282  CIPPVLEESEKGSE  295



>ref|XP_011101979.1| PREDICTED: uncharacterized protein LOC105180011 isoform X3 [Sesamum 
indicum]
Length=411

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            +DIGFS+E  D SGKKT ILPYRRYESDQGNFCTC++G+YKL+WDNSYSSFF KV+RYKV
Sbjct  337  EDIGFSVECTDLSGKKTLILPYRRYESDQGNFCTCVSGSYKLIWDNSYSSFFKKVMRYKV  396

Query  341  DCIPPVVESSASA  303
            DCIPPV ES+  A
Sbjct  397  DCIPPVAESATHA  409



>ref|XP_008370316.1| PREDICTED: uncharacterized protein LOC103433803 [Malus domestica]
Length=440

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC AGNYKL+WDNSYSSFF KVLRYKVD
Sbjct  364  DIGFSVEYTNPSGQKSLILPYRRFESDQGNFCTCEAGNYKLIWDNSYSSFFKKVLRYKVD  423

Query  338  CIPPVVESSASANQLE  291
            CIPPV E    A + E
Sbjct  424  CIPPVTEPVEPATEAE  439



>ref|XP_004302492.1| PREDICTED: uncharacterized protein LOC101292427 [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+K+ ILPY+RYESDQGNFCTC AG YKLVWDNSYSSFF KVLR+KVD
Sbjct  364  DIGFSVEYTNASGEKSLILPYKRYESDQGNFCTCEAGKYKLVWDNSYSSFFKKVLRFKVD  423

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE+   A + E
Sbjct  424  CIPPVVETVPRATEAE  439



>ref|XP_007032238.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03164.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAG+YKL+WDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYTNTVGEKTLILPYRRYESDQGNFSTCMAGHYKLIWDNSYSTFFKKALRYKVD  422

Query  338  CIPPVVESSASANQLEG  288
            CIPPV++ SA +N++EG
Sbjct  423  CIPPVLD-SAESNEVEG  438



>ref|XP_009370848.1| PREDICTED: uncharacterized protein LOC103960157 [Pyrus x bretschneideri]
Length=440

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC  GNYKL+WDNSYSSFF KVLRYKVD
Sbjct  364  DIGFSVEYTNPSGQKSLILPYRRFESDQGNFCTCEVGNYKLIWDNSYSSFFKKVLRYKVD  423

Query  338  CIPPVVESSASANQLE  291
            CIPPV E    A ++E
Sbjct  424  CIPPVTEPVEPATEVE  439



>ref|XP_011101978.1| PREDICTED: uncharacterized protein LOC105180011 isoform X2 [Sesamum 
indicum]
Length=436

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E  D SGKKT ILPYRRYESDQGNFCTC++G+YKL+WDNSYSSFF KV+RYKVD
Sbjct  363  DIGFSVECTDLSGKKTLILPYRRYESDQGNFCTCVSGSYKLIWDNSYSSFFKKVMRYKVD  422

Query  338  CIPPVVESSASA  303
            CIPPV ES+  A
Sbjct  423  CIPPVAESATHA  434



>gb|KHG16695.1| Retinal-binding [Gossypium arboreum]
Length=442

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRYKVD  422

Query  338  CIPPVVESSASANQ  297
            CIPPV+E S   ++
Sbjct  423  CIPPVLEESEKGSE  436



>ref|XP_006429679.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 ref|XP_006481275.1| PREDICTED: uncharacterized protein LOC102624894 [Citrus sinensis]
 gb|ESR42919.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=438

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY+VD
Sbjct  363  DIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRYRVD  422

Query  338  CIPPVVESSASANQLE  291
            CIPPVVE     N+ E
Sbjct  423  CIPPVVEPMQPTNEAE  438



>ref|XP_010036049.1| PREDICTED: uncharacterized protein LOC104425150 [Eucalyptus grandis]
 gb|KCW47571.1| hypothetical protein EUGRSUZ_K01318 [Eucalyptus grandis]
Length=439

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E    SG+KT ILPYRRYESDQGNFCTC+AGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVECISPSGEKTLILPYRRYESDQGNFCTCIAGNYKLVWDNSYSTFFKKALRYKVD  422

Query  338  CIPPVVESSASANQLEG  288
            CIPPVVE   S ++ E 
Sbjct  423  CIPPVVEPVQSMSEEEA  439



>ref|XP_008244213.1| PREDICTED: uncharacterized protein LOC103342365 [Prunus mume]
Length=440

