BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050I04

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     162   5e-46   Nicotiana sylvestris
gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               162   5e-46   Nicotiana tabacum [American tobacco]
ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     163   1e-45   Nicotiana tomentosiformis
emb|CDP16685.1|  unnamed protein product                                158   2e-45   Coffea canephora [robusta coffee]
ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     159   9e-45   Solanum tuberosum [potatoes]
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          158   1e-44   Solanum lycopersicum
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          158   8e-44   Eucalyptus grandis [rose gum]
emb|CAN82189.1|  hypothetical protein VITISV_031114                     158   1e-43   Vitis vinifera
ref|NP_001268190.1|  uncharacterized protein LOC100260066               158   1e-43   Vitis vinifera
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    157   1e-43   Vitis vinifera
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like     148   4e-43   Solanum tuberosum [potatoes]
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like     145   2e-42   Solanum lycopersicum
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     160   6e-42   Sesamum indicum [beniseed]
gb|KHN01525.1|  Chloride channel protein CLC-b                          150   3e-41   Glycine soja [wild soybean]
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                157   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     154   5e-41   Sesamum indicum [beniseed]
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             147   8e-41   Citrus clementina [clementine]
ref|NP_001236494.1|  chloride channel                                   150   8e-41   
ref|XP_006447085.1|  hypothetical protein CICLE_v10014341mg             147   1e-40   
gb|KDP46292.1|  hypothetical protein JCGZ_10132                         145   1e-40   Jatropha curcas
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    150   1e-40   Glycine max [soybeans]
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    150   1e-40   Glycine max [soybeans]
ref|XP_002509531.1|  chloride channel clc, putative                     150   2e-40   Ricinus communis
gb|KHN24330.1|  Chloride channel protein CLC-b                          149   2e-40   Glycine soja [wild soybean]
gb|KDO43317.1|  hypothetical protein CISIN_1g0039662mg                  145   2e-40   Citrus sinensis [apfelsine]
ref|XP_002300101.1|  Chloride channel protein CLC-a                     151   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          151   2e-40   Populus euphratica
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             147   2e-40   Phaseolus vulgaris [French bean]
ref|XP_007031847.1|  Chloride channel B isoform 1                       149   3e-40   
ref|XP_007031848.1|  Chloride channel B isoform 2                       149   3e-40   
gb|KEH22046.1|  ClC chloride channel family protein                     147   5e-40   Medicago truncatula
ref|XP_010111585.1|  Chloride channel protein CLC-b                     153   8e-40   Morus notabilis
gb|KHN10806.1|  Chloride channel protein CLC-b                          148   1e-39   Glycine soja [wild soybean]
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             149   1e-39   Phaseolus vulgaris [French bean]
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     147   2e-39   Cicer arietinum [garbanzo]
gb|KDO43321.1|  hypothetical protein CISIN_1g0039662mg                  147   5e-39   Citrus sinensis [apfelsine]
gb|KEH25446.1|  ClC chloride channel family protein                     150   6e-39   Medicago truncatula
gb|AES75065.2|  ClC chloride channel family protein                     149   9e-39   Medicago truncatula
ref|XP_003618847.1|  Chloride channel protein CLC-a                     149   9e-39   
gb|KEH25445.1|  ClC chloride channel family protein                     149   1e-38   Medicago truncatula
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             141   2e-38   Prunus persica
ref|NP_001267676.1|  chloride channel protein CLC-b-like                143   3e-38   Cucumis sativus [cucumbers]
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     144   4e-38   Cucumis melo [Oriental melon]
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          140   4e-38   Prunus mume [ume]
gb|KJB76409.1|  hypothetical protein B456_012G087500                    144   8e-38   Gossypium raimondii
gb|KJB76407.1|  hypothetical protein B456_012G087500                    144   9e-38   Gossypium raimondii
gb|KHG13135.1|  Chloride channel CLC-b -like protein                    143   2e-37   Gossypium arboreum [tree cotton]
ref|XP_010556277.1|  PREDICTED: chloride channel protein CLC-b          143   8e-37   
gb|KHF97413.1|  Chloride channel CLC-b -like protein                    144   9e-37   Gossypium arboreum [tree cotton]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    141   1e-36   Gossypium raimondii
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          145   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_008341308.1|  PREDICTED: chloride channel protein CLC-b          138   3e-36   
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             144   4e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     144   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     143   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             142   1e-35   Capsella rubella
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    142   1e-35   Arabis alpina [alpine rockcress]
ref|XP_010678326.1|  PREDICTED: chloride channel protein CLC-b-li...    141   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    142   2e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                139   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    140   4e-35   
emb|CDY28488.1|  BnaC02g36720D                                          140   5e-35   Brassica napus [oilseed rape]
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     140   5e-35   Tarenaya hassleriana [spider flower]
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     138   7e-35   Fragaria vesca subsp. vesca
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     136   7e-35   
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          140   7e-35   Brassica rapa
emb|CDY13685.1|  BnaA06g32380D                                          139   2e-34   Brassica napus [oilseed rape]
emb|CDX83663.1|  BnaC07g24030D                                          139   2e-34   
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    138   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002875360.1|  CLC-B                                              138   4e-34   
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    138   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          138   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    138   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    137   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     137   6e-34   
ref|NP_189353.1|  chloride channel protein CLC-b                        137   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     137   6e-34   Brassica rapa
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     137   7e-34   
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     137   1e-33   
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     136   2e-33   Brassica rapa
emb|CDX67478.1|  BnaA07g15180D                                          136   2e-33   
emb|CDY11722.1|  BnaC06g13300D                                          135   4e-33   Brassica napus [oilseed rape]
gb|ADD09860.1|  chloride channel A                                      135   4e-33   Eutrema halophilum
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             135   5e-33   Eutrema salsugineum [saltwater cress]
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          135   5e-33   Brassica rapa
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          135   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          135   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     134   1e-32   Camelina sativa [gold-of-pleasure]
ref|NP_198905.1|  chloride channel protein CLC-a                        134   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24139.1|  putative anion channel protein                          134   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     134   1e-32   
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             134   1e-32   Capsella rubella
ref|NP_001031990.1|  chloride channel protein CLC-a                     133   1e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAA96057.1|  CLC-a chloride channel protein                         134   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAB17007.1|  voltage-gated chloride channel                          134   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    134   2e-32   Arabis alpina [alpine rockcress]
ref|XP_002868624.1|  ATCLC-A                                            133   2e-32   
emb|CDY34173.1|  BnaA02g28670D                                          132   2e-32   Brassica napus [oilseed rape]
emb|CDY15925.1|  BnaA04g11860D                                          133   2e-32   Brassica napus [oilseed rape]
gb|EMS65031.1|  Chloride channel protein CLC-b                          130   3e-32   Triticum urartu
gb|EMT27070.1|  Chloride channel protein CLC-b                          130   8e-32   
gb|EMT23598.1|  hypothetical protein F775_52599                         130   2e-31   
dbj|BAJ88201.1|  predicted protein                                      130   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX99630.1|  BnaC04g33870D                                          130   2e-31   
dbj|BAJ91019.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92499.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96369.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like     130   3e-31   Oryza brachyantha
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like     130   4e-31   Brachypodium distachyon [annual false brome]
ref|XP_008441632.1|  PREDICTED: chloride channel protein CLC-b-like     123   5e-31   
gb|EEC69202.1|  hypothetical protein OsI_38195                          125   6e-30   Oryza sativa Indica Group [Indian rice]
gb|EEE53145.1|  hypothetical protein OsJ_35963                          125   8e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98017.1|  Chloride channel protein CLC-a, putative, expressed     125   9e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1     125   1e-29   Zea mays [maize]
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...    125   1e-29   Setaria italica
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090          125   1e-29   Sorghum bicolor [broomcorn]
ref|NP_001066692.1|  Os12g0438600                                       125   1e-29   
ref|XP_006848425.1|  hypothetical protein AMTR_s00013p00233550          115   4e-26   
gb|KJB76408.1|  hypothetical protein B456_012G087500                    102   3e-25   Gossypium raimondii
gb|AFB33948.1|  hypothetical protein CL1659Contig1_02                   103   1e-24   Abies alba [abete-blanco]
ref|XP_007031850.1|  Chloride channel B isoform 4                     96.7    2e-24   
ref|NP_001268085.1|  uncharacterized protein LOC100259734               110   4e-24   Vitis vinifera
emb|CBI27719.3|  unnamed protein product                                109   4e-24   Vitis vinifera
gb|AFB33961.1|  hypothetical protein CL1659Contig1_02                   100   1e-23   Pinus mugo [mountain pine]
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like     107   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010099521.1|  Chloride channel protein CLC-c                     101   3e-23   
gb|AEW08796.1|  hypothetical protein CL1659Contig1_02                 99.0    4e-23   Pinus lambertiana
gb|ADD09861.1|  chloride channel C                                      105   1e-22   Eutrema halophilum
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg             105   1e-22   Eutrema salsugineum [saltwater cress]
gb|AFB33956.1|  hypothetical protein CL1659Contig1_02                 97.8    1e-22   Pinus cembra [Arve]
gb|AEW08797.1|  hypothetical protein CL1659Contig1_02                 97.4    1e-22   Pinus radiata
gb|AFG64985.1|  hypothetical protein CL1659Contig1_02                 97.4    2e-22   Pinus taeda
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like     105   2e-22   Nicotiana sylvestris
gb|KJB40519.1|  hypothetical protein B456_007G067500                    104   2e-22   Gossypium raimondii
gb|KHG07842.1|  Chloride channel CLC-c -like protein                    104   2e-22   Gossypium arboreum [tree cotton]
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...    104   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like     104   2e-22   Nicotiana tomentosiformis
gb|EMT27046.1|  Chloride channel protein CLC-c                          104   3e-22   
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like     104   3e-22   Oryza brachyantha
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like     104   3e-22   Eucalyptus grandis [rose gum]
ref|NP_001169702.1|  uncharacterized protein LOC100383583               101   3e-22   
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...  96.7    5e-22   
gb|ADW93911.1|  chloride channel 1                                      103   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like     103   5e-22   
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    103   5e-22   
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...    103   5e-22   Elaeis guineensis
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like     103   5e-22   Cicer arietinum [garbanzo]
ref|XP_007048601.1|  Chloride channel C                                 103   5e-22   
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like     103   5e-22   Phoenix dactylifera
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250          103   6e-22   Sorghum bicolor [broomcorn]
ref|XP_010905340.1|  PREDICTED: putative chloride channel-like pr...    103   6e-22   Elaeis guineensis
ref|XP_002865761.1|  CLC-C                                              103   7e-22   
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg             103   7e-22   Capsella rubella
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...    103   7e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...    103   7e-22   Phoenix dactylifera
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like     103   7e-22   Brachypodium distachyon [annual false brome]
ref|NP_199800.1|  chloride channel protein CLC-c                        103   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like     103   8e-22   Solanum lycopersicum
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c          103   9e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like     103   9e-22   Camelina sativa [gold-of-pleasure]
emb|CDX91539.1|  BnaC02g16210D                                          103   9e-22   
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like     103   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like     102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c          102   1e-21   Brassica rapa
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c          102   1e-21   Brassica rapa
emb|CDY21447.1|  BnaC03g27500D                                          102   1e-21   Brassica napus [oilseed rape]
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like     102   1e-21   Camelina sativa [gold-of-pleasure]
ref|NP_001275140.1|  chloride channel protein CLC-c-like                102   1e-21   Solanum tuberosum [potatoes]
ref|XP_006852872.1|  hypothetical protein AMTR_s00033p00206270          102   1e-21   Amborella trichopoda
ref|XP_006385193.1|  Chloride channel protein CLC-c                     102   1e-21   
ref|XP_006836849.1|  hypothetical protein AMTR_s00099p00074960          102   1e-21   Amborella trichopoda
ref|XP_002527858.1|  chloride channel clc, putative                     102   1e-21   
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...    102   1e-21   Fragaria vesca subsp. vesca
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like     102   1e-21   Elaeis guineensis
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...    102   2e-21   Brachypodium distachyon [annual false brome]
gb|AFW70592.1|  hypothetical protein ZEAMMB73_317914                    102   2e-21   
ref|XP_009586705.1|  PREDICTED: putative chloride channel-like pr...    102   2e-21   Nicotiana tomentosiformis
ref|XP_011084086.1|  PREDICTED: putative chloride channel-like pr...    101   2e-21   
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...    102   2e-21   
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g             102   2e-21   Phaseolus vulgaris [French bean]
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...    102   2e-21   Fragaria vesca subsp. vesca
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...    102   2e-21   Vitis vinifera
gb|KDP42489.1|  hypothetical protein JCGZ_00286                         102   2e-21   Jatropha curcas
ref|NP_001268053.1|  uncharacterized protein LOC100245380               102   2e-21   Vitis vinifera
ref|XP_010240516.1|  PREDICTED: putative chloride channel-like pr...    101   2e-21   
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c          102   3e-21   Fragaria vesca subsp. vesca
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...    101   3e-21   Nicotiana sylvestris
gb|EPS68170.1|  hypothetical protein M569_06601                         101   3e-21   Genlisea aurea
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...    101   3e-21   Eucalyptus grandis [rose gum]
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...    101   3e-21   Setaria italica
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...    101   3e-21   Nicotiana tomentosiformis
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg             101   3e-21   
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...    101   3e-21   Phoenix dactylifera
ref|XP_009777969.1|  PREDICTED: putative chloride channel-like pr...    101   3e-21   Nicotiana sylvestris
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like     101   3e-21   Nicotiana sylvestris
gb|AAQ56538.1|  putative chloride channel                               101   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like     101   4e-21   Nicotiana tomentosiformis
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...    101   4e-21   Solanum tuberosum [potatoes]
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like     101   4e-21   Populus euphratica
ref|XP_010099780.1|  Chloride channel protein CLC-c                     101   4e-21   Morus notabilis
emb|CDX83179.1|  BnaA03g23270D                                          101   4e-21   
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g            101   4e-21   
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like     101   4e-21   Populus euphratica
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c          101   4e-21   
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...    101   4e-21   Solanum lycopersicum
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...    100   5e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...    101   5e-21   
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...    100   5e-21   
emb|CBI29647.3|  unnamed protein product                                100   6e-21   Vitis vinifera
ref|XP_010657886.1|  PREDICTED: uncharacterized protein LOC100245...    100   6e-21   Vitis vinifera
ref|XP_006381102.1|  chloride channel-like family protein               100   8e-21   
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870              100   8e-21   
tpg|DAA35720.1|  TPA: chloride channel G                                100   8e-21   
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g            100   8e-21   Glycine soja [wild soybean]
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...    100   8e-21   Glycine max [soybeans]
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...    100   9e-21   Elaeis guineensis
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570          100   9e-21   Sorghum bicolor [broomcorn]
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...    100   9e-21   Sesamum indicum [beniseed]
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...    100   9e-21   Oryza brachyantha
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...    100   9e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003592890.1|  Chloride channel protein CLC-c                     100   1e-20   Medicago truncatula
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c          100   1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c          100   1e-20   Solanum lycopersicum
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                   100   1e-20   Citrus sinensis [apfelsine]
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg                100   1e-20   Erythranthe guttata [common monkey flower]
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                    100   1e-20   
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg           99.8    1e-20   Prunus persica
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1           100   1e-20   Zea mays [maize]
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                99.8    1e-20   Medicago truncatula
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like   99.8    1e-20   Solanum tuberosum [potatoes]
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870            99.8    1e-20   
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...  99.8    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB46914.1|  hypothetical protein B456_008G001200                  99.8    1e-20   Gossypium raimondii
dbj|BAB97267.1|  chloride channel                                     99.8    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like   99.8    1e-20   
gb|KHG08138.1|  Chloride channel CLC-c -like protein                  99.4    1e-20   Gossypium arboreum [tree cotton]
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530        99.8    2e-20   Sorghum bicolor [broomcorn]