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC  GNYKL+WDNSYSSFF K LRYKVD
Sbjct  364  DIGFSVEYTNPSGEKSLILPYRRFESDQGNFCTCEVGNYKLLWDNSYSSFFKKALRYKVD  423

Query  338  CIPPVVESSASANQ  297
            CIPPV E  A A +
Sbjct  424  CIPPVAEPVAPATE  437



>dbj|BAH57287.1| AT5G01010 [Arabidopsis thaliana]
Length=98

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  23   DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  82

Query  338  CIPPVVE  318
            CI PVVE
Sbjct  83   CIAPVVE  89



>gb|EYU42067.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=436

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  527  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  348
            N+QDIGFS+E  + SG+KT ILPY+RYE++QGNFCTC+ GNYKL+WDNSYSSFF KVLRY
Sbjct  362  NVQDIGFSVECTNLSGEKTLILPYQRYEANQGNFCTCVPGNYKLIWDNSYSSFFKKVLRY  421

Query  347  KVDCIPPVVES  315
            KVDCIPPVV+S
Sbjct  422  KVDCIPPVVDS  432



>ref|XP_004169546.1| PREDICTED: uncharacterized protein LOC101223675 [Cucumis sativus]
Length=78

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E E   G K  ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVD
Sbjct  4    DIGFSVECESPGGVKRLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVD  63

Query  338  CIPPVVESSASANQ  297
            CIPPVVE    A +
Sbjct  64   CIPPVVEPVQPAAE  77



>ref|XP_007205211.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
 gb|EMJ06410.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
Length=438

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC  GNYKL+WDNSYSSFF K LRYKVD
Sbjct  361  DIGFSVEYTNPSGEKSLILPYRRFESDQGNFCTCEVGNYKLLWDNSYSSFFKKALRYKVD  420

Query  338  CIPPVVESSASA  303
            CIPPV E  A A
Sbjct  421  CIPPVAEPVAPA  432



>ref|XP_006279346.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
 gb|EOA12244.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
Length=434

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+KT ILPYRR+E+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYINASGEKTLILPYRRFEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVESSAS  306
            CIPPVVE   S
Sbjct  423  CIPPVVEPEPS  433



>gb|AFW77521.1| hypothetical protein ZEAMMB73_436424 [Zea mays]
Length=412

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  +G+YKLVWDNSYSSFF KVLRYKVD
Sbjct  338  DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSSGSYKLVWDNSYSSFFKKVLRYKVD  397

Query  338  CIPPVVESSASANQL  294
             +PPVVE + SA +L
Sbjct  398  AVPPVVEPALSATEL  412



>gb|KHN24577.1| hypothetical protein glysoja_014181 [Glycine soja]
Length=434

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E+   +G+KT +LPYRRYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRYK+D
Sbjct  363  DIGFSLEFVSPTGEKTLMLPYRRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRYKID  422

Query  338  CIPPVVESSAS  306
            CIPPV ES  S
Sbjct  423  CIPPVTESVQS  433



>ref|XP_009125386.1| PREDICTED: uncharacterized protein LOC103850397 [Brassica rapa]
 emb|CDY04819.1| BnaAnng00010D [Brassica napus]
Length=440

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYISASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CIPPVVE
Sbjct  423  CIPPVVE  429



>ref|XP_008649463.1| PREDICTED: uncharacterized protein LOC103630158 isoform X1 [Zea 
mays]
Length=501

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  +G+YKLVWDNSYSSFF KVLRYKVD
Sbjct  427  DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSSGSYKLVWDNSYSSFFKKVLRYKVD  486

Query  338  CIPPVVESSASANQL  294
             +PPVVE + SA +L
Sbjct  487  AVPPVVEPALSATEL  501



>ref|XP_008649464.1| PREDICTED: uncharacterized protein LOC103630158 isoform X2 [Zea 
mays]
Length=499

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  +G+YKLVWDNSYSSFF KVLRYKVD
Sbjct  425  DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSSGSYKLVWDNSYSSFFKKVLRYKVD  484

Query  338  CIPPVVESSASANQL  294
             +PPVVE + SA +L
Sbjct  485  AVPPVVEPALSATEL  499



>ref|XP_010496822.1| PREDICTED: uncharacterized protein LOC104773850 [Camelina sativa]
Length=434

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF+K LRYKVD
Sbjct  363  DIGFSVEYIGASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFNKTLRYKVD  422

Query  338  CIPPVVE  318
            CIPPVVE
Sbjct  423  CIPPVVE  429



>ref|XP_008463317.1| PREDICTED: uncharacterized protein LOC103501503 isoform X2 [Cucumis 
melo]
Length=411

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            +DIGFS+E E   G KT ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKV
Sbjct  336  EDIGFSVECESPGGVKTLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKV  395

Query  341  DCIPPVVESSASANQ  297
            DCIPPVVE    A +
Sbjct  396  DCIPPVVEPVQPAAE  410



>dbj|BAD43397.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43553.1| unnamed protein product, partial [Arabidopsis thaliana]
Length=282

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  207  DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  266

Query  338  CIPPVVE  318
            CI PVVE
Sbjct  267  CIAPVVE  273



>gb|KFK24699.1| hypothetical protein AALP_AA8G013300 [Arabis alpina]
Length=427

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY  ++G+KT ILPYRRYE+DQGNF T MAGNYKLVWDNS+S+FF K LRYKVD
Sbjct  358  DIGFSVEYISATGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSFSTFFKKTLRYKVD  417

Query  338  CIPPVVESS  312
            CIPPVVE S
Sbjct  418  CIPPVVEPS  426



>gb|EPS68255.1| hypothetical protein M569_06516, partial [Genlisea aurea]
Length=463

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            QD+GFS+E  D SGK T ILPYRRYE+DQGNFC C+ GNYKL+WDNSY++FF KVLRYKV
Sbjct  397  QDVGFSIECTDLSGKTTKILPYRRYEADQGNFCACLLGNYKLIWDNSYAAFFRKVLRYKV  456

Query  341  DCIPPVV  321
            DCIPPVV
Sbjct  457  DCIPPVV  463



>ref|XP_008463316.1| PREDICTED: uncharacterized protein LOC103501503 isoform X1 [Cucumis 
melo]
Length=436

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E E   G KT ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVD
Sbjct  362  DIGFSVECESPGGVKTLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVD  421

Query  338  CIPPVVESSASANQ  297
            CIPPVVE    A +
Sbjct  422  CIPPVVEPVQPAAE  435



>ref|XP_010490476.1| PREDICTED: uncharacterized protein LOC104768250 isoform X1 [Camelina 
sativa]
 ref|XP_010490478.1| PREDICTED: uncharacterized protein LOC104768250 isoform X3 [Camelina 
sativa]
Length=434

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY  +SG++T ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYISASGEQTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CIPPVVE
Sbjct  423  CIPPVVE  429



>ref|NP_001190197.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90285.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=472

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            QDIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKV
Sbjct  396  QDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKV  455

Query  341  DCIPPVVE  318
            DCI PVVE
Sbjct  456  DCIAPVVE  463



>ref|XP_010490477.1| PREDICTED: uncharacterized protein LOC104768250 isoform X2 [Camelina 
sativa]
Length=434

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY  +SG++T ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYISASGEQTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CIPPVVE
Sbjct  423  CIPPVVE  429



>ref|NP_001154687.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90283.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=479

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            QDIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKV
Sbjct  403  QDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKV  462

Query  341  DCIPPVVE  318
            DCI PVVE
Sbjct  463  DCIAPVVE  470



>ref|XP_003521546.1| PREDICTED: uncharacterized protein LOC100778827 isoform 1 [Glycine 
max]
 gb|KHN42120.1| hypothetical protein glysoja_021610 [Glycine soja]
Length=434

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E+   +G+KT +LPYRRYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRYK+D
Sbjct  363  DIGFSLEFLSPTGEKTLMLPYRRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRYKID  422

Query  338  CIPPVVESSAS  306
            CIPPV +S  S
Sbjct  423  CIPPVTDSVQS  433



>dbj|BAD43927.1| unnamed protein product [Arabidopsis thaliana]
Length=358

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  283  DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  342

Query  338  CIPPVVE  318
            CI PVVE
Sbjct  343  CIAPVVE  349



>ref|XP_006398547.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ40000.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=432

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDN+YS+FF K LRYKVD
Sbjct  363  DIGFSVEYISASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNAYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CIPPVV+
Sbjct  423  CIPPVVQ  429



>dbj|BAD43795.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CI PVVE
Sbjct  423  CIAPVVE  429