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like   99.4    2e-20   Populus euphratica
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...  99.4    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c        99.4    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008379004.1|  PREDICTED: chloride channel protein CLC-c        99.0    2e-20   
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                 99.4    2e-20   Citrus sinensis [apfelsine]
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg           99.4    2e-20   Citrus clementina [clementine]
gb|EAY94258.1|  hypothetical protein OsI_16029                        99.4    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like   99.8    2e-20   Setaria italica
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...  99.4    2e-20   Setaria italica
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g          99.4    2e-20   
ref|XP_002530769.1|  chloride channel clc, putative                   99.0    2e-20   Ricinus communis
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...  99.0    2e-20   
gb|EEE60792.1|  hypothetical protein OsJ_14377                        99.0    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g          99.4    2e-20   Triticum urartu
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...  99.0    2e-20   Populus euphratica
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like   99.0    2e-20   Populus euphratica
ref|NP_001130407.2|  chloride channel G                               99.4    2e-20   
ref|XP_004155280.1|  PREDICTED: chloride channel protein CLC-c-like   98.2    3e-20   
gb|ACF78606.1|  unknown                                               97.8    3e-20   Zea mays [maize]
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g          98.6    3e-20   Triticum urartu
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...  99.0    3e-20   Citrus sinensis [apfelsine]
ref|XP_006385076.1|  Chloride channel protein CLC-c                   98.6    3e-20   
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c-li...  98.6    3e-20   Cucumis sativus [cucumbers]
gb|KDO42565.1|  hypothetical protein CISIN_1g003885mg                 98.2    4e-20   Citrus sinensis [apfelsine]
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like   98.2    4e-20   Pyrus x bretschneideri [bai li]
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...  98.6    4e-20   Prunus mume [ume]
ref|XP_006431488.1|  hypothetical protein CICLE_v10000336mg           98.2    4e-20   
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...  98.2    4e-20   
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...  98.2    4e-20   Vitis vinifera
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  98.2    5e-20   Cucumis melo [Oriental melon]
ref|NP_001170245.1|  uncharacterized protein LOC100384199             96.7    5e-20   
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c        98.2    5e-20   Tarenaya hassleriana [spider flower]
gb|AES75975.2|  chloride channel ClC1 protein                         98.2    5e-20   Medicago truncatula
emb|CAD41919.2|  OSJNBa0033G05.20                                     98.2    5e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ABB86548.1|  chloride channel-like protein Osclc                   98.2    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like   98.2    5e-20   Beta vulgaris subsp. vulgaris [field beet]
emb|CAJ86158.1|  H0413E07.11                                          98.2    5e-20   Oryza sativa [red rice]
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...  98.2    5e-20   Glycine max [soybeans]
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890        98.2    5e-20   Sorghum bicolor [broomcorn]
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...  97.8    5e-20   Populus euphratica
emb|CAN62616.1|  hypothetical protein VITISV_036165                   98.2    5e-20   Vitis vinifera
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...  97.8    6e-20   Glycine max [soybeans]
ref|NP_001267998.1|  uncharacterized protein LOC100255837             97.8    6e-20   
ref|XP_006470993.1|  PREDICTED: chloride channel protein CLC-c-li...  97.4    6e-20   
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...  97.8    6e-20   
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...  97.8    6e-20   
gb|EEC78120.1|  hypothetical protein OsI_17660                        94.7    6e-20   
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...  97.8    6e-20   
gb|KHM99790.1|  Chloride channel protein CLC-c                        97.8    6e-20   
ref|XP_003619757.1|  Chloride channel protein CLC-c                   97.8    6e-20   
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like   97.8    7e-20   
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                  97.8    7e-20   
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like   97.4    7e-20   
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...  97.8    7e-20   
ref|XP_004133731.1|  PREDICTED: chloride channel protein CLC-c-li...  97.4    7e-20   
gb|EEE61792.1|  hypothetical protein OsJ_16396                        97.8    7e-20   
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like   97.4    8e-20   
ref|NP_001105216.1|  LOC542114                                        97.4    8e-20   
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like   97.1    1e-19   
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like   97.1    1e-19   
ref|XP_006587398.1|  PREDICTED: chloride channel protein CLC-c-li...  96.7    1e-19   
gb|KJB64678.1|  hypothetical protein B456_010G060300                  97.1    1e-19   
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like   97.1    1e-19   
gb|KEH26640.1|  chloride channel ClC1 protein                         96.7    1e-19   
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...  97.1    1e-19   
ref|XP_006599665.1|  PREDICTED: chloride channel protein CLC-c-li...  96.7    1e-19   
gb|KHN24457.1|  Chloride channel protein CLC-c                        96.3    1e-19   
dbj|BAD16425.1|  chloride channel                                     96.7    1e-19   
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg           96.7    1e-19   
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like   96.7    2e-19   
ref|XP_010057599.1|  PREDICTED: putative chloride channel-like pr...  96.3    2e-19   
dbj|BAB97268.1|  chloride channel                                     96.7    2e-19   
gb|AIY56605.1|  CLC                                                   96.7    2e-19   
ref|XP_010030224.1|  PREDICTED: chloride channel protein CLC-c-li...  96.3    2e-19   
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...  96.7    2e-19   
emb|CDO97645.1|  unnamed protein product                              96.7    2e-19   
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...  96.3    2e-19   
ref|NP_001047143.2|  Os02g0558100                                     95.9    2e-19   
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...  96.3    2e-19   
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...  95.9    2e-19   
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like   95.5    4e-19   
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...  95.5    4e-19   
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...  95.1    4e-19   
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...  95.1    4e-19   
ref|XP_006389435.1|  chloride channel-like family protein             95.1    5e-19   
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g           95.1    5e-19   
gb|KDP44103.1|  hypothetical protein JCGZ_05570                       95.1    5e-19   
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...  94.4    9e-19   
gb|KHG01487.1|  Putative chloride channel-like protein CLC-g          94.0    1e-18   
gb|KJB53990.1|  hypothetical protein B456_009G015100                  94.4    1e-18   
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...  94.0    1e-18   
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like   94.0    1e-18   
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...  94.0    1e-18   
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...  93.6    2e-18   
emb|CDY47559.1|  BnaA08g07280D                                        93.6    2e-18   
emb|CDP10469.1|  unnamed protein product                              93.6    2e-18   
gb|KEH32756.1|  chloride channel ClC1 protein                         93.2    2e-18   
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...  93.2    2e-18   
ref|NP_198313.2|  putative chloride channel-like protein CLC-g        93.2    3e-18   
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...  92.8    3e-18   
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                  92.8    3e-18   
emb|CDY12393.1|  BnaC08g08120D                                        92.8    3e-18   
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...  92.8    3e-18   
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c        92.4    4e-18   
ref|XP_004512645.1|  PREDICTED: chloride channel protein CLC-c-li...  92.0    4e-18   
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...  92.0    5e-18   
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...  92.0    5e-18   
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...  92.0    6e-18   
gb|EMT05380.1|  Chloride channel protein CLC-c                        85.9    9e-18   
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg           91.3    9e-18   
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...  91.3    1e-17   
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like   91.3    1e-17   
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576           91.3    1e-17   
gb|ADF30876.1|  chloride channel protein                              91.3    1e-17   
gb|EEE55755.1|  hypothetical protein OsJ_04269                        91.3    1e-17   
gb|EEC71893.1|  hypothetical protein OsI_04638                        90.9    1e-17   
dbj|BAD82092.1|  putative chloride channel                            90.9    1e-17   
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg           90.1    2e-17   
tpg|DAA56573.1|  TPA: chloride channel protein                        90.1    2e-17   
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg              90.1    3e-17   
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c        90.1    3e-17   
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480        90.1    3e-17   
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg           89.7    3e-17   
gb|KCW82974.1|  hypothetical protein EUGRSUZ_C04362                   89.0    4e-17   
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...  89.4    5e-17   
gb|KCW82961.1|  hypothetical protein EUGRSUZ_C04346                   89.0    5e-17   
ref|XP_002325287.2|  hypothetical protein POPTR_0019s00230g           88.6    6e-17   
ref|XP_006370817.1|  hypothetical protein POPTR_0019s00230g           88.6    6e-17   
gb|EMS55037.1|  Chloride channel protein CLC-c                        89.0    7e-17   
ref|XP_010554105.1|  PREDICTED: chloride channel protein CLC-b-like   82.0    7e-17   
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like   89.0    7e-17   
ref|XP_006388253.1|  hypothetical protein POPTR_0261s002201g          87.0    8e-17   
gb|EMT28663.1|  Chloride channel protein CLC-c                        88.2    1e-16   
ref|XP_004165980.1|  PREDICTED: putative chloride channel-like pr...  87.8    2e-16   
gb|EMS67360.1|  Chloride channel protein CLC-c                        87.0    3e-16   
gb|EPS73799.1|  hypothetical protein M569_00956                       85.9    8e-16   
ref|NP_001183936.1|  chloride channel protein                         80.1    9e-16   
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...  80.9    9e-16   
dbj|BAJ92873.1|  predicted protein                                    84.3    2e-15   
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906           83.6    4e-15   
gb|KDP30234.1|  hypothetical protein JCGZ_17016                       83.6    4e-15   
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g           65.5    9e-15   
gb|EMS50378.1|  Chloride channel protein CLC-c                        82.0    1e-14   
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...  82.0    2e-14   
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...  81.6    2e-14   
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...  81.3    2e-14   
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899           81.3    2e-14   
gb|KJB40520.1|  hypothetical protein B456_007G067500                  80.9    3e-14   
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...  78.6    2e-13   
ref|XP_001756485.1|  predicted protein                                78.6    2e-13   
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...  77.8    3e-13   
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...  77.4    5e-13   
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g     76.3    1e-12   
gb|AES93978.2|  chloride channel ClC-like protein, putative           72.0    2e-12   
ref|XP_003611020.1|  Cl-channel clc-7                                 72.4    3e-12   
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...  74.7    3e-12   
gb|KHG02940.1|  Putative chloride channel-like protein CLC-g          73.9    7e-12   
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...  73.6    1e-11   
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                   72.0    2e-11   
emb|CDM85188.1|  unnamed protein product                              72.0    3e-11   
gb|ADF78069.1|  chloride channel protein                              71.2    5e-11   
ref|XP_001782456.1|  predicted protein                                70.9    7e-11   
gb|EYU45642.1|  hypothetical protein MIMGU_mgv1a0022071mg             68.2    7e-11   
ref|XP_002963642.1|  hypothetical protein SELMODRAFT_80232            70.9    7e-11   
gb|EYU45643.1|  hypothetical protein MIMGU_mgv1a0022071mg             67.8    8e-11   
ref|XP_002974732.1|  hypothetical protein SELMODRAFT_101801           70.1    1e-10   
ref|XP_010277677.1|  PREDICTED: chloride channel protein CLC-d-li...  70.1    1e-10   
ref|XP_010277670.1|  PREDICTED: chloride channel protein CLC-d-li...  70.1    1e-10   
ref|XP_010277691.1|  PREDICTED: chloride channel protein CLC-d-li...  69.7    2e-10   
ref|XP_010277685.1|  PREDICTED: chloride channel protein CLC-d-li...  69.7    2e-10   
ref|NP_001267905.1|  uncharacterized protein LOC100261408             69.3    2e-10   
ref|XP_010649611.1|  PREDICTED: uncharacterized protein LOC100261...  69.3    2e-10   
ref|XP_010546808.1|  PREDICTED: chloride channel protein CLC-d is...  68.9    3e-10   
ref|XP_010546809.1|  PREDICTED: chloride channel protein CLC-d is...  68.9    3e-10   
ref|XP_010255990.1|  PREDICTED: chloride channel protein CLC-d is...  68.9    3e-10   
ref|XP_006838275.1|  hypothetical protein AMTR_s00103p00080940        68.9    3e-10   
gb|KDO74669.1|  hypothetical protein CISIN_1g003732mg                 68.6    3e-10   
gb|KDO74671.1|  hypothetical protein CISIN_1g003732mg                 68.6    4e-10   
ref|XP_010255988.1|  PREDICTED: chloride channel protein CLC-d is...  68.6    4e-10   
ref|XP_010255989.1|  PREDICTED: chloride channel protein CLC-d is...  68.6    4e-10   
ref|XP_006419888.1|  hypothetical protein CICLE_v10004375mg           68.6    4e-10   
ref|XP_007034702.1|  Chloride channel clc, putative isoform 3         68.6    4e-10   
ref|XP_006489358.1|  PREDICTED: chloride channel protein CLC-d-li...  68.6    4e-10   
ref|XP_007034701.1|  Chloride channel clc, putative isoform 2         68.6    4e-10   
ref|XP_010524817.1|  PREDICTED: chloride channel protein CLC-d is...  68.6    4e-10   
ref|XP_007034700.1|  Chloride channel clc, putative isoform 1         68.6    4e-10   
ref|XP_008222943.1|  PREDICTED: chloride channel protein CLC-d is...  68.2    5e-10   
ref|XP_010524816.1|  PREDICTED: chloride channel protein CLC-d is...  68.2    5e-10   
gb|KJB12552.1|  hypothetical protein B456_002G024000                  68.2    5e-10   
ref|XP_008222944.1|  PREDICTED: chloride channel protein CLC-d is...  68.2    5e-10   
ref|XP_008222942.1|  PREDICTED: chloride channel protein CLC-d is...  68.2    5e-10   
gb|KHG12041.1|  Chloride channel CLC-d -like protein                  66.2    5e-10   
gb|KCW60809.1|  hypothetical protein EUGRSUZ_H03545                   65.5    5e-10   
ref|XP_010524818.1|  PREDICTED: chloride channel protein CLC-d is...  68.2    6e-10   
ref|XP_009765642.1|  PREDICTED: chloride channel protein CLC-d is...  68.2    6e-10   
ref|XP_008222941.1|  PREDICTED: chloride channel protein CLC-d is...  68.2    6e-10   
ref|XP_011071570.1|  PREDICTED: chloride channel protein CLC-d is...  67.8    6e-10   
ref|XP_011021557.1|  PREDICTED: chloride channel protein CLC-d is...  67.8    6e-10   
emb|CDO99033.1|  unnamed protein product                              67.8    7e-10   
gb|KJB12549.1|  hypothetical protein B456_002G024000                  67.8    7e-10   
gb|KJB12550.1|  hypothetical protein B456_002G024000                  67.8    7e-10   
ref|XP_010024357.1|  PREDICTED: chloride channel protein CLC-d        65.5    7e-10   
ref|XP_009765643.1|  PREDICTED: chloride channel protein CLC-d is...  67.8    7e-10   
ref|XP_004296904.1|  PREDICTED: chloride channel protein CLC-d        67.8    8e-10   
ref|XP_002315783.2|  hypothetical protein POPTR_0010s10040g           67.4    9e-10   
gb|KDP40151.1|  hypothetical protein JCGZ_02149                       67.4    9e-10   
ref|XP_011021556.1|  PREDICTED: chloride channel protein CLC-d is...  67.4    1e-09   
ref|XP_009364220.1|  PREDICTED: chloride channel protein CLC-d-like   67.4    1e-09   
gb|KCW60808.1|  hypothetical protein EUGRSUZ_H03545                   65.5    1e-09   
ref|XP_002974894.1|  hypothetical protein SELMODRAFT_442632           67.0    1e-09   
gb|KCW60811.1|  hypothetical protein EUGRSUZ_H03545                   65.5    1e-09   
ref|XP_002980983.1|  hypothetical protein SELMODRAFT_420553           67.0    1e-09   
ref|XP_002988905.1|  hypothetical protein SELMODRAFT_427560           67.0    1e-09   
ref|XP_011071569.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    1e-09   
ref|XP_011071568.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    1e-09   
ref|XP_003539246.1|  PREDICTED: chloride channel protein CLC-d-li...  67.0    1e-09   
ref|XP_006359908.1|  PREDICTED: chloride channel protein CLC-d-li...  67.0    1e-09   
ref|XP_011071571.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    1e-09   
ref|XP_002982464.1|  hypothetical protein SELMODRAFT_233993           66.6    1e-09   
ref|XP_004511351.1|  PREDICTED: chloride channel protein CLC-d-li...  67.0    1e-09   
gb|KHN35186.1|  Chloride channel protein CLC-d                        67.0    1e-09   
ref|XP_009395588.1|  PREDICTED: chloride channel protein CLC-d is...  66.6    1e-09   
gb|AAO19370.1|  putative CLC-d chloride channel protein               66.6    1e-09   
ref|XP_009395587.1|  PREDICTED: chloride channel protein CLC-d is...  66.6    1e-09   
ref|XP_009395586.1|  PREDICTED: chloride channel protein CLC-d is...  66.6    2e-09   
ref|XP_006590397.1|  PREDICTED: chloride channel protein CLC-d-li...  66.6    2e-09   
ref|XP_004511350.1|  PREDICTED: chloride channel protein CLC-d-li...  66.6    2e-09   
ref|NP_001050977.1|  Os03g0695700                                     64.7    2e-09   
ref|XP_009618208.1|  PREDICTED: chloride channel protein CLC-d        66.6    2e-09   
ref|XP_004247370.1|  PREDICTED: chloride channel protein CLC-d        66.6    2e-09   
ref|XP_006590398.1|  PREDICTED: chloride channel protein CLC-d-li...  66.2    2e-09   
gb|AAC26247.2|  Arabidopsis thaliana CLC-d chloride channel prote...  66.2    2e-09   
gb|EEE59743.1|  hypothetical protein OsJ_12209                        66.2    2e-09   
emb|CAA96065.1|  CLC-d chloride channel protein                       66.2    2e-09   
gb|EEC75998.1|  hypothetical protein OsI_13133                        66.2    2e-09   
ref|XP_006290072.1|  hypothetical protein CARUB_v10003710mg           66.2    2e-09   
ref|XP_010454978.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    2e-09   
gb|KFK26402.1|  hypothetical protein AALP_AA8G244100                  66.2    2e-09   
ref|NP_197996.1|  chloride channel protein CLC-d                      66.2    2e-09   
ref|XP_001771383.1|  predicted protein                                66.2    2e-09   
ref|XP_006394868.1|  hypothetical protein EUTSA_v10003643mg           66.2    2e-09   
ref|XP_010421498.1|  PREDICTED: chloride channel protein CLC-d-li...  66.2    2e-09   
gb|KFK26403.1|  hypothetical protein AALP_AA8G244100                  66.2    2e-09   
ref|XP_002872208.1|  CLC-D                                            66.2    2e-09   
ref|XP_009151132.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    2e-09   
ref|XP_010493890.1|  PREDICTED: chloride channel protein CLC-d-like   66.2    2e-09   
ref|XP_010454977.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    2e-09   
ref|XP_008449563.1|  PREDICTED: chloride channel protein CLC-d        66.2    2e-09   
ref|XP_009151133.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    2e-09   
ref|XP_010421497.1|  PREDICTED: chloride channel protein CLC-d-li...  66.2    2e-09   
emb|CDY52633.1|  BnaC07g49590D                                        66.2    2e-09   
gb|KJB72282.1|  hypothetical protein B456_011G168600                  66.2    2e-09   
ref|XP_006394869.1|  hypothetical protein EUTSA_v10003643mg           66.2    2e-09   
ref|XP_006394870.1|  hypothetical protein EUTSA_v10003643mg           66.2    2e-09   
ref|XP_002517213.1|  chloride channel clc, putative                   66.2    3e-09   
ref|XP_006573887.1|  PREDICTED: chloride channel protein CLC-d-li...  65.9    3e-09   
ref|XP_006573886.1|  PREDICTED: chloride channel protein CLC-d-li...  65.9    3e-09   
dbj|BAJ33844.1|  unnamed protein product                              65.5    3e-09   
gb|KJB72284.1|  hypothetical protein B456_011G168600                  65.9    3e-09   
gb|KJB72279.1|  hypothetical protein B456_011G168600                  65.9    3e-09   
gb|KJB72281.1|  hypothetical protein B456_011G168600                  65.9    3e-09   
ref|XP_006359907.1|  PREDICTED: chloride channel protein CLC-d-li...  65.9    3e-09   
ref|XP_009366954.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  65.9    3e-09   



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   162 bits (410),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL
Sbjct  700  KDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  759

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRAHNIL+VFPHL KSK   KG+
Sbjct  760  TRQDLRAHNILSVFPHLEKSKSGKKGN  786


 Score = 49.3 bits (116),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+HERRRTEEWEVREKF+W+DLAER GKIEDV VT
Sbjct  660  LKKKWFLHERRRTEEWEVREKFTWIDLAERGGKIEDVLVT  699



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   162 bits (410),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL
Sbjct  700  KDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  759

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRAHNIL+VFPHL KSK   KG+
Sbjct  760  TRQDLRAHNILSVFPHLEKSKSGKKGN  786


 Score = 49.3 bits (116),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+HERRRTEEWEVREKF+W+DLAER GKIEDV VT
Sbjct  660  LKKKWFLHERRRTEEWEVREKFTWIDLAERGGKIEDVLVT  699



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   163 bits (412),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL
Sbjct  700  KDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  759

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRAHNIL+VFPHL KSK   KG+
Sbjct  760  TRQDLRAHNILSVFPHLEKSKSGKKGN  786


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F++ERRRTEEWEVREKF+W+DLAER GKIEDV VT
Sbjct  660  LKKKWFLNERRRTEEWEVREKFTWIDLAERGGKIEDVVVT  699



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   158 bits (400),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 75/87 (86%), Positives = 81/87 (93%), Gaps = 1/87 (1%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+S AKAMVLFRQVGLRHM+I+PKYQA+GVSPVVGIL
Sbjct  701  KDEMEMYVDLHPLTNTTPYTVLESMSAAKAMVLFRQVGLRHMIIIPKYQASGVSPVVGIL  760

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRAHNIL+ FPHLAKSKG  KGH
Sbjct  761  TRQDLRAHNILSAFPHLAKSKG-KKGH  786


 Score = 50.4 bits (119),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LK+K+F+ ERRRTEEWEVREKF+WVDLAERWGKI+DV VT
Sbjct  661  LKRKWFLQERRRTEEWEVREKFTWVDLAERWGKIDDVTVT  700



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   159 bits (402),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL
Sbjct  699  KSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  758

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDLRAHNIL+VFPHL KSK   K
Sbjct  759  TRQDLRAHNILSVFPHLVKSKSGKK  783


 Score = 47.8 bits (112),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 19/20 (95%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = -2

Query  505  KFSWVDLAERWGKIEDVAVT  446
            KFSW+DLAERWGKIEDVAVT
Sbjct  679  KFSWIDLAERWGKIEDVAVT  698



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   158 bits (400),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL
Sbjct  699  KSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  758

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDLRAHNIL VFPHL KSK   K
Sbjct  759  TRQDLRAHNILTVFPHLVKSKSGKK  783


 Score = 47.8 bits (112),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 19/20 (95%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = -2

Query  505  KFSWVDLAERWGKIEDVAVT  446
            KFSW+DLAERWGKIEDVAVT
Sbjct  679  KFSWIDLAERWGKIEDVAVT  698



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   158 bits (400),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNTTP+TV ES+SVAKAMVLFRQVGLRHMLI+PKYQAAGVSPVVG+LTR
Sbjct  704  EMEMYVDLHPFTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVSPVVGVLTR  763

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NILA FPHLAKSKG   GH
Sbjct  764  QDLRAYNILAAFPHLAKSKGMEGGH  788


 Score = 45.4 bits (106),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            +KKK+F+ ERRRTE+WEVRE+FSW+DLAER GKIE+VAVT
Sbjct  662  IKKKWFLQERRRTEDWEVRERFSWIDLAEREGKIEEVAVT  701



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   158 bits (399),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR
Sbjct  669  EMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  728

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL  FPHLAKSK   KG+
Sbjct  729  QDLRAYNILTAFPHLAKSKEREKGN  753


 Score = 45.4 bits (106),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRTEEWEVREKF+W++LAER GK E+VAVTN
Sbjct  627  LKKKWFLQERRRTEEWEVREKFTWIELAEREGKFEEVAVTN  667



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   158 bits (399),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR
Sbjct  705  EMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  764

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL  FPHLAKSK   KG+
Sbjct  765  QDLRAYNILTAFPHLAKSKEREKGN  789


 Score = 45.4 bits (106),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRTEEWEVREKF+W++LAER GK E+VAVTN
Sbjct  663  LKKKWFLQERRRTEEWEVREKFTWIELAEREGKFEEVAVTN  703



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   157 bits (398),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR
Sbjct  705  EMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  764

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL  FPHLAKSK   KG+
Sbjct  765  QDLRAYNILTAFPHLAKSKEREKGN  789


 Score = 45.4 bits (106),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRTEEWEVREKF+W++LAER GK E+VAVTN
Sbjct  663  LKKKWFLQERRRTEEWEVREKFTWIELAEREGKFEEVAVTN  703



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score =   148 bits (374),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPL NTTP TV ES+SVAKAMV FRQVGLRHM+IVPKYQAAGV PVVGIL
Sbjct  688  KDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAFRQVGLRHMIIVPKYQAAGVFPVVGIL  747

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRA NIL VFPHLAKSK   KG+
Sbjct  748  TRQDLRACNILNVFPHLAKSKSIKKGN  774


 Score = 53.1 bits (126),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F++ERRRTE+WEV EKF+W+DLAERWGKIED+AVT
Sbjct  648  LKKKWFLNERRRTEDWEVEEKFTWIDLAERWGKIEDIAVT  687



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score =   145 bits (367),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 72/87 (83%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPL NTTP TV ES+SVAKAMV FRQVGLRHM+IVPKYQAAGV PVVGIL
Sbjct  677  KDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAFRQVGLRHMIIVPKYQAAGVFPVVGIL  736

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRA NIL V PHLAKSK   KG+
Sbjct  737  TRQDLRACNILNVIPHLAKSKSIKKGN  763


 Score = 53.1 bits (126),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F++ERRRTE WEV EKF+W+DLAERWGKIED+AVT
Sbjct  637  LKKKWFLNERRRTENWEVEEKFTWIDLAERWGKIEDIAVT  676



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   160 bits (404),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 75/87 (86%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLI+PKYQAAGVSPVVGIL
Sbjct  701  KDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVSPVVGIL  760

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDL AHNIL+ FPHL +SKG+ KGH
Sbjct  761  TRQDLIAHNILSAFPHLERSKGNKKGH  787



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   150 bits (380),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEM+VDLHPLTNTTPFTV ES+SVAKAMVLFRQVGLRHML+VPKYQA+GVSPV+GIL
Sbjct  701  KEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLFRQVGLRHMLVVPKYQASGVSPVIGIL  760

Query  266  TRQDLRAHNILAVFPHLAKSK  204
            TRQDL A+NIL VFPHLAKSK
Sbjct  761  TRQDLLAYNILTVFPHLAKSK  781


 Score = 44.7 bits (104),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ ERRRTEEWEVREKF+WV+LAER G IEDVAVT
Sbjct  661  LKKKWFLKERRRTEEWEVREKFTWVELAEREGNIEDVAVT  700



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   157 bits (398),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 74/87 (85%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ESISVAKAMVLFRQ+ LRHMLI+PKYQAAGVSPVVGIL
Sbjct  702  KDEMEMYVDLHPLTNTTPYTVVESISVAKAMVLFRQLALRHMLILPKYQAAGVSPVVGIL  761

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDL AHNIL+ FPHL KSK + KGH
Sbjct  762  TRQDLIAHNILSAFPHLEKSKANKKGH  788



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   154 bits (390),  Expect(2) = 5e-41, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPL+NTTP+TV ES+SVAKAMVLFRQVGLRHMLI+PKYQAAGV PVVGIL
Sbjct  701  KDEMEMYVDLHPLSNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVYPVVGIL  760

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRAHNIL+  P L KS GS KGH
Sbjct  761  TRQDLRAHNILSALPQLKKSNGSKKGH  787


 Score = 40.0 bits (92),  Expect(2) = 5e-41, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRT+EWEVREKF+ +DLAER GKIE+V VT
Sbjct  661  LKKKWFLQEKRRTQEWEVREKFTSIDLAERGGKIEEVTVT  700



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   147 bits (371),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+L+VPKY+AAGVSPVVGILTR
Sbjct  700  EMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTR  759

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA NIL  FPHL +SK   K
Sbjct  760  QDLRAFNILTAFPHLERSKSGQK  782


 Score = 46.6 bits (109),  Expect(2) = 8e-41, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ E+RRTEEWEVREKFSWV+LAER GKIE+VAVT+
Sbjct  658  LKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTS  698



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   150 bits (380),  Expect(2) = 8e-41, Method: Composition-based stats.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEM+VDLHPLTNTTPFTV ES+SVAKAMVLFRQVGLRHML+VPKYQA+GVSPV+GIL
Sbjct  701  KEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLFRQVGLRHMLVVPKYQASGVSPVIGIL  760

Query  266  TRQDLRAHNILAVFPHLAKSK  204
            TRQDL A+NIL VFPHLAKSK
Sbjct  761  TRQDLLAYNILTVFPHLAKSK  781


 Score = 43.1 bits (100),  Expect(2) = 8e-41, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  562  KKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            KKK+F+ ERRRTEEWEVREKF+WV+LAER G IEDVAVT
Sbjct  662  KKKWFLKERRRTEEWEVREKFTWVELAEREGNIEDVAVT  700



>ref|XP_006447085.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 gb|ESR60325.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=605

 Score =   147 bits (370),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+L+VPKY+AAGVSPVVGILTR
Sbjct  522  EMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTR  581

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA NIL  FPHL +SK   K
Sbjct  582  QDLRAFNILTAFPHLERSKSGQK  604


 Score = 46.6 bits (109),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ E+RRTEEWEVREKFSWV+LAER GKIE+VAVT+
Sbjct  480  LKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTS  520



>gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   145 bits (365),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            + EMEM+VDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+LIVPKYQAAGV PVVGIL
Sbjct  702  RAEMEMFVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQAAGVPPVVGIL  761

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDL A+NIL  FPHLA++K   K
Sbjct  762  TRQDLMAYNILTAFPHLARTKSREK  786


 Score = 48.5 bits (114),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            +KKK+F+HE+RRTEEWE REKFSWVDLAER GKIE+V VT
Sbjct  662  IKKKWFLHEKRRTEEWEAREKFSWVDLAEREGKIEEVPVT  701



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   150 bits (378),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LFRQVGLRH+L+VPKYQA+GVSPV+GILTR
Sbjct  696  EMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVSPVIGILTR  755

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDL AHNIL VFPHLA SKG  K
Sbjct  756  QDLLAHNILTVFPHLAISKGREK  778


 Score = 43.1 bits (100),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRTEEWEVREKF+WV+LAER G IE+VAVT+
Sbjct  654  LKKKWFLKERRRTEEWEVREKFTWVELAEREGSIEEVAVTS  694



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   150 bits (378),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LFRQVGLRH+L+VPKYQA+GVSPV+GILTR
Sbjct  706  EMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVSPVIGILTR  765

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDL AHNIL VFPHLA SKG  K
Sbjct  766  QDLLAHNILTVFPHLAISKGREK  788


 Score = 43.1 bits (100),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRTEEWEVREKF+WV+LAER G IE+VAVT+
Sbjct  664  LKKKWFLKERRRTEEWEVREKFTWVELAEREGSIEEVAVTS  704