>ref|NP_195721.5| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42982.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43305.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43143.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43301.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43345.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43526.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43539.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43565.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43716.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43767.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43772.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43786.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43808.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44005.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44013.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44023.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44099.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44270.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44410.1| unknown protein [Arabidopsis thaliana]
 gb|AED90282.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=438

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CI PVVE
Sbjct  423  CIAPVVE  429



>dbj|BAD43433.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43633.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43683.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43717.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43821.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CI PVVE
Sbjct  423  CIAPVVE  429



>ref|XP_006599750.1| PREDICTED: uncharacterized protein LOC100795582 isoform X2 [Glycine 
max]
Length=408

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E+   +G+KT +LPY RYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRYK+D
Sbjct  337  DIGFSLEFVSPTGEKTLMLPYGRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRYKID  396

Query  338  CIPPVVESSAS  306
            CIPPV ES  S
Sbjct  397  CIPPVTESVQS  407



>ref|XP_003548341.1| PREDICTED: uncharacterized protein LOC100795582 isoform X1 [Glycine 
max]
Length=434

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E+   +G+KT +LPY RYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRYK+D
Sbjct  363  DIGFSLEFVSPTGEKTLMLPYGRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRYKID  422

Query  338  CIPPVVESSAS  306
            CIPPV ES  S
Sbjct  423  CIPPVTESVQS  433



>gb|EYU42068.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=435

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E  + SG+KT ILPY+RYE++QGNFCTC+ GNYKL+WDNSYSSFF KVLRYKVD
Sbjct  364  DIGFSVECTNLSGEKTLILPYQRYEANQGNFCTCVPGNYKLIWDNSYSSFFKKVLRYKVD  423

Query  338  CIPPVVES  315
            CIPPVV+S
Sbjct  424  CIPPVVDS  431



>ref|XP_010278895.1| PREDICTED: uncharacterized protein LOC104612935 [Nelumbo nucifera]
Length=432

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY + SG+KT ILPYRRYESDQGNFCTCMAG YKL+WDNSYS+FF KVL YKVD
Sbjct  363  DIGFSVEYINPSGEKTMILPYRRYESDQGNFCTCMAGCYKLIWDNSYSTFFKKVLCYKVD  422

Query  338  CIPPVVESS  312
            CIPPV + +
Sbjct  423  CIPPVADPT  431



>ref|XP_004510081.1| PREDICTED: uncharacterized protein LOC101493369 isoform X1 [Cicer 
arietinum]
Length=434

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E+   +G+KT +LPYRRYESDQGNFCT MAG+YKL+WDN++S+FF KVLRYKVD
Sbjct  363  DIGFSLEFSSPTGEKTLMLPYRRYESDQGNFCTLMAGSYKLIWDNTHSTFFRKVLRYKVD  422

Query  338  CIPPVVE  318
            CIPPV E
Sbjct  423  CIPPVTE  429



>ref|XP_010673452.1| PREDICTED: uncharacterized protein LOC104889827 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E  +SSG+KT ILPYRR ESDQGNFCTCMAG YKL+WDNSYS+FF K L YKVD
Sbjct  358  DIGFSVECTNSSGEKTLILPYRRCESDQGNFCTCMAGTYKLIWDNSYSTFFRKALLYKVD  417

Query  338  CIPPVVE  318
            CIPPVVE
Sbjct  418  CIPPVVE  424



>ref|XP_004147520.1| PREDICTED: uncharacterized protein LOC101218161 [Cucumis sativus]
 gb|KGN53967.1| hypothetical protein Csa_4G197820 [Cucumis sativus]
Length=436

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E E   G K  ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVD
Sbjct  362  DIGFSVECESPGGVKRLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVD  421

Query  338  CIPPVVESSASANQ  297
            CIPPVVE    A +
Sbjct  422  CIPPVVEPVQPAAE  435



>ref|XP_009130613.1| PREDICTED: uncharacterized protein LOC103855392 isoform X1 [Brassica 
rapa]
Length=432

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY  +SG+KT ILPY RYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFCVEYISASGEKTLILPYHRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVE  318
            CIPPVVE
Sbjct  423  CIPPVVE  429



>ref|XP_007134600.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
 gb|ESW06594.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
Length=445

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E+   +G+KT +LP RRYESDQGNFCT MAG+YKL+WDN+YS+FF KV+RYK+D
Sbjct  363  DIGFSLEFVSPTGEKTLMLPSRRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVIRYKID  422