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   150 bits (379),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+LIVPKY+A+GV PVVGILTR
Sbjct  703  EMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYEASGVPPVVGILTR  762

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL+ FPHLA+SK   K H
Sbjct  763  QDLRAYNILSAFPHLARSKDREKRH  787


 Score = 42.4 bits (98),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            +KKK+F+ E+RRTEEWEVR+KF+WVDLAER  KIE+VAVT
Sbjct  661  IKKKWFLREKRRTEEWEVRQKFTWVDLAERELKIEEVAVT  700



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   149 bits (377),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LFRQVGLRH+L+VPKYQA+GVSPV+GILTR
Sbjct  689  EMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVSPVIGILTR  748

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDL AHNIL VFPHLA SKG  K
Sbjct  749  QDLLAHNILTVFPHLAISKGREK  771


 Score = 43.1 bits (100),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRTEEWEVREKF+WV+LAER G IE+VAVT+
Sbjct  647  LKKKWFLKERRRTEEWEVREKFTWVELAEREGSIEEVAVTS  687



>gb|KDO43317.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43318.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43319.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43320.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
Length=595

 Score =   145 bits (367),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+L+VPKY+AAGVSPVVGILTR
Sbjct  512  EMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTR  571

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA NIL  FPHL +SK   K
Sbjct  572  QDLRAFNILTAFPHLERSKSGQK  594


 Score = 46.6 bits (109),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ E+RRTEEWEVREKFSWV+LAER GKIE+VAVT+
Sbjct  470  LKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTS  510



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   151 bits (382),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 72/87 (83%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            + EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLI+PKYQAAGV PVVGIL
Sbjct  699  RNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVPPVVGIL  758

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRAHNIL  FPHL  SK   K H
Sbjct  759  TRQDLRAHNILLAFPHLQGSKSREKKH  785


 Score = 40.8 bits (94),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF WV+LAER G IE+VAVT
Sbjct  659  LKKKWFLPEKRRTEEWEVREKFDWVELAERDGTIEEVAVT  698



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   151 bits (382),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 72/87 (83%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            + EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLI+PKYQAAGV PVVGIL
Sbjct  699  RNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLILPKYQAAGVPPVVGIL  758

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKGH  186
            TRQDLRAHNIL  FPHL  SK   K H
Sbjct  759  TRQDLRAHNILLAFPHLQGSKNREKKH  785


 Score = 40.8 bits (94),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF WV+LAER G IE+VAVT
Sbjct  659  LKKKWFLPEKRRTEEWEVREKFDWVELAERDGTIEEVAVT  698



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   147 bits (372),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEM+VDLHPLTNTTPFTV ES+SVAKA+VLFRQVGLRHML+VPKYQA+GVSPV+GIL
Sbjct  700  KEEMEMFVDLHPLTNTTPFTVLESMSVAKALVLFRQVGLRHMLVVPKYQASGVSPVIGIL  759

Query  266  TRQDLRAHNILAVFPHLAKSK  204
            TRQDL A+NIL VFPHL KSK
Sbjct  760  TRQDLLAYNILTVFPHLTKSK  780


 Score = 44.7 bits (104),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTE+WEVREKF+WV+LAER G IEDVAVT
Sbjct  660  LKKKWFLKEKRRTEDWEVREKFTWVELAEREGNIEDVAVT  699



>ref|XP_007031847.1| Chloride channel B isoform 1 [Theobroma cacao]
 ref|XP_007031849.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02773.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02775.1| Chloride channel B isoform 1 [Theobroma cacao]
Length=606

 Score =   149 bits (377),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+LIVPKYQ AGV+PVVGILTR
Sbjct  522  EMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQGAGVTPVVGILTR  581

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA+NIL  FPHLA+ KG  K
Sbjct  582  QDLRAYNILTAFPHLARCKGEEK  604


 Score = 42.7 bits (99),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+FM E+RRTEEWEVREKF+WVDLAER  KIE VAVT
Sbjct  480  LKKKWFMPEKRRTEEWEVREKFNWVDLAERELKIEQVAVT  519



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   149 bits (376),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+LIVPKYQ AGV+PVVGILTR
Sbjct  703  EMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQGAGVTPVVGILTR  762

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA+NIL  FPHLA+ KG  K
Sbjct  763  QDLRAYNILTAFPHLARCKGEEK  785


 Score = 42.7 bits (99),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+FM E+RRTEEWEVREKF+WVDLAER  KIE VAVT
Sbjct  661  LKKKWFMPEKRRTEEWEVREKFNWVDLAERELKIEQVAVT  700



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score =   147 bits (372),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            + EMEM+VDLHPLTNTTPFTV ESISVAKAM+LFRQVGLRH+L+VPKYQA+GV PV+GIL
Sbjct  710  REEMEMFVDLHPLTNTTPFTVLESISVAKAMILFRQVGLRHLLVVPKYQASGVCPVIGIL  769

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDL A+NIL VFPHLAKSK   K
Sbjct  770  TRQDLLAYNILTVFPHLAKSKNRQK  794


 Score = 43.5 bits (101),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKK++F+ ERRRTEEWEVREKF+WV+LAER GKIE+VA+T
Sbjct  670  LKKRFFLKERRRTEEWEVREKFTWVELAEREGKIEEVAIT  709



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   153 bits (386),  Expect(2) = 8e-40, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MY+DLHPLTNTTP+TV ES+SVAKAMVLFR VGLRHMLIVPKY+AAGV P+VGILTR
Sbjct  704  EMDMYIDLHPLTNTTPYTVVESMSVAKAMVLFRAVGLRHMLIVPKYEAAGVPPIVGILTR  763

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRAHNIL+ FPHLA+SK   KGH
Sbjct  764  QDLRAHNILSAFPHLARSKSREKGH  788


 Score = 37.4 bits (85),  Expect(2) = 8e-40, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF+ VDLAER G IE+V VT
Sbjct  662  LKKKWFLSEKRRTEEWEVREKFTSVDLAEREGTIEEVVVT  701



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   148 bits (373),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTPFTV ES+SVAKAM LFRQVGLRH+L+VPKYQA+G+SPV+GILTR
Sbjct  690  EMEMFVDLHPLTNTTPFTVLESMSVAKAMTLFRQVGLRHLLVVPKYQASGISPVIGILTR  749

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDL A NIL VFPHLAKSKG  K
Sbjct  750  QDLLAQNILTVFPHLAKSKGREK  772


 Score = 42.4 bits (98),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            +KKK+F+ ERRRTEEWEVREKF+WV+LAER G IE+VAVT+
Sbjct  648  IKKKWFLKERRRTEEWEVREKFTWVELAEREGSIEEVAVTS  688



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   149 bits (375),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LFRQVGLRH+L+VPKYQA+GVSPV+GILTR
Sbjct  707  EMEMFVDLHPLTNTTPFTVLESMSVAKAMILFRQVGLRHLLVVPKYQASGVSPVIGILTR  766

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDL AHNI  VFPHLAKSK   K
Sbjct  767  QDLLAHNISTVFPHLAKSKSRGK  789


 Score = 41.2 bits (95),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F  ERRRTE+WEVR+KF+WV+LAER G IE VAVT+
Sbjct  665  LKKKWFFKERRRTEDWEVRQKFTWVELAEREGSIEGVAVTS  705



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   147 bits (370),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            + EMEM+VDLHPLTNTTPFTV ESISVAKAM+LF QVGLRH+L+VPKYQA+GV PV+GIL
Sbjct  706  REEMEMFVDLHPLTNTTPFTVLESISVAKAMILFHQVGLRHLLVVPKYQASGVCPVIGIL  765

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDL AHNIL VFPHLAKSK   K
Sbjct  766  TRQDLLAHNILTVFPHLAKSKRRQK  790


 Score = 42.4 bits (98),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ ERRRTEEWE REKF+WV+LAER G IE+VA+T
Sbjct  666  LKKKWFLKERRRTEEWEAREKFTWVELAEREGNIEEVAIT  705



>gb|KDO43321.1| hypothetical protein CISIN_1g0039662mg [Citrus sinensis]
Length=447

 Score =   147 bits (370),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+L+VPKY+AAGVSPVVGILTR
Sbjct  364  EMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQVGLRHLLVVPKYEAAGVSPVVGILTR  423

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA NIL  FPHL +SK   K
Sbjct  424  QDLRAFNILTAFPHLERSKSGQK  446


 Score = 40.8 bits (94),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ E+RRTEEWEVREKFSWV+LAER GKIE+VAVT+
Sbjct  322  LKKKWFLQEKRRTEEWEVREKFSWVELAEREGKIEEVAVTS  362



>gb|KEH25446.1| ClC chloride channel family protein [Medicago truncatula]
Length=722

 Score =   150 bits (378),  Expect(2) = 6e-39, Method: Composition-based stats.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  455  GSDKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVV  276
            G  K EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRHML+VPKYQA+GVSPV+
Sbjct  633  GVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVSPVI  692

Query  275  GILTRQDLRAHNILAVFPHLAKSKGSNKGH  186
            GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  693  GILTRQDLLAYNILPVFPHLENSKGREKSN  722


 Score = 37.4 bits (85),  Expect(2) = 6e-39, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDV  455
            LKKK+F+ E+RRTEEWEVREKFSWV+LAER   IEDV
Sbjct  595  LKKKWFLKEKRRTEEWEVREKFSWVELAEREENIEDV  631



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   149 bits (377),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  455  GSDKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVV  276
            G  K EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRHML+VPKYQA+GVSPV+
Sbjct  686  GVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVSPVI  745

Query  275  GILTRQDLRAHNILAVFPHLAKSKGSNKGH  186
            GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  746  GILTRQDLLAYNILPVFPHLENSKGREKSN  775


 Score = 37.4 bits (85),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDV  455
            LKKK+F+ E+RRTEEWEVREKFSWV+LAER   IEDV
Sbjct  648  LKKKWFLKEKRRTEEWEVREKFSWVELAEREENIEDV  684



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   149 bits (377),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  455  GSDKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVV  276
            G  K EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRHML+VPKYQA+GVSPV+
Sbjct  691  GVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVSPVI  750

Query  275  GILTRQDLRAHNILAVFPHLAKSKGSNKGH  186
            GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  751  GILTRQDLLAYNILPVFPHLENSKGREKSN  780


 Score = 37.4 bits (85),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDV  455
            LKKK+F+ E+RRTEEWEVREKFSWV+LAER   IEDV
Sbjct  653  LKKKWFLKEKRRTEEWEVREKFSWVELAEREENIEDV  689



>gb|KEH25445.1| ClC chloride channel family protein [Medicago truncatula]
Length=646

 Score =   149 bits (377),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  455  GSDKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVV  276
            G  K EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRHML+VPKYQA+GVSPV+
Sbjct  557  GVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRHMLVVPKYQASGVSPVI  616

Query  275  GILTRQDLRAHNILAVFPHLAKSKGSNKGH  186
            GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  617  GILTRQDLLAYNILPVFPHLENSKGREKSN  646



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   141 bits (355),  Expect(2) = 2e-38, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ+GLRH+LIVPKY+AAGV PVVGILTR
Sbjct  707  EMEMYVDLHPLTNTTPYTVMESMSVAKAMVLFRQLGLRHLLIVPKYEAAGVPPVVGILTR  766

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDL A+NIL  FPHL K     KG+
Sbjct  767  QDLIAYNILNAFPHLTKPTSREKGN  791


 Score = 44.3 bits (103),  Expect(2) = 2e-38, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F  E+RRTEEWEVREKF+WV+LAER GKIE+VAVT+
Sbjct  665  LKKKWFQREKRRTEEWEVREKFTWVELAEREGKIEEVAVTS  705



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   143 bits (361),  Expect(2) = 3e-38, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKA+VLFRQVGLRH+LIVPKY+AAGV PV+GIL
Sbjct  703  KEEMEMYVDLHPLTNTTPYTVLESMSVAKALVLFRQVGLRHLLIVPKYEAAGVPPVIGIL  762

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDLR +NIL+ FP LA+ KG+ K
Sbjct  763  TRQDLRPYNILSAFPDLARIKGNEK  787


 Score = 41.6 bits (96),  Expect(2) = 3e-38, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ ERRRTE+WEVREKF+WV+LAER GKIE++ VT
Sbjct  663  LKKKWFLRERRRTEDWEVREKFTWVELAEREGKIEELVVT  702



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   144 bits (364),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTTP+TV ES+SVAKA+VLFRQVGLRH+LIVPKY+AAGV PV+GIL
Sbjct  703  KEEMEMYVDLHPLTNTTPYTVMESMSVAKALVLFRQVGLRHLLIVPKYEAAGVPPVIGIL  762

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDLR +NIL+ FP LA++KG+ K
Sbjct  763  TRQDLRPYNILSAFPDLARTKGNEK  787


 Score = 40.4 bits (93),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ ERRRTEEWEVREKF+WV+LAER GKIE++ VT
Sbjct  663  LKKKWFLRERRRTEEWEVREKFTWVELAEREGKIEELVVT  702



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   140 bits (353),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ+GLRH+LIVPKY AAGV PVVGILTR
Sbjct  707  EMEMYVDLHPLTNTTPYTVMESMSVAKAMVLFRQLGLRHLLIVPKYVAAGVPPVVGILTR  766

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDL A+NIL  FPHL K+    KG+
Sbjct  767  QDLIAYNILNAFPHLTKATSREKGN  791


 Score = 44.3 bits (103),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F  E+RRTEEWEVREKF+WV+LAER GKIE+VAVT+
Sbjct  665  LKKKWFQREKRRTEEWEVREKFTWVELAEREGKIEEVAVTS  705



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   144 bits (364),  Expect(2) = 8e-38, Method: Composition-based stats.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQVGLRH+LIVPKYQ AGV+PVVGILTR
Sbjct  705  EMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQVGLRHLLIVPKYQGAGVTPVVGILTR  764

Query  260  QDLRAHNILAVFPHLAKSKGS  198
            QDLRA+NIL+ FPHL + K S
Sbjct  765  QDLRAYNILSAFPHLERPKLS  785


 Score = 39.3 bits (90),  Expect(2) = 8e-38, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF+WV+LAER  KIE VAVT
Sbjct  663  LKKKWFLPEKRRTEEWEVREKFNWVELAEREIKIEQVAVT  702



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   144 bits (363),  Expect(2) = 9e-38, Method: Composition-based stats.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQVGLRH+LIVPKYQ AGV+PVVGILTR
Sbjct  705  EMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQVGLRHLLIVPKYQGAGVAPVVGILTR  764

Query  260  QDLRAHNILAVFPHLAKSKGS  198
            QDLRA+NIL+ FPHL + K S
Sbjct  765  QDLRAYNILSAFPHLERPKLS  785


 Score = 39.3 bits (90),  Expect(2) = 9e-38, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF+WV+LAER  KIE VAVT
Sbjct  663  LKKKWFLPEKRRTEEWEVREKFNWVELAEREIKIEQVAVT  702



>gb|KHG13135.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=717

 Score =   143 bits (361),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQVGLRH+LIVPKYQ AGV+PVVGILTR
Sbjct  637  EMEMYVDLHPLTNTTPFTVVESMSVAKALVLFRQVGLRHLLIVPKYQGAGVAPVVGILTR  696

Query  260  QDLRAHNILAVFPHLAKSKGS  198
            QDLRA+NIL+ FPHL + K S
Sbjct  697  QDLRAYNILSAFPHLERPKLS  717


 Score = 39.3 bits (90),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF+WV+LAER  KIE VAVT
Sbjct  595  LKKKWFLPEKRRTEEWEVREKFNWVELAERELKIEQVAVT  634



>ref|XP_010556277.1| PREDICTED: chloride channel protein CLC-b [Tarenaya hassleriana]
Length=653

 Score =   143 bits (360),  Expect(2) = 8e-37, Method: Composition-based stats.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            +M+MYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+LIVPK QAAG+SPV+GILTR
Sbjct  570  DMQMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKIQAAGMSPVLGILTR  629

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRA+NIL  FPHL KSKG
Sbjct  630  QDLRAYNILQAFPHLEKSKG  649


 Score = 37.4 bits (85),  Expect(2) = 8e-37, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKK++F+ E+RRTE+WEVREKF+WV+LAER    E+VAVT+
Sbjct  528  LKKRWFLSEKRRTEDWEVREKFTWVELAEREDNFEEVAVTS  568



>gb|KHF97413.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=721

 Score =   144 bits (362),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQ AGV  VVGILTR
Sbjct  637  EMEMYIDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQGAGVPAVVGILTR  696

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA+NIL VFPHLA  K   K
Sbjct  697  QDLRAYNILTVFPHLATHKVQQK  719


 Score = 36.6 bits (83),  Expect(2) = 9e-37, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ E+RRT++WEV++KF+WV+L+ER  KIE VAV +
Sbjct  595  LKKKWFLAEKRRTDDWEVQKKFNWVELSERELKIEQVAVAH  635



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   141 bits (355),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHMLIVPKYQ AGV  VVGILTR
Sbjct  704  EMEMYMDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHMLIVPKYQGAGVPAVVGILTR  763

Query  260  QDLRAHNILAVFPHLAKSKGSNK  192
            QDLRA+NI  VFPHLA  K   K
Sbjct  764  QDLRAYNISTVFPHLATHKEQQK  786


 Score = 38.5 bits (88),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ E+RRTE+WEV+EKF+WV+L+ER  KIE VAVT+
Sbjct  662  LKKKWFLAEKRRTEDWEVQEKFNWVELSERELKIEQVAVTH  702



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV ES+SVAKA+VLFRQVGLR MLI+PKY+AAG+SPVVGILTR
Sbjct  698  EMEMYVDLHPLTNTTPYTVVESMSVAKAIVLFRQVGLRQMLIIPKYRAAGISPVVGILTR  757

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRA NIL+ F HLAKSKG
Sbjct  758  QDLRASNILSAFSHLAKSKG  777



>ref|XP_008341308.1| PREDICTED: chloride channel protein CLC-b [Malus domestica]
Length=283

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQVGLRH+L+VP Y+A+ V PVVGIL
Sbjct  197  KDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLVVPNYEASQVPPVVGIL  256

Query  266  TRQDLRAHNILAVFPHLAKSKGSNKG  189
            TRQDL A+NIL  FPHLAKS G  KG
Sbjct  257  TRQDLIAYNILNAFPHLAKSAGREKG  282



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   144 bits (362),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK QA G+SPVVGILTR
Sbjct  695  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQATGMSPVVGILTR  754

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRAHNIL  FPHL K+KG  K H
Sbjct  755  QDLRAHNILQAFPHLKKTKGG-KAH  778



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   144 bits (362),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHP TN TP+TV E +S AKAMVLFRQV LRH+LIVPKYQ AG+ PV+GIL
Sbjct  718  KREMEMYVDLHPFTNKTPYTVVEDMSAAKAMVLFRQVALRHLLIVPKYQGAGIYPVIGIL  777

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDLRAHNI  VFPH+AKSKG  K
Sbjct  778  TRQDLRAHNIQTVFPHIAKSKGREK  802



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   143 bits (361),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP TNTTP+TV ES+SVAKA+VLFRQVGLRH+L++PKYQ AG+SPVVGILTR
Sbjct  698  EMDMYVDLHPFTNTTPYTVVESMSVAKAVVLFRQVGLRHLLVIPKYQGAGISPVVGILTR  757

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRAHNIL  FPHLA  +G
Sbjct  758  QDLRAHNILGAFPHLANKRG  777



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK QA+G+ PVVGILTR
Sbjct  696  EMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQASGMCPVVGILTR  755

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRAHNIL  FPHL KSKG
Sbjct  756  QDLRAHNILQAFPHLEKSKG  775



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 1/85 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQ+GLRH+LIVPK QA+G+SPVVGILTR
Sbjct  695  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQLGLRHLLIVPKIQASGMSPVVGILTR  754

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL  FPHL KSKG  K H
Sbjct  755  QDLRAYNILQAFPHLEKSKG-RKAH  778



>ref|XP_010678326.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=655

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
             K+EMEMYVDLHP TN TP+TV E +SVAKAMVLFRQV LRHMLIVPKY  +G+ P+ GI
Sbjct  568  SKHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLFRQVALRHMLIVPKYHGSGIYPITGI  627

Query  269  LTRQDLRAHNILAVFPHLAKSKGSNK  192
            LTRQDLRAHNI  VFPHLA+SKG  K
Sbjct  628  LTRQDLRAHNIQNVFPHLARSKGREK  653



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K+EMEMYVDLHP TN TP+TV E +SVAKAMVLFRQV LRHMLIVPKY  +G+ P+ GIL
Sbjct  745  KHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLFRQVALRHMLIVPKYHGSGIYPITGIL  804

Query  266  TRQDLRAHNILAVFPHLAKSKGSNK  192
            TRQDLRAHNI  VFPHLA+SKG  K
Sbjct  805  TRQDLRAHNIQNVFPHLARSKGREK  829



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   139 bits (350),  Expect(2) = 3e-35, Method: Composition-based stats.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDL+PL NTTP++V ES+SVAKAMVLFR+VGLRHMLI+PKYQA+GV+PVVGILTR
Sbjct  699  EMEMFVDLYPLINTTPYSVIESMSVAKAMVLFREVGLRHMLILPKYQASGVAPVVGILTR  758

Query  260  QDLRAHNILAVFPHLAKSKGSNKG  189
            QDL AHNIL  FP L KS  S KG
Sbjct  759  QDLIAHNILCAFPQLEKSNASKKG  782


 Score = 35.8 bits (81),  Expect(2) = 3e-35, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRT+  EVRE F+  DLAER GKIEDV V++
Sbjct  657  LKKKWFLRERRRTKAEEVREIFTSADLAERGGKIEDVIVSD  697



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   140 bits (353),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQVGLRH+LIVPKY+A+GV P+VGILTR
Sbjct  706  EMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLIVPKYEASGVPPLVGILTR  765

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDL A+NIL  FPHL KS G  KG+
Sbjct  766  QDLIAYNILNAFPHLTKSAGREKGN  790


 Score = 34.7 bits (78),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF+ V+LAE   KIE+VAVT
Sbjct  664  LKKKWFLREKRRTEEWEVREKFTSVELAEXEAKIEEVAVT  703



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   140 bits (354),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK Q +G+SPVVGILTR
Sbjct  700  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQVSGMSPVVGILTR  759

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRA+NIL  FPHL KSKG
Sbjct  760  QDLRAYNILQAFPHLEKSKG  779



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   140 bits (354),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 66/79 (84%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+LIVPK QAAG+ PVVGILTR
Sbjct  698  EMQMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKIQAAGMCPVVGILTR  757

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  758  QDLRAYNILQAFPHLVKPK  776



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   138 bits (347),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP TV E++SVAKAMVLFRQVGLRH+LI+PKY+AAGV PVVGILTR
Sbjct  706  EMEMYVDLHPLTNTTPHTVLETMSVAKAMVLFRQVGLRHLLILPKYEAAGVPPVVGILTR  765

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDL A+NIL  FPHL   K   KG+
Sbjct  766  QDLIAYNILNAFPHLKNPKSREKGN  790


 Score = 35.8 bits (81),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKKK+F+ ERRRTEEWEVREKF+ V+LAER  KIE+VAVT+
Sbjct  664  LKKKWFLKERRRTEEWEVREKFTAVELAERELKIEEVAVTS  704



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   136 bits (342),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQVGLRH+L+VP Y+A+ + PVVGILTR
Sbjct  703  EMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLVVPNYEASRLPPVVGILTR  762

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDL A+NIL  FPHLAKS G  KG+
Sbjct  763  QDLIAYNILNAFPHLAKSAGREKGN  787


 Score = 37.7 bits (86),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAV  449
            LKKK+F+ E+RRTEEWEVREKF+ V+LAER GKIE+VAV
Sbjct  661  LKKKWFLREKRRTEEWEVREKFTSVELAEREGKIEEVAV  699



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   140 bits (353),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVP+ QA+G SPV+GILTR
Sbjct  700  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPRIQASGRSPVIGILTR  759

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL  FPHL KSKG  K H
Sbjct  760  QDLRAYNILQAFPHLEKSKG-RKAH  783



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVP+ QA+G SPV+GILTR
Sbjct  700  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPRIQASGRSPVIGILTR  759

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL  FPHL K+KG  K H
Sbjct  760  QDLRAYNILQAFPHLEKTKG-RKAH  783



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVP+ QA+G SPVVGILTR
Sbjct  700  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPRIQASGRSPVVGILTR  759

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA NIL  FPHL KSKG  K H
Sbjct  760  QDLRACNILQAFPHLEKSKG-RKAH  783



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   138 bits (348),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK Q +G+ PVVGILTR
Sbjct  660  EMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQTSGLCPVVGILTR  719

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRAHNIL  FP L KSKG
Sbjct  720  QDLRAHNILQAFPQLEKSKG  739



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK QA+G+ PVVGILTR
Sbjct  696  EMEMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQASGMCPVVGILTR  755

Query  260  QDLRAHNILAVFPHLAKSKGSNKGH  186
            QDLRA+NIL  FP L KSKG  K H
Sbjct  756  QDLRAYNILQAFPLLEKSKGG-KAH  779



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK Q +G+ PVVGILTR
Sbjct  696  EMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQTSGLCPVVGILTR  755

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRAHNIL  FP L KSKG
Sbjct  756  QDLRAHNILQAFPQLEKSKG  775



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK Q +G+ PVVGILTR
Sbjct  696  EMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQTSGLCPVVGILTR  755

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRAHNIL  FP L KSKG
Sbjct  756  QDLRAHNILQAFPQLEKSKG  775



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   138 bits (347),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK Q++G+ PVVGILTR
Sbjct  660  EMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQSSGLCPVVGILTR  719

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRAHNIL  FP + KSKG
Sbjct  720  QDLRAHNILQAFPQMEKSKG  739



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   137 bits (346),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK Q++G+ PVVGILTR
Sbjct  696  EMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQSSGLCPVVGILTR  755

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRAHNIL  FP + KSKG
Sbjct  756  QDLRAHNILQAFPQMEKSKG  775



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MY+DLHP TN TP+TV E++SVAKAMVLFRQV LRH+LIVPKYQ AG+SPVVGILTR
Sbjct  704  EMDMYIDLHPFTNATPYTVLETMSVAKAMVLFRQVALRHLLIVPKYQGAGISPVVGILTR  763

Query  260  QDLRAHNILAVFPHLAK  210
            QDLRAHNIL  FPHL K
Sbjct  764  QDLRAHNILGAFPHLEK  780



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   137 bits (346),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK QA+G+ PVVGILTR
Sbjct  697  EMEMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQASGMCPVVGILTR  756

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRA+NIL  FP L KSKG
Sbjct  757  QDLRAYNILQAFPLLEKSKG  776



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGL H+LIVPK Q +G+SPVVGILTR
Sbjct  700  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLWHLLIVPKIQVSGMSPVVGILTR  759

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRA+NIL  FPHL KSKG
Sbjct  760  QDLRAYNILQAFPHLEKSKG  779



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MY+DLHP TNTTP+TV E++SVAKA+VLFRQV LRH+LIVPKYQ AG+SP+VGILTR
Sbjct  710  EMDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRQVALRHLLIVPKYQGAGISPIVGILTR  769

Query  260  QDLRAHNILAVFPHLAKSKGS  198
            QDL AHNIL  FPHLAK + S
Sbjct  770  QDLIAHNILGAFPHLAKKEKS  790



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   137 bits (345),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MY+DLHP TNTTP+TV E++SVAKA+VLFRQV LRH+LI+PKYQ AG+SPVVGILTR
Sbjct  712  EMDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRQVALRHLLIIPKYQGAGISPVVGILTR  771

Query  260  QDLRAHNILAVFPHLAK  210
            QDLRAHNIL  FPHLA+
Sbjct  772  QDLRAHNILGAFPHLAE  788



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  455  GSDKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVV  276
            G    EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LIVPK QA+G+SPV+
Sbjct  682  GITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSPVI  741

Query  275  GILTRQDLRAHNILAVFPHLAKSK  204
            GILTRQDLRA+NIL  FPHL K K
Sbjct  742  GILTRQDLRAYNILQAFPHLDKHK  765



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  455  GSDKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVV  276
            G    EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LIVPK QA+G+SPV+
Sbjct  682  GITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSPVI  741

Query  275  GILTRQDLRAHNILAVFPHLAKSK  204
            GILTRQDLRA+NIL  FPHL K K
Sbjct  742  GILTRQDLRAYNILQAFPHLDKHK  765



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   135 bits (340),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LIVPK QA+G+SPV+GILTR
Sbjct  687  EMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSPVIGILTR  746

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  747  QDLRAYNILQAFPHLDKHK  765



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   135 bits (340),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  693  EMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  752

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  753  QDLRAYNILQAFPHLDKHK  771



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   135 bits (340),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  693  EMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  752

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  753  QDLRAYNILQAFPHLDKHK  771



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   135 bits (339),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  693  EMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  752

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  753  QDLRAYNILQAFPHLDKHK  771



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   135 bits (339),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LIVPK QA+G+SPV+GILTR
Sbjct  692  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSPVIGILTR  751

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  752  QDLRAYNILQAFPHLDKHK  770



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   135 bits (339),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LIVPK QA+G+SPV+GILTR
Sbjct  692  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSPVIGILTR  751

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  752  QDLRAYNILQAFPHLDKHK  770



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/79 (77%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+ YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LIVPK QA+G+SPV+GILTR
Sbjct  692  EMQFYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLIVPKIQASGMSPVIGILTR  751

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  752  QDLRAYNILQAFPHLDKHK  770



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  692  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  751

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  752  QDLRAYNILQAFPHLDKHK  770



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  692  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  751

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  752  QDLRAYNILQAFPHLDKHK  770



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MY+DLHP  NTTP+TV E++SVAKA+VLFRQV LRH+LIVPKYQ AG+ P+VGILTR
Sbjct  705  EMDMYIDLHPFANTTPYTVVETMSVAKAVVLFRQVALRHLLIVPKYQGAGIPPIVGILTR  764

Query  260  QDLRAHNILAVFPHLAK  210
            QDL+AHNIL  FPHLAK
Sbjct  765  QDLKAHNILGAFPHLAK  781



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   134 bits (336),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  694  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  753

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  754  QDLRAYNILQAFPHLDKHK  772



>ref|NP_001031990.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 gb|AED94613.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=643

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  560  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  619

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  620  QDLRAYNILQAFPHLDKHK  638



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  692  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  751

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  752  QDLRAYNILQAFPHLDKHK  770



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  690  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  749

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  750  QDLRAYNILQAFPHLDKHK  768



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  693  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  752

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  753  QDLRAYNILQAFPHLDKHK  771



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  693  EMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  752

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FPHL K K
Sbjct  753  QDLRAYNILQAFPHLDKHK  771



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   132 bits (332),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 3/80 (4%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQVGLRH+LIVPK Q   +SPVVGILTR
Sbjct  700  EMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQVGLRHLLIVPKIQ---MSPVVGILTR  756

Query  260  QDLRAHNILAVFPHLAKSKG  201
            QDLRA+NIL  FPHL KSKG
Sbjct  757  QDLRAYNILQAFPHLEKSKG  776


 Score = 33.1 bits (74),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKK++F+ E+RRTEEWEVREKF W +LAER    +DVA+T+
Sbjct  658  LKKRWFLTEKRRTEEWEVREKFPWDELAEREDNFDDVAITS  698