Query  338  CIPPVVESSAS-ANQLEG  288
            CIPPV E   S +N+ EG
Sbjct  423  CIPPVTEPVQSDSNKNEG  440



>emb|CDY11168.1| BnaA03g00040D [Brassica napus]
Length=474

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY  +SG+KT ILPY RYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVD
Sbjct  405  DIGFCVEYISASGEKTLILPYHRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVD  464

Query  338  CIPPVVE  318
            CIPPVVE
Sbjct  465  CIPPVVE  471



>ref|XP_010938085.1| PREDICTED: uncharacterized protein LOC105057244 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            +DIGF MEY   SG+ T ILPYRRYESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKV
Sbjct  337  EDIGFRMEYVSPSGEVTLILPYRRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKV  396

Query  341  DCIPPVVE  318
            D IPPVVE
Sbjct  397  DAIPPVVE  404



>ref|XP_010543127.1| PREDICTED: uncharacterized protein LOC104816146 isoform X2 [Tarenaya 
hassleriana]
Length=437

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 4/77 (5%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +E   +SG+KT ILPY+RYE+DQGNF TCM GNYKLVWDNSYS+FF K LRYKVD
Sbjct  363  DIGFRVECIGASGEKTLILPYQRYEADQGNFSTCMPGNYKLVWDNSYSTFFKKTLRYKVD  422

Query  338  CIPPVVESSASANQLEG  288
            CIPPVVE    A +L+G
Sbjct  423  CIPPVVE----ATELKG  435



>ref|XP_010543126.1| PREDICTED: uncharacterized protein LOC104816146 isoform X1 [Tarenaya 
hassleriana]
Length=448

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 4/77 (5%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +E   +SG+KT ILPY+RYE+DQGNF TCM GNYKLVWDNSYS+FF K LRYKVD
Sbjct  374  DIGFRVECIGASGEKTLILPYQRYEADQGNFSTCMPGNYKLVWDNSYSTFFKKTLRYKVD  433

Query  338  CIPPVVESSASANQLEG  288
            CIPPVVE    A +L+G
Sbjct  434  CIPPVVE----ATELKG  446



>ref|XP_010938084.1| PREDICTED: uncharacterized protein LOC105057244 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF MEY   SG+ T ILPYRRYESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKVD
Sbjct  363  DIGFRMEYVSPSGEVTLILPYRRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKVD  422

Query  338  CIPPVVE  318
             IPPVVE
Sbjct  423  AIPPVVE  429



>ref|XP_003568677.1| PREDICTED: uncharacterized protein LOC100826543 isoform X1 [Brachypodium 
distachyon]
Length=437

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  527  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  348
             L DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYS+FF K LRY
Sbjct  360  TLLDIGFHVEYISLSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSTFFKKTLRY  419

Query  347  KVDCIPPVVESS  312
            KVD +PPVVE +
Sbjct  420  KVDAVPPVVEPA  431



>ref|XP_006654248.1| PREDICTED: uncharacterized protein LOC102707586 [Oryza brachyantha]
Length=437

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  363  DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  422

Query  338  CIPPVVESSASANQ  297
             +PPVV  + +A +
Sbjct  423  AVPPVVTPAEAAAE  436



>ref|XP_003626627.1| hypothetical protein MTR_8g005040 [Medicago truncatula]
 gb|ABE93045.1| Proteinase inhibitor I4, serpin; emp24/gp25L/p24 [Medicago truncatula]
 gb|AET01103.1| serpin, putative [Medicago truncatula]
Length=428

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+E+   +G+K  +LPYRRYES+QGNFCT MAG+YKL+WDN++S+FF KVLRYKVD
Sbjct  357  DIGFSLEFASPTGEKILMLPYRRYESEQGNFCTLMAGSYKLIWDNTHSTFFRKVLRYKVD  416

Query  338  CIPPVVE  318
            CIPPV E
Sbjct  417  CIPPVAE  423



>ref|NP_001055152.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAF17066.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAG92466.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78947.1| hypothetical protein OsI_19396 [Oryza sativa Indica Group]
Length=439

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  365  DIGFHVEYISPSGQKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  424

Query  338  CIPPVVESSASANQ  297
             +PPVV  +  A +
Sbjct  425  AVPPVVAPAEPAAE  438



>ref|XP_008793391.1| PREDICTED: uncharacterized protein LOC103709697 isoform X3 [Phoenix 
dactylifera]
Length=413