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  693  EMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  752

Query  260  QDLRAHNILAVFPHLAK  210
            QDLRA+NIL  FPHL K
Sbjct  753  QDLRAYNILQAFPHLDK  769



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PKYQ   +SP+VGILTR
Sbjct  437  ELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISPLVGILTR  496

Query  260  QDLRAHNILAVFPHLAK  210
            QDLRAHNIL  FPHLAK
Sbjct  497  QDLRAHNILGAFPHLAK  513



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMYVDLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PKYQ   +SP+VGILTR
Sbjct  456  ELEMYVDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISPLVGILTR  515

Query  260  QDLRAHNILAVFPHLAK  210
            QDLRAHNIL  FPHL+K
Sbjct  516  QDLRAHNILGAFPHLSK  532



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PKYQ   +SP+VGILTR
Sbjct  583  ELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISPLVGILTR  642

Query  260  QDLRAHNILAVFPHLAK  210
            QDLRAHNIL  FPHLAK
Sbjct  643  QDLRAHNILGAFPHLAK  659



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PKYQ   +SP+VGILTR
Sbjct  706  ELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISPIVGILTR  765

Query  260  QDLRAHNILAVFPHLA-KSK  204
            QDLRAHNIL  FPHLA KSK
Sbjct  766  QDLRAHNILGAFPHLANKSK  785



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   130 bits (326),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M+VDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+L+VPK QA+G+SPV+GILTR
Sbjct  693  EMQMWVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLVVPKIQASGMSPVIGILTR  752

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRA+NIL  FP L K K
Sbjct  753  QDLRAYNILQAFPRLDKHK  771


 Score = 32.0 bits (71),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVTN  443
            LKK++F++E+RRTEEWEVREKF+ V+LAER    +DVA+T+
Sbjct  651  LKKRWFLNEKRRTEEWEVREKFTPVELAEREDNFDDVAITS  691



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PKYQ   +SP+VGILTR
Sbjct  701  ELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISPIVGILTR  760

Query  260  QDLRAHNILAVFPHLA-KSK  204
            QDLRAHNIL  FPHLA KSK
Sbjct  761  QDLRAHNILGAFPHLANKSK  780



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PKYQ   +SP+VGILTR
Sbjct  706  ELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISPIVGILTR  765

Query  260  QDLRAHNILAVFPHLA-KSK  204
            QDLRAHNIL  FPHLA KSK
Sbjct  766  QDLRAHNILGAFPHLANKSK  785



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PKYQ   +SP+VGILTR
Sbjct  706  ELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKYQGPEISPIVGILTR  765

Query  260  QDLRAHNILAVFPHLA-KSK  204
            QDLRAHNIL  FPHLA KSK
Sbjct  766  QDLRAHNILGAFPHLANKSK  785



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score =   130 bits (326),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHMLI+PK+Q   +SP+VGILTR
Sbjct  703  EMAMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISPIVGILTR  762

Query  260  QDLRAHNILAVFPHLAKSKGSN  195
            QDLRAHNIL  FPHLA  + ++
Sbjct  763  QDLRAHNILGAFPHLANKRKTH  784



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score =   130 bits (326),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI+PK+Q   +SP+VGILTR
Sbjct  709  EMEMFVDLHPFTNTTPYTVVETMSVAKAVVLFRAVALRHMLIMPKFQGPEISPIVGILTR  768

Query  260  QDLRAHNILAVFPHLAKSKGSN  195
            QDLRAHNIL  FPHLA  + ++
Sbjct  769  QDLRAHNILGAFPHLANKRKAH  790



>ref|XP_008441632.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=205

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEMYVDLHPLTNTT +TV ES+SVAKA+VLFRQVG+RH+LIVPKY+AA V  V+GIL
Sbjct  28   KEEMEMYVDLHPLTNTTSYTVMESMSVAKALVLFRQVGIRHLLIVPKYEAARVLLVIGIL  87

Query  266  TRQDLRAHNILAVFPHLAKSKG  201
            T QDLR++NIL+  P L ++K 
Sbjct  88   TWQDLRSYNILSAIPDLERTKA  109



>gb|EEC69202.1| hypothetical protein OsI_38195 [Oryza sativa Indica Group]
Length=621

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHMLI+PK+Q   +SP+VGILTR
Sbjct  540  EMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISPIVGILTR  599

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDL AHNIL  FPHLA  +
Sbjct  600  QDLIAHNILGAFPHLASKR  618



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHMLI+PK+Q   +SP+VGILTR
Sbjct  635  EMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISPIVGILTR  694

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDL AHNIL  FPHLA  +
Sbjct  695  QDLIAHNILGAFPHLASKR  713



>gb|ABA98017.1| Chloride channel protein CLC-a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95101.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97716.1| unnamed protein product [Oryza sativa Japonica Group]
Length=625

 Score =   125 bits (313),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHMLI+PK+Q   +SP+VGILTR
Sbjct  544  EMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISPIVGILTR  603

Query  260  QDLRAHNILAVFPHLAKSKGSN  195
            QDL AHNIL  FPHLA  + ++
Sbjct  604  QDLIAHNILGAFPHLASKRKTH  625



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRHMLI+PK+Q   ++P+VGILTR
Sbjct  720  ELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQGPEIAPIVGILTR  779

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRAHNIL  FPHLA  +
Sbjct  780  QDLRAHNILGAFPHLANKR  798



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRHMLI+PK+Q   +SP++GILTR
Sbjct  713  ELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQGLEISPIMGILTR  772

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRAHNIL  FPHLA  +
Sbjct  773  QDLRAHNILGAFPHLANKR  791



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRHMLI+PK+Q   ++P+VGILTR
Sbjct  720  ELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHMLIIPKFQGPEIAPIVGILTR  779

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDLRAHNIL  FPHLA  +
Sbjct  780  QDLRAHNILGAFPHLANKR  798



>ref|NP_001066692.1| Os12g0438600 [Oryza sativa Japonica Group]
 dbj|BAF29711.1| Os12g0438600, partial [Oryza sativa Japonica Group]
Length=707

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHMLI+PK+Q   +SP+VGILTR
Sbjct  626  EMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISPIVGILTR  685

Query  260  QDLRAHNILAVFPHLAKSK  204
            QDL AHNIL  FPHLA  +
Sbjct  686  QDLIAHNILGAFPHLASKR  704



>ref|XP_006848425.1| hypothetical protein AMTR_s00013p00233550 [Amborella trichopoda]
 gb|ERN10006.1| hypothetical protein AMTR_s00013p00233550 [Amborella trichopoda]
Length=634

 Score =   115 bits (287),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -1

Query  431  MYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTRQDL  252
            MY+DLHP TN TP+TV ES+SVAKA+VLFRQVGLRHML++PK Q AG SPVVGILTRQDL
Sbjct  552  MYIDLHPFTNMTPYTVMESMSVAKAVVLFRQVGLRHMLVMPKSQVAGGSPVVGILTRQDL  611

Query  251  RAHNILAVFPHLAKSKGS  198
             A+NI + +PHL +   S
Sbjct  612  IANNIKSAYPHLLRRGKS  629



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   102 bits (254),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 5/76 (7%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILT-  264
            EMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQVGLRH+LIVPKYQ AGVS    +LT 
Sbjct  705  EMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQVGLRHLLIVPKYQGAGVS----LLTI  760

Query  263  RQDLRAHNILAVFPHL  216
               L  H   ++F HL
Sbjct  761  NTSLLFHAYSSIFVHL  776


 Score = 39.3 bits (90),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF+WV+LAER  KIE VAVT
Sbjct  663  LKKKWFLPEKRRTEEWEVREKFNWVELAEREIKIEQVAVT  702



>gb|AFB33948.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33949.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33950.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33951.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33952.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33953.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33954.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
Length=91

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFRQVGLRH+ +VPK  ++  SP+VGILTR
Sbjct  2    EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQVGLRHLCVVPK--SSDRSPIVGILTR  59

Query  260  QDLRAHNILAVFPHLAKSK  204
             D     +L + PHL +S 
Sbjct  60   HDFMPEYVLGLHPHLKQSN  78



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score = 96.7 bits (239),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAG  291
            EMEMY DLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRH+LIVPKYQ AG
Sbjct  701  EMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHLLIVPKYQGAG  750


 Score = 42.7 bits (99),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+FM E+RRTEEWEVREKF+WVDLAER  KIE VAVT
Sbjct  659  LKKKWFMPEKRRTEEWEVREKFNWVDLAERELKIEQVAVT  698



>ref|NP_001268085.1| uncharacterized protein LOC100259734 [Vitis vinifera]
 ref|XP_010653021.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653022.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653023.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653024.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653025.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653026.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653027.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 gb|ADK66981.1| chloride channel ClC3 [Vitis vinifera]
Length=780

 Score =   110 bits (274),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            ++ EMEMYVDLHP+TN +P+TV E++S+AKA +LFRQVGLRHM +VPK Q  G  P+VGI
Sbjct  701  EEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQVGLRHMCVVPKSQ--GRPPIVGI  758

Query  269  LTRQDLRAHNILAVFPHLAKSK  204
            LTR D    +IL ++PHL+  K
Sbjct  759  LTRHDFMPEHILGLYPHLSPHK  780



>emb|CBI27719.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            ++ EMEMYVDLHP+TN +P+TV E++S+AKA +LFRQVGLRHM +VPK Q  G  P+VGI
Sbjct  663  EEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQVGLRHMCVVPKSQ--GRPPIVGI  720

Query  269  LTRQDLRAHNILAVFPHLAKSK  204
            LTR D    +IL ++PHL+  K
Sbjct  721  LTRHDFMPEHILGLYPHLSPHK  742



>gb|AFB33961.1| hypothetical protein CL1659Contig1_02, partial [Pinus mugo]
 gb|AFB33962.1| hypothetical protein CL1659Contig1_02, partial [Pinus mugo]
 gb|AFB33963.1| hypothetical protein CL1659Contig1_02, partial [Pinus mugo]
Length=91

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFRQ+GLRH+ +VPK  ++  SP+VGILTR
Sbjct  2    EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SSDRSPIVGILTR  59

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P+L +S 
Sbjct  60   HDFMPEHVLGLHPYLKQSN  78



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP+TN +P+TV E++S+AKA VLFRQ+GLRHM +VPK Q  G SP+VG+LTR
Sbjct  707  EMEMYIDLHPITNASPYTVLETMSLAKAKVLFRQIGLRHMCVVPKSQ--GRSPIVGLLTR  764

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++PH+ + K
Sbjct  765  HDFMPEHILGLYPHMKQHK  783



>ref|XP_010099521.1| Chloride channel protein CLC-c [Morus notabilis]
 gb|EXB79401.1| Chloride channel protein CLC-c [Morus notabilis]
Length=176

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR +GLRHM +VPK Q  G  P+VGILTR
Sbjct  100  EMEMYVDLHPITNTSPYTVVETMSLAKAAILFRLLGLRHMCVVPKSQ--GRHPIVGILTR  157

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L ++PHL   K
Sbjct  158  HDFMPEHVLGLYPHLNPHK  176



>gb|AEW08796.1| hypothetical protein CL1659Contig1_02, partial [Pinus lambertiana]
 gb|AFB33955.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
Length=91

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFRQ+GLRH+ +VPK  ++  SP+VGILTR
Sbjct  2    EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SSERSPIVGILTR  59

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P+L ++ 
Sbjct  60   HDFMPEHVLGLHPYLKQNN  78



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV ES+S+AKA +LFRQ+GLRH+ ++PK   AG  P+VGILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLGLRHLCVIPK--TAGRPPIVGILTR  756

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  757  HDFMPEHVLGLYPHI  771



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV ES+S+AKA +LFRQ+GLRH+ ++PK   AG  P+VGILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLGLRHLCVIPK--TAGRPPIVGILTR  756

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  757  HDFMPEHVLGLYPHI  771



>gb|AFB33956.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33957.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33958.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33959.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33960.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
Length=91

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFRQ+GLRH+ +VPK  +   SP+VGILTR
Sbjct  2    EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SLERSPIVGILTR  59

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P+L ++ 
Sbjct  60   HDFMPEHVLGLHPYLKQNN  78



>gb|AEW08797.1| hypothetical protein CL1659Contig1_02, partial [Pinus radiata]
Length=91

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFRQ+GLRH+ +VPK  ++  SP+VGILTR
Sbjct  2    EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SSDRSPIVGILTR  59

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L +  +L +S 
Sbjct  60   HDFMPEHVLGLHSYLKQSN  78



>gb|AFG64985.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64986.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64987.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64988.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64989.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64990.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64991.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64992.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64993.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64994.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64995.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
Length=91

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFRQ+GLRH+ +VPK  ++  SP+VGILTR
Sbjct  2    EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SSDRSPIVGILTR  59

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L +  +L +S 
Sbjct  60   HDFMPEHVLGLHSYLKQSN  78



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK +  G  P+VGILTR
Sbjct  703  EMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK-KTTGRDPIVGILTR  761

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  762  HDFMPEHIKGLYPHLVHHK  780



>gb|KJB40519.1| hypothetical protein B456_007G067500 [Gossypium raimondii]
Length=767

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 61/75 (81%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV E++S+AKA VLFRQ+GLRHM +VPK Q  G  P+VGILTR
Sbjct  691  EMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHMCVVPKSQ--GRPPIVGILTR  748

Query  260  QDLRAHNILAVFPHL  216
             D    +IL ++PH+
Sbjct  749  HDFLPEHILGLYPHI  763



>gb|KHG07842.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=700

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 61/75 (81%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV E++S+AKA VLFRQ+GLRHM +VPK Q  G  P+VGILTR
Sbjct  624  EMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHMCVVPKSQ--GRPPIVGILTR  681

Query  260  QDLRAHNILAVFPHL  216
             D    +IL ++PH+
Sbjct  682  HDFLPEHILGLYPHI  696



>ref|XP_009392132.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=806

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP TNT+P+TV E++S+AKA+ LFRQVGLRH+LIVPK  ++  +PVVGILTR
Sbjct  706  EMEMYIDLHPFTNTSPYTVVETMSLAKALTLFRQVGLRHLLIVPK--SSCRAPVVGILTR  763

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  764  HDFMPEHILGLHPFLVKSR  782



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK +  G  P+VGILTR
Sbjct  705  EMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK-KTTGRDPIVGILTR  763

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  764  HDFMPEHIKGLYPHLVHHK  782



>gb|EMT27046.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=768

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  692  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRFPIVGILTR  749

Query  260  QDLRAHNILAVFPHLAKS  207
             DL   +I  +FP+L KS
Sbjct  750  HDLMPEHIHGLFPNLRKS  767



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EMYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  727  ELEMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  784

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +IL +FP+L+KS
Sbjct  785  HDFMPEHILGLFPNLSKS  802



>ref|XP_010025693.1| PREDICTED: chloride channel protein CLC-c-like [Eucalyptus grandis]
 gb|KCW62414.1| hypothetical protein EUGRSUZ_H05062 [Eucalyptus grandis]
Length=783

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            D  EM++Y+DLHP+TN +P+TV E++S+AKA +LFRQ+GLRHM +VPK Q  G  P+VGI
Sbjct  702  DDEEMDLYIDLHPVTNASPYTVVETMSLAKAAILFRQLGLRHMCVVPKSQ--GRPPIVGI  759

Query  269  LTRQDLRAHNILAVFPHLAKSK  204
            LTR D    +IL ++PH+   K
Sbjct  760  LTRHDFMPEHILGLYPHIKPHK  781



>ref|NP_001169702.1| uncharacterized protein LOC100383583 [Zea mays]
 gb|ACN34587.1| unknown [Zea mays]
Length=341

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VGLRH+L+VPK  A   SPVVGILTR
Sbjct  239  EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSPVVGILTR  296

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L +S+
Sbjct  297  HDFMPEHILELHPVLLRSR  315



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score = 96.7 bits (239),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVS  285
            EMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQVGLRH+LIVPKY+A+GVS
Sbjct  706  EMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVGLRHLLIVPKYEASGVS  757


 Score = 34.7 bits (78),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  565  LKKKYFMHerrrteewevrEKFSWVDLAERWGKIEDVAVT  446
            LKKK+F+ E+RRTEEWEVREKF+ V+LAE   KIE+VAVT
Sbjct  664  LKKKWFLREKRRTEEWEVREKFTSVELAEXEAKIEEVAVT  703



>gb|ADW93911.1| chloride channel 1 [Hordeum vulgare subsp. vulgare]
Length=799

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  723  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRFPIVGILTR  780

Query  260  QDLRAHNILAVFPHLAKS  207
             DL   +I  +FP+L KS
Sbjct  781  HDLMPEHIHGLFPNLRKS  798



>ref|XP_008368156.1| PREDICTED: chloride channel protein CLC-c-like [Malus domestica]
Length=778

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            ++ EM+MYVDLHP+TN +P+TV E++S+AKA +LFRQ+GLRH+ +VPK Q  G  P+VGI
Sbjct  698  EEEEMDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--GRPPIVGI  755

Query  269  LTRQDLRAHNILAVFPHLAKSK  204
            LTR D    +IL ++PH+   K
Sbjct  756  LTRHDFMPEHILGLYPHIKAHK  777



>ref|XP_008361634.1| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-c-like 
[Malus domestica]
Length=778

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            ++ EM+MYVDLHP+TN +P+TV E++S+AKA +LFRQ+GLRH+ +VPK Q  G  P+VGI
Sbjct  698  EEEEMDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--GRPPIVGI  755

Query  269  LTRQDLRAHNILAVFPHLAKSK  204
            LTR D    +IL ++PH+   K
Sbjct  756  LTRHDFMPEHILGLYPHIKAHK  777



>ref|XP_010905336.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905338.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905339.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
Length=779

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L+VPK  ++  +PVVGILTR
Sbjct  684  EMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SSSRAPVVGILTR  741

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  742  HDFMPEHILGLHPFLLKSR  760



>ref|XP_004486231.1| PREDICTED: chloride channel protein CLC-c-like [Cicer arietinum]
Length=766

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -1

Query  446  KYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGIL  267
            K EMEM+VDLHP+TNT+P+TV E++S+AKA +LFR+VGLRH+L+VPK    G  P+VGIL
Sbjct  689  KEEMEMFVDLHPITNTSPYTVVETMSLAKAALLFREVGLRHLLVVPK--TPGRPPIVGIL  746

Query  266  TRQDLRAHNILAVFPHL  216
            TR D     IL +FPHL
Sbjct  747  TRHDFMPEYILGLFPHL  763



>ref|XP_007048601.1| Chloride channel C [Theobroma cacao]
 gb|EOX92758.1| Chloride channel C [Theobroma cacao]
Length=771

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            ++ EM+MYVDLHP+TN +P+TV E++S+AKA VLFRQ+GLRHM +VPK Q  G  P+VGI
Sbjct  692  EQEEMDMYVDLHPITNASPYTVVETMSLAKAAVLFRQLGLRHMCVVPKSQ--GRPPIVGI  749

Query  269  LTRQDLRAHNILAVFPHL  216
            LTR D    ++L ++PH+
Sbjct  750  LTRHDFMPEHVLGLYPHI  767



>ref|XP_008786445.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=778

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV E++S+AKA VLFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  702  EMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHLCVVPK--TPGRPPIVGILTR  759

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL +FPH    K
Sbjct  760  HDFVPEHILGLFPHFNPHK  778



>ref|XP_002453459.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
 gb|EES06435.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
Length=793

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VGLRH+L+VPK  A   SPVVGILTR
Sbjct  691  EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSPVVGILTR  748

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  749  HDFMPEHILGLHPVLLKSR  767



>ref|XP_010905340.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Elaeis guineensis]
Length=645

 Score =   103 bits (256),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L+VPK  ++  +PVVGILTR
Sbjct  550  EMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SSSRAPVVGILTR  607

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  608  HDFMPEHILGLHPFLLKSR  626



>ref|XP_002865761.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42020.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  702  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  759

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  760  HDFMPEHVLGLYPHI  774



>ref|XP_006280044.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
 gb|EOA12942.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
Length=776

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  700  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  757

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  758  HDFMPEHVLGLYPHI  772



>ref|XP_009418228.1| PREDICTED: putative chloride channel-like protein CLC-g [Musa 
acuminata subsp. malaccensis]
Length=801

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP TN++P+TV E++S+AKA++LFR++GLRH+LIVPK  ++  +PVVGILTR
Sbjct  701  EMEMFVDLHPFTNSSPYTVVETMSLAKALILFREMGLRHLLIVPK--SSSRAPVVGILTR  758

Query  260  QDLRAHNILAVFPHLAKSK  204
             D  A +IL + P L KS+
Sbjct  759  HDFMAEHILGLHPFLRKSR  777



>ref|XP_008801913.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801914.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=778

 Score =   103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L+VPK  ++  +PVVGILTR
Sbjct  683  EMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SSSRAPVVGILTR  740

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  741  HDFMPEHILGLHPCLLKSR  759



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  719  EMEMYVDLHPVTNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  776

Query  260  QDLRAHNILAVFPHLAKS  207
             DL   +I  +FP+L KS
Sbjct  777  HDLMPEHIHGLFPNLRKS  794



>ref|NP_199800.1| chloride channel protein CLC-c [Arabidopsis thaliana]
 sp|Q96282.1|CLCC_ARATH RecName: Full=Chloride channel protein CLC-c; Short=AtCLC-c; 
AltName: Full=CBS domain-containing protein CBSCLC4 [Arabidopsis 
thaliana]
 emb|CAA70310.1| chloride channel [Arabidopsis thaliana]
 emb|CAA96059.1| CLC-c chloride channel protein [Arabidopsis thaliana]
 dbj|BAA97010.1| chloride channel [Arabidopsis thaliana]
 gb|AAM53312.1| chloride channel [Arabidopsis thaliana]
 gb|AAN65098.1| chloride channel [Arabidopsis thaliana]
 gb|AED95868.1| chloride channel protein CLC-c [Arabidopsis thaliana]
Length=779

 Score =   103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  703  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  760

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  761  HDFMPEHVLGLYPHI  775



>ref|XP_004248849.1| PREDICTED: chloride channel protein CLC-c-like [Solanum lycopersicum]
Length=778

 Score =   103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G +P+VGILTR
Sbjct  702  EMEMYIDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KTGRAPIVGILTR  759

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  760  HDFMHEHISNLYPHLVPHK  778



>ref|XP_010442463.1| PREDICTED: chloride channel protein CLC-c [Camelina sativa]
Length=777

 Score =   103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  701  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  758

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  759  HDFMPEHVLGLYPHI  773



>ref|XP_010441249.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=779

 Score =   103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  703  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  760

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  761  HDFMPEHVLGLYPHI  775



>emb|CDX91539.1| BnaC02g16210D [Brassica napus]
Length=775

 Score =   103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  756

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  757  HDFMPEHVLGLYPHI  771



>ref|XP_009411882.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            D  EMEMYVDLHP+ N +P+TV E++S+AKA VLFR++GLRH+ +VPK  + G SPV GI
Sbjct  700  DDAEMEMYVDLHPIVNRSPYTVKETMSLAKAAVLFRELGLRHLCVVPK--SPGGSPVAGI  757

Query  269  LTRQDLRAHNILAVFPHL  216
            LTR D    +IL  FPHL
Sbjct  758  LTRHDFMPEHILGRFPHL  775



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M+VDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  704  EMDMFVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TPGRPPIVGILTR  761

Query  260  QDLRAHNILAVFPHLAKSK  204
             D  + +IL +FPH+   K
Sbjct  762  HDFTSEHILGLFPHIHPHK  780



>ref|XP_009134029.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
Length=775

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  756

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  757  HDFMPEHVLGLYPHI  771



>ref|XP_009127371.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
 emb|CDY16376.1| BnaA02g11800D [Brassica napus]
Length=775

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  756

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  757  HDFMPEHVLGLYPHI  771



>emb|CDY21447.1| BnaC03g27500D [Brassica napus]
Length=775

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  756

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  757  HDFMPEHVLGLYPHI  771



>ref|XP_010482284.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=778

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  702  EMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  759

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  760  HDFMPEHVLGLYPHI  774



>ref|NP_001275140.1| chloride channel protein CLC-c-like [Solanum tuberosum]
 emb|CAA71369.1| chloride channel Stclc1 [Solanum tuberosum]
Length=764

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G +P+VGILTR
Sbjct  688  EMEMYIDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KTGRAPIVGILTR  745

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  746  HDFMHEHISNLYPHLVPHK  764



>ref|XP_006852872.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
 gb|ERN14339.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
Length=785

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP  NT+P+TV E++S+AKA++LFRQVGLRH+L+VPK    G +PVVGILTR
Sbjct  689  EMEMFVDLHPFANTSPYTVVETMSLAKALILFRQVGLRHLLVVPKTH--GRAPVVGILTR  746

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P+L  S+
Sbjct  747  HDFMPEHVLGLHPYLKGSQ  765



>ref|XP_006385193.1| Chloride channel protein CLC-c [Populus trichocarpa]
 gb|ERP62990.1| Chloride channel protein CLC-c [Populus trichocarpa]
Length=769

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  693  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TPGRPPIVGILTR  750

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++PH+   K
Sbjct  751  HDFTPDHILGLYPHIKPHK  769



>ref|XP_006836849.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
 gb|ERM99702.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
Length=772

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = -1

Query  452  SDKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVG  273
            SDK EMEMYVDLHP+TN++P+TV E++S+AKA +LFRQ+GLRH+ ++PK    G +P+VG
Sbjct  693  SDK-EMEMYVDLHPITNSSPYTVVETMSLAKAAMLFRQLGLRHLCVMPK--TPGGAPIVG  749

Query  272  ILTRQDLRAHNILAVFPHLAKSK  204
            ILTR D    +I+ ++PHL   K
Sbjct  750  ILTRHDFMPEHIIGLYPHLRPHK  772



>ref|XP_002527858.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF34561.1| chloride channel clc, putative [Ricinus communis]
Length=754

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV ES+S+AKA VLFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  678  EMDMYVDLHPITNTSPYTVVESMSLAKAAVLFRELGLRHLCVVPK--TPGRPPIVGILTR  735

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++PH+   K
Sbjct  736  HDFVPEHILGLYPHINPHK  754



>ref|XP_004287270.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Fragaria vesca subsp. vesca]
Length=752

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP TN +P+TV E++S+AKA++LFRQVGLRH+L++PK  +  +SP+VGILTR
Sbjct  661  EMEMYIDLHPFTNASPYTVVETMSLAKALILFRQVGLRHLLVIPKMSS--MSPIVGILTR  718

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  + P L  SK
Sbjct  719  HDFMPEHIFGIHPMLVSSK  737



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MY+DLHP+TNT+P+TV E++S+AKA VLFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  702  EMDMYLDLHPITNTSPYTVVETMSLAKAAVLFRQLGLRHLCVVPK--TPGRPPIVGILTR  759

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL +FPH    K
Sbjct  760  HDFVPEHILGLFPHFNPHK  778



>ref|XP_003580671.2| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Brachypodium distachyon]
Length=826

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  735  EMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVLPK--SSKRAPVVGILTR  792

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P+L KS+
Sbjct  793  HDFMPEHVLGLHPYLIKSR  811



>gb|AFW70592.1| hypothetical protein ZEAMMB73_317914 [Zea mays]
Length=648

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VGLRH+L+VPK  A   SPVVGILTR
Sbjct  546  EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSPVVGILTR  603

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L +S+
Sbjct  604  HDFMPEHILELHPVLLRSR  622



>ref|XP_009586705.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana tomentosiformis]
Length=732

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VGLRH+L++PK   +G  PVVGI+TR
Sbjct  641  EMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVGLRHLLVIPK--VSGRVPVVGIITR  698

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L++ P LAKSK
Sbjct  699  HDFMPEHVLSLHPSLAKSK  717



>ref|XP_011084086.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Sesamum indicum]
Length=651

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP TNT+P+TV E++S+AKA+ LFR+VGLRH+L++PK+  +G  PVVGILTR
Sbjct  548  EMDMYVDLHPFTNTSPYTVVETMSLAKALKLFREVGLRHLLVIPKF--SGRIPVVGILTR  605

Query  260  QDLRAHNILAVFPHLAK  210
             D    +IL + P LA+
Sbjct  606  HDFMPEDILNLHPRLAR  622



>ref|XP_008644088.1| PREDICTED: uncharacterized protein LOC100383583 isoform X1 [Zea 
mays]
Length=793

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VGLRH+L+VPK  A   SPVVGILTR
Sbjct  691  EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSPVVGILTR  748

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L +S+
Sbjct  749  HDFMPEHILELHPVLLRSR  767



>ref|XP_007152471.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
 gb|ESW24465.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
Length=807

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/84 (54%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            D+ +M+MYVDLHP+TN +P+TV E++ +AKA ++FRQ GLRHM +VPK Q  G  PVVGI
Sbjct  708  DEEDMDMYVDLHPITNASPYTVVETMPLAKAAIIFRQHGLRHMCVVPKSQ--GRPPVVGI  765

Query  269  LTRQDLRAHNILAVFPHLAKSKGS  198
            LTR D    ++L ++PH+   K S
Sbjct  766  LTRHDFMPEHVLGLYPHIKSQKQS  789



>ref|XP_004287269.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Fragaria vesca subsp. vesca]
Length=780

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP TN +P+TV E++S+AKA++LFRQVGLRH+L++PK  +  +SP+VGILTR
Sbjct  689  EMEMYIDLHPFTNASPYTVVETMSLAKALILFRQVGLRHLLVIPKMSS--MSPIVGILTR  746

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  + P L  SK
Sbjct  747  HDFMPEHIFGIHPMLVSSK  765



>ref|XP_010657885.1| PREDICTED: uncharacterized protein LOC100245380 isoform X1 [Vitis 
vinifera]
Length=777

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK  A    P+VGILTR
Sbjct  701  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPKTHAR--PPIVGILTR  758

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PH   SK
Sbjct  759  HDFMPGHIRGLYPHFNSSK  777



>gb|KDP42489.1| hypothetical protein JCGZ_00286 [Jatropha curcas]
Length=768

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK    G  PV GILTR
Sbjct  692  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TPGRPPVAGILTR  749

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++PH+   K
Sbjct  750  HDFMPEHILGLYPHINPHK  768



>ref|NP_001268053.1| uncharacterized protein LOC100245380 [Vitis vinifera]
 gb|ADK66979.1| chloride channel ClC1 [Vitis vinifera]
Length=771

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK  A    P+VGILTR
Sbjct  695  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPKTHAR--PPIVGILTR  752

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PH   SK
Sbjct  753  HDFMPGHIRGLYPHFNSSK  771



>ref|XP_010240516.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Brachypodium distachyon]
Length=662

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  571  EMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVLPK--SSKRAPVVGILTR  628

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P+L KS+
Sbjct  629  HDFMPEHVLGLHPYLIKSR  647



>ref|XP_004288642.1| PREDICTED: chloride channel protein CLC-c [Fragaria vesca subsp. 
vesca]
Length=782

 Score =   102 bits (253),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            ++ EMEMYVDLHP+TN +P+TV E++S+AKA +LFRQ+GLRH+ +VPK Q  G SP+VGI
Sbjct  702  EEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--GRSPIVGI  759