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            +DIGF +EY   SG+ T ILPY+RYESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKV
Sbjct  337  EDIGFRVEYVSPSGEITMILPYQRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKV  396

Query  341  DCIPPVVES  315
            D IPPVVES
Sbjct  397  DAIPPVVES  405



>ref|XP_008793389.1| PREDICTED: uncharacterized protein LOC103709697 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+ T ILPY+RYESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKVD
Sbjct  363  DIGFRVEYVSPSGEITMILPYQRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKVD  422

Query  338  CIPPVVES  315
             IPPVVES
Sbjct  423  AIPPVVES  430



>ref|XP_010921253.1| PREDICTED: uncharacterized protein LOC105044884 isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  524  LQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYK  345
            ++DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYK
Sbjct  319  IRDIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYK  378

Query  344  VDCIPPVVES  315
            VD +PPVVE+
Sbjct  379  VDAVPPVVET  388



>ref|XP_010921254.1| PREDICTED: uncharacterized protein LOC105044884 isoform X4 [Elaeis 
guineensis]
Length=362

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  524  LQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYK  345
            ++DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYK
Sbjct  285  IRDIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYK  344

Query  344  VDCIPPVVES  315
            VD +PPVVE+
Sbjct  345  VDAVPPVVET  354



>ref|XP_008782734.1| PREDICTED: uncharacterized protein LOC103702180 isoform X2 [Phoenix 
dactylifera]
Length=312

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD
Sbjct  237  DIGFHVEYVSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVD  296

Query  338  CIPPVVES  315
             +PPVVE+
Sbjct  297  AVPPVVET  304



>ref|XP_010921250.1| PREDICTED: uncharacterized protein LOC105044884 isoform X1 [Elaeis 
guineensis]
Length=449

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  524  LQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYK  345
            ++DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYK
Sbjct  372  IRDIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYK  431

Query  344  VDCIPPVVES  315
            VD +PPVVE+
Sbjct  432  VDAVPPVVET  441



>ref|XP_008782731.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782732.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782733.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD
Sbjct  363  DIGFHVEYVSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVD  422

Query  338  CIPPVVES  315
             +PPVVE+
Sbjct  423  AVPPVVET  430



>ref|XP_010921251.1| PREDICTED: uncharacterized protein LOC105044884 isoform X2 [Elaeis 
guineensis]
Length=438

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD
Sbjct  363  DIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVD  422

Query  338  CIPPVVES  315
             +PPVVE+
Sbjct  423  AVPPVVET  430



>dbj|BAH57023.1| AT5G01010 [Arabidopsis thaliana]
Length=448

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 60/77 (78%), Gaps = 10/77 (13%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTP----------ILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSF  369
            DIGFS+EY ++SG+KT           ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+F
Sbjct  363  DIGFSVEYINASGEKTVSLLINFQTLLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTF  422

Query  368  FSKVLRYKVDCIPPVVE  318
            F K LRYKVDCI PVVE
Sbjct  423  FKKTLRYKVDCIAPVVE  439



>ref|XP_006842639.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
 gb|ERN04314.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
Length=440

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFS+EY   SG  T ILPY+RYESDQGNFCT  AG+YKL+WDNSYS+FF K LRYKVD
Sbjct  363  DIGFSVEYISPSGITTLILPYQRYESDQGNFCTVKAGSYKLIWDNSYSTFFKKNLRYKVD  422

Query  338  CIPPVVE  318
             IPPV E
Sbjct  423  AIPPVAE  429



>dbj|BAJ93195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  348
             L DIGF +EY   S +KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYS+FF K LRY
Sbjct  360  TLLDIGFHVEYISPSQEKTLILPYRRYEADQGNFCTVFAGSYKLVWDNSYSTFFKKTLRY  419

Query  347  KVDCIPPVVE  318
            KVD +P V E
Sbjct  420  KVDAVPSVTE  429



>ref|XP_007032241.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY03167.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=422

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 1/60 (2%)
 Frame = -3

Query  467  ILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLEG  288
            ILPYRRYESDQGNF TCMAG+YKL+WDNSYS+FF K LRYKVDCIPPV++ SA +N++EG
Sbjct  364  ILPYRRYESDQGNFSTCMAGHYKLIWDNSYSTFFKKALRYKVDCIPPVLD-SAESNEVEG  422



>ref|XP_010653095.1| PREDICTED: uncharacterized protein LOC100243295 isoform X2 [Vitis 
vinifera]
 emb|CAQ58613.1| Unknown gene [Vitis vinifera]
Length=432

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGFSMEY ++SG KT ILPYRRYESDQGNFCTCMAGNYKL+WDNSYS+FF K L   +D
Sbjct  363  DIGFSMEYTNASGDKTLILPYRRYESDQGNFCTCMAGNYKLIWDNSYSTFFKKNLVVFLD  422

Query  338  C  336
            C
Sbjct  423  C  423



>ref|XP_006429677.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42917.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=422

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  473  TPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQL  294
            T ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY+VDCIPPVVE     N+ 
Sbjct  362  TLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRYRVDCIPPVVEPMQPTNEA  421

Query  293  E  291
            E
Sbjct  422  E  422



>ref|XP_009391656.1| PREDICTED: uncharacterized protein LOC103977773 [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
             DIGF +EY + SG  T ILPYRRY SDQGNFCT +AG+YKL WDNSYS+F  K LRYKV
Sbjct  364  HDIGFHVEYVNPSGDVTLILPYRRYVSDQGNFCTILAGSYKLKWDNSYSTFSKKSLRYKV  423

Query  341  DCIPPVVES  315
            D +PPVV++
Sbjct  424  DAVPPVVDT  432



>ref|XP_004962482.1| PREDICTED: uncharacterized protein LOC101772803 isoform X2 [Setaria 
italica]
Length=437

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  363  DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  422



>ref|XP_004962481.1| PREDICTED: uncharacterized protein LOC101772803 isoform X1 [Setaria 
italica]
Length=439

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  365  DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  424



>ref|XP_004962483.1| PREDICTED: uncharacterized protein LOC101772803 isoform X3 [Setaria 
italica]
Length=437

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  339
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  363  DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  422



>gb|KDO37187.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=158

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLR  351
            DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLR
Sbjct  97   DIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLR  152



>gb|KJB27580.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=279

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKV  357
            DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF KV
Sbjct  222  DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKV  275



>ref|XP_006429676.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42916.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=424

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLR  351
            DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLR
Sbjct  363  DIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLR  418



>ref|NP_001154688.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH56815.1| AT5G01010 [Arabidopsis thaliana]
 gb|AED90284.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=429

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  348
            DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF KV RY
Sbjct  363  DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKVGRY  419



>ref|XP_002872981.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49240.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  348
            DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF KV RY
Sbjct  358  DIGFSLEYISASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKVGRY  414



>ref|XP_006296412.1| hypothetical protein CARUB_v10025590mg, partial [Capsella rubella]
 gb|EOA29310.1| hypothetical protein CARUB_v10025590mg, partial [Capsella rubella]
Length=55

 Score = 91.7 bits (226),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKV  357
            DIGFS+EY  +SG+KT ILPYRR+E++QGNF T MAGNYKLVWDNSYS+FF KV
Sbjct  1    DIGFSVEYISASGEKTLILPYRRFEAEQGNFSTLMAGNYKLVWDNSYSTFFKKV  54



>ref|XP_002980642.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
 gb|EFJ18293.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
Length=429

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            +D+GFS+EY  S+G K  +LPY+RY+S QGNF +   G+YKLVWDNSYS+F+ K +RYKV
Sbjct  354  KDVGFSVEYISSNGAKMQMLPYQRYDSHQGNFYSPGVGSYKLVWDNSYSTFYRKTVRYKV  413

Query  341  DCIPPVVESSASANQ  297
            D IPPV ++    +Q
Sbjct  414  DAIPPVADAQKLEDQ  428



>ref|XP_002991009.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
 gb|EFJ07817.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
Length=429

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            +D+GFS+EY  S+G K  +LPY+RY+S QGNF +   G+YKLVWDNSYS+F+ K +RYKV
Sbjct  354  KDVGFSVEYISSNGAKMQMLPYQRYDSHQGNFYSPGVGSYKLVWDNSYSTFYRKTVRYKV  413

Query  341  DCIPPVVESSASANQ  297
            D IPPV ++    +Q
Sbjct  414  DAIPPVADAQKLEDQ  428



>ref|XP_007032239.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY03165.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKV  357
            DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAG+YKL+WDNSYS+FF K+
Sbjct  363  DIGFSVEYTNTVGEKTLILPYRRYESDQGNFSTCMAGHYKLIWDNSYSTFFKKL  416



>ref|XP_006429678.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42918.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=437

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSK  360
            DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF K
Sbjct  363  DIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKK  415



>gb|EEE63181.1| hypothetical protein OsJ_17990 [Oryza sativa Japonica Group]
Length=431

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLR  351
            DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K L+
Sbjct  365  DIGFHVEYISPSGQKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKGLQ  420



>ref|XP_001765571.1| predicted protein [Physcomitrella patens]
 gb|EDQ69621.1| predicted protein [Physcomitrella patens]
Length=444

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  342
            +DIGFS+E  DSS    P+ PY+RYE+ QG+F +   GNY+LVWDN+YS+F+ K LRYKV
Sbjct  359  KDIGFSVELVDSSRATRPMFPYQRYETHQGSFQSPCVGNYRLVWDNTYSNFYRKYLRYKV  418

Query  341  DCIPPVVESS  312
            D IPPV+E +
Sbjct  419  DEIPPVLEEA  428



>ref|XP_010231533.1| PREDICTED: uncharacterized protein LOC100826543 isoform X2 [Brachypodium 
distachyon]
Length=423

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  527  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSK  360
             L DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYS+FF K
Sbjct  360  TLLDIGFHVEYISLSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSTFFKK  415



>gb|EFN84723.1| SEC14-like protein 2 [Harpegnathos saltator]
Length=125

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVL  354
             DI F +  +D+SG KT ++P RR   ++S++     C +   Y +V+DN+YS   +K +
Sbjct  46   HDIKFGILRKDTSGTKTEVIPIRRVASHQSEEIGILNCEVPAIYSIVFDNTYSFLRNKKV  105

Query  353  RYKVDCIPPVVESSASAN  300
             Y V  +PP+ E+ AS +
Sbjct  106  HYSVRVLPPMQETEASTS  123



>ref|XP_011139122.1| PREDICTED: SEC14-like protein 2 [Harpegnathos saltator]
Length=190

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKKTPILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVL  354
             DI F +  +D+SG KT ++P RR   ++S++     C +   Y +V+DN+YS   +K +
Sbjct  111  HDIKFGILRKDTSGTKTEVIPIRRVASHQSEEIGILNCEVPAIYSIVFDNTYSFLRNKKV  170

Query  353  RYKVDCIPPVVESSASAN  300
             Y V  +PP+ E+ AS +
Sbjct  171  HYSVRVLPPMQETEASTS  188



>ref|XP_008793390.1| PREDICTED: uncharacterized protein LOC103709697 isoform X2 [Phoenix 
dactylifera]
Length=419

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 5/58 (9%)
 Frame = -1

Query  469  QSYLTDAMNLIKATSAHAWLEITNSYGTILIHHSSARSCVTRWTVYLQLWSHRLRLIN  296
            Q Y +D     +  SA +W + TNSYG I I H S R+C TRW +Y  LW+ R  L+N
Sbjct  346  QRYESD-----QEISAQSWPDPTNSYGIIPIRHFSKRACGTRWMLYPLLWNRRSFLLN  398



>ref|XP_002602154.1| hypothetical protein BRAFLDRAFT_234283 [Branchiostoma floridae]
 gb|EEN58166.1| hypothetical protein BRAFLDRAFT_234283, partial [Branchiostoma 
floridae]
Length=128

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 6/77 (8%)
 Frame = -3

Query  521  QDIGFSMEYEDSSGKK--TPILPY----RRYESDQGNFCTCMAGNYKLVWDNSYSSFFSK  360
            ++IGFS+ Y++S   +    ++P        ++ QG      AG Y L++DNSYS F SK
Sbjct  52   KNIGFSVTYKESEAHEDSQVLIPMCKCNSHRQAVQGELIAKRAGVYTLMFDNSYSRFTSK  111

Query  359  VLRYKVDCIPPVVESSA  309
             L YK+    PV E+S+
Sbjct  112  KLTYKLQVKRPVTEASS  128



>ref|XP_006398545.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39998.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=412

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 4/47 (9%)
 Frame = -3

Query  518  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSY  378
            DIGFS+EY  +SG+KT ILPYRRYE+DQ +   C+   +KL++ N +
Sbjct  363  DIGFSVEYISASGEKTLILPYRRYEADQVS-AMCI---WKLLYANGW  405



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400