Query  269  LTRQDLRAHNILAVFPHL  216
            LTR D    +IL ++P++
Sbjct  760  LTRHDFMPEHILGLYPNI  777



>ref|XP_009777968.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana sylvestris]
Length=788

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VGLRH+L++PK   +G  PVVGI+TR
Sbjct  697  EMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVGLRHLLVIPK--VSGRVPVVGIITR  754

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L++ P LAKSK
Sbjct  755  HDFMPEHVLSLHPSLAKSK  773



>gb|EPS68170.1| hypothetical protein M569_06601 [Genlisea aurea]
Length=782

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP+TNT+P+TV E++S+AKA +LFR++GLRH+ +VPK   +G SP+VGILTR
Sbjct  706  EMEMFVDLHPITNTSPYTVVETMSLAKAALLFRELGLRHLCVVPK--TSGRSPIVGILTR  763

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L ++P L   K
Sbjct  764  HDFMPEHVLGLYPQLQHQK  782



>ref|XP_010050093.1| PREDICTED: putative chloride channel-like protein CLC-g [Eucalyptus 
grandis]
 gb|KCW82982.1| hypothetical protein EUGRSUZ_C04372 [Eucalyptus grandis]
Length=770

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM++DLHP TN +P+TV E++S+AKA++LFR+VGLRH+L++PK   +G SPVVGILTR
Sbjct  679  EMEMFLDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVIPK--ISGRSPVVGILTR  736

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++LA+ P L +S+
Sbjct  737  HDFMPEHVLALHPTLIRSR  755



>ref|XP_004979167.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Setaria italica]
Length=793

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VGLRH+L+VPK  A   SPVVGILTR
Sbjct  691  EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSPVVGILTR  748

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L  S+
Sbjct  749  HDFMPEHILGLHPVLLGSR  767



>ref|XP_009586704.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana tomentosiformis]
Length=788

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VGLRH+L++PK   +G  PVVGI+TR
Sbjct  697  EMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVGLRHLLVIPK--VSGRVPVVGIITR  754

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L++ P LAKSK
Sbjct  755  HDFMPEHVLSLHPSLAKSK  773



>ref|XP_006453099.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453100.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453101.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006474404.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474405.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X2 [Citrus sinensis]
 gb|ESR66339.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66340.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66341.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
Length=794

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP  N +P+TV E++S+AKA++LFR+VGLRH+L++PK      SPVVGILTR
Sbjct  703  EMEMYVDLHPFANASPYTVVETMSLAKALILFREVGLRHLLVIPKISNG--SPVVGILTR  760

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +ILA+ P LA+S+
Sbjct  761  HDFMPEHILALNPLLARSR  779



>ref|XP_008788814.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=790

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM++DLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L+VPK  ++  +PVVGILTR
Sbjct  690  EMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SSPRAPVVGILTR  747

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P+L +S+
Sbjct  748  HDFMPEHILGLHPYLMRSR  766



>ref|XP_009777969.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana sylvestris]
Length=776

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VGLRH+L++PK   +G  PVVGI+TR
Sbjct  685  EMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVGLRHLLVIPK--VSGRVPVVGIITR  742

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L++ P LAKSK
Sbjct  743  HDFMPEHVLSLHPSLAKSK  761



>ref|XP_009768532.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
Length=775

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G +P+ GILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KTGRAPIAGILTR  756

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  757  HDFMHEHISNLYPHLVPHK  775



>gb|AAQ56538.1| putative chloride channel [Oryza sativa Japonica Group]
 gb|AAQ56565.1| putative chloride channel protein [Oryza sativa Japonica Group]
 dbj|BAC92420.1| putative chloride channel protein [Oryza sativa Japonica Group]
 gb|EAZ06475.1| hypothetical protein OsI_28712 [Oryza sativa Indica Group]
 gb|EAZ42255.1| hypothetical protein OsJ_26819 [Oryza sativa Japonica Group]
 dbj|BAG89940.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39689.1| putative chloride channel [Oryza sativa Indica Group]
Length=796

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VGLRH+L+VPK  +   SPVVGILTR
Sbjct  693  EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--SCDRSPVVGILTR  750

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L  S+
Sbjct  751  HDFMPEHILGLHPVLVGSR  769



>ref|XP_009599120.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=775

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+GLRH+ +VPK    G +P+ GILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK--KTGRAPIAGILTR  756

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  757  HDFMHEHISNLYPHLVPHK  775



>ref|XP_006359489.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Solanum tuberosum]
Length=767

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP  NT+PFTV E++S+AKA++LFR+VGLRH+L++PK   +G  PVVGI+TR
Sbjct  676  EMDMFIDLHPFCNTSPFTVVETMSLAKALMLFREVGLRHLLVIPK--VSGRIPVVGIITR  733

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L++ P LAKSK
Sbjct  734  HDFMPEHVLSLHPSLAKSK  752



>ref|XP_011003711.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=768

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  692  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TPGRPPIVGILTR  749

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++P++   K
Sbjct  750  HDFTPDHILGLYPYIKTHK  768



>ref|XP_010099780.1| Chloride channel protein CLC-c [Morus notabilis]
 gb|EXB80398.1| Chloride channel protein CLC-c [Morus notabilis]
Length=763

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TN +P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  685  EMEMYVDLHPITNASPYTVVETMSLAKAAVLFRDLGLRHLLVVPK--TPGRPPIVGILTR  742

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  743  HDFMPEHVLGLYPHI  757



>emb|CDX83179.1| BnaA03g23270D [Brassica napus]
Length=775

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AK  +LFRQ+GLRH+ +VPK    G  P+VGILTR
Sbjct  699  EMEMYVDLHPITNTSPYTVLETLSLAKVAILFRQLGLRHLCVVPK--TPGRPPIVGILTR  756

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  757  HDFMPEHVLGLYPHI  771



>gb|EMT23162.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=1241

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK   +  +PVVGILTR
Sbjct  724  ELEMFVDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVLPK--TSKRAPVVGILTR  781

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P+L KS+
Sbjct  782  HDFMPEHVLGLHPYLFKSR  800



>ref|XP_011047852.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=768

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  692  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPK--TPGRPPIVGILTR  749

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++P++   K
Sbjct  750  HDFTPDHILGLYPYIKTHK  768



>ref|XP_011087632.1| PREDICTED: chloride channel protein CLC-c [Sesamum indicum]
Length=789

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+ V E++S+AKA VLFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  710  EMEMYVDLHPITNTSPYMVVETMSLAKAAVLFRELGLRHLCVVPK--TPGRPPIVGILTR  767

Query  260  QDLRAHNILAVFPHLAKSKG  201
             D    +IL ++P   + KG
Sbjct  768  HDFMPEHILGLYPEFIRHKG  787



>ref|XP_004242745.2| PREDICTED: putative chloride channel-like protein CLC-g [Solanum 
lycopersicum]
Length=788

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP  NT+PFTV E++S+AKA++LFR+VGLRH+L++PK   +G  PVVGI+TR
Sbjct  697  EMDMFIDLHPFCNTSPFTVVETMSLAKALMLFREVGLRHLLVIPK--VSGRIPVVGIITR  754

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L++ P LAKSK
Sbjct  755  HDFMPEHVLSLHPSLAKSK  773



>ref|XP_009401374.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=742

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  647  EMDMYVDLHPYTNTSPYTVVETMSLAKALILFREVGLRHLLVIPK--SSSRAPVVGILTR  704

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL   P L +S+
Sbjct  705  HDFMPEHILGTHPFLLQSR  723



>ref|XP_004975698.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Setaria 
italica]
Length=875

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  799  EMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  856

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +I  +FP+L KS
Sbjct  857  HDFMPEHIHGLFPNLHKS  874



>ref|XP_004975700.1| PREDICTED: chloride channel protein CLC-c-like isoform X3 [Setaria 
italica]
Length=844

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  768  EMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  825

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +I  +FP+L KS
Sbjct  826  HDFMPEHIHGLFPNLHKS  843



>emb|CBI29647.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK  A    P+VGILTR
Sbjct  666  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPKTHAR--PPIVGILTR  723

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PH   SK
Sbjct  724  HDFMPGHIRGLYPHFNSSK  742



>ref|XP_010657886.1| PREDICTED: uncharacterized protein LOC100245380 isoform X2 [Vitis 
vinifera]
Length=630

 Score =   100 bits (248),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++GLRH+ +VPK  A    P+VGILTR
Sbjct  554  EMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELGLRHLCVVPKTHAR--PPIVGILTR  611

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PH   SK
Sbjct  612  HDFMPGHIRGLYPHFNSSK  630



>ref|XP_006381102.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP58899.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   100 bits (249),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM++DLHP TN +P+TV+E++S+AKA++LFR+VGLRH+L++PK   +G SPVVGILTR
Sbjct  684  EMEMFLDLHPFTNASPYTVAETMSLAKALILFREVGLRHLLVIPK--ISGRSPVVGILTR  741

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L +S+
Sbjct  742  HDFMPGHILGLHPMLIRSR  760



>tpg|DAA35719.1| TPA: hypothetical protein ZEAMMB73_781870, partial [Zea mays]
Length=827

 Score =   100 bits (249),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  721  ELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPK--SSKRAPVVGILTR  778

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  779  HDFMPEHILGLHPFLFKSR  797



>tpg|DAA35720.1| TPA: chloride channel G, partial [Zea mays]
Length=823

 Score =   100 bits (249),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  717  ELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPK--SSKRAPVVGILTR  774

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  775  HDFMPEHILGLHPFLFKSR  793



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score =   100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP TN +P+TV E++S+ KA+ LFR++GLRH+L+VPK+  +G SPVVGILTR
Sbjct  683  EMDMFIDLHPFTNASPYTVVETMSLGKALTLFRELGLRHLLVVPKF--SGRSPVVGILTR  740

Query  260  QDLRAHNILAVFPHLAKSKGSN  195
             D  + +IL + P L ++ G +
Sbjct  741  HDFMSEHILGLHPFLVRNTGKS  762



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score =   100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP TN +P+TV E++S+ KA+ LFR++GLRH+L+VPK+  +G SPVVGILTR
Sbjct  683  EMDMFIDLHPFTNASPYTVVETMSLGKALTLFRELGLRHLLVVPKF--SGRSPVVGILTR  740

Query  260  QDLRAHNILAVFPHLAKSKGSN  195
             D  + +IL + P L ++ G +
Sbjct  741  HDFMSEHILGLHPFLVRNTGKS  762



>ref|XP_010928311.1| PREDICTED: putative chloride channel-like protein CLC-g [Elaeis 
guineensis]
Length=790

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM++DLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L+VPK  ++  +PVVGILTR
Sbjct  690  EMEMFLDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPK--SSPRAPVVGILTR  747

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P+L +S+
Sbjct  748  HDFMPEHILGLHPYLMRSR  766



>ref|XP_002447895.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
 gb|EES12223.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
Length=798

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  722  EMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  779

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +I  +FP++ KS
Sbjct  780  HDFMPEHIHGLFPNIHKS  797



>ref|XP_011084085.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Sesamum indicum]
Length=787

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP TNT+P+TV E++S+AKA+ LFR+VGLRH+L++PK+  +G  PVVGILTR
Sbjct  684  EMDMYVDLHPFTNTSPYTVVETMSLAKALKLFREVGLRHLLVIPKF--SGRIPVVGILTR  741

Query  260  QDLRAHNILAVFPHLAK  210
             D    +IL + P LA+
Sbjct  742  HDFMPEDILNLHPRLAR  758



>ref|XP_006652911.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Oryza brachyantha]
Length=808

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP TNT+P+TV E++S+AKA VLFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  717  EMEMFVDLHPFTNTSPYTVVETMSLAKAHVLFREVGLRHLLVLPK--SSKRAPVVGILTR  774

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L K++
Sbjct  775  HDFMPEHILGLHPFLFKTR  793



>ref|XP_009401373.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=786

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  691  EMDMYVDLHPYTNTSPYTVVETMSLAKALILFREVGLRHLLVIPK--SSSRAPVVGILTR  748

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL   P L +S+
Sbjct  749  HDFMPEHILGTHPFLLQSR  767



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR++GLRH+L+VPK    G  P+VGILTR
Sbjct  685  EMEMYVDLHPITNTSPYTVVETMSLAKAALLFRELGLRHLLVVPK--KPGRPPIVGILTR  742

Query  260  QDLRAHNILAVFPHLAKSK  204
             D     IL +FP+L   K
Sbjct  743  HDFMHDYILGLFPNLNPHK  761



>ref|XP_009393492.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393493.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
Length=780

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -1

Query  449  DKYEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGI  270
            ++ EMEMYVDLHP+TN +P+TV+E++S+AKA +LFR++GLRH+ +VPK    G  P+VGI
Sbjct  701  NEEEMEMYVDLHPITNRSPYTVAETMSLAKAAILFRELGLRHLCVVPK--TPGRPPIVGI  758

Query  269  LTRQDLRAHNILAVFPHL  216
            LTR D  + +IL +FP +
Sbjct  759  LTRHDFMSEHILGLFPRI  776



>ref|XP_004230422.1| PREDICTED: chloride channel protein CLC-c [Solanum lycopersicum]
Length=776

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR++GLRH+ +VPK      +P+VGILTR
Sbjct  700  EMEMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLCVVPK--TTKRNPIVGILTR  757

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  758  HDFMPEHIKGLYPHLVHHK  776



>gb|KDO73468.1| hypothetical protein CISIN_1g003801mg [Citrus sinensis]
Length=794

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP  N +P+TV E++S+AKA++LFR+VGLRH+L++PK      SPV+GILTR
Sbjct  703  EMEMYVDLHPFANASPYTVVETMSLAKALILFREVGLRHLLVIPKISNG--SPVMGILTR  760

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +ILA+ P LA+S+
Sbjct  761  HDFMPEHILALNPLLARSR  779



>gb|EYU35026.1| hypothetical protein MIMGU_mgv1a001577mg [Erythranthe guttata]
Length=791

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+ V++++S+AKA VLFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  715  EMEMYVDLHPVTNTSPYMVADTMSLAKAAVLFRELGLRHLCVVPK--TPGRPPIVGILTR  772

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L ++P +A  K
Sbjct  773  HDFMPEHVLGLYPQIAHQK  791



>gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58338.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58339.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
Length=795

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM++YVDLHP+TNT+P+TV E++S+AKA VLFR +GLRHML+VPK    G  P+VGILTR
Sbjct  719  EMDLYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHMLVVPK--TPGRPPIVGILTR  776

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +I  +FP++ KS
Sbjct  777  HDFIPEHIHGLFPNIHKS  794



>ref|XP_007214607.1| hypothetical protein PRUPE_ppa001700mg [Prunus persica]
 gb|EMJ15806.1| hypothetical protein PRUPE_ppa001700mg [Prunus persica]
Length=777

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = -1

Query  437  MEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTRQ  258
            M+MYVDLHP+TN +P+TV E++S+AKA +LFRQ+GLRH+ +VPK Q  G  P+VGILTR 
Sbjct  703  MDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--GRPPIVGILTRH  760

Query  257  DLRAHNILAVFPHL  216
            D    +IL ++PH+
Sbjct  761  DFMPEHILGLYPHI  774



>ref|XP_008667038.1| PREDICTED: chloride channel G isoform X1 [Zea mays]
Length=812

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  721  ELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPK--SSKRAPVVGILTR  778

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  779  HDFMPEHILGLHPFLFKSR  797



>ref|XP_003609433.1| hypothetical protein MTR_4g115640 [Medicago truncatula]
 gb|AES91630.1| ClC chloride channel family protein [Medicago truncatula]
Length=776

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM M+VDLHP TN +P+TV E++S+AKA++LFR+VGLRH+L++PK    G SPVVGILTR
Sbjct  682  EMGMFVDLHPFTNASPYTVVETMSLAKALILFREVGLRHLLVIPK--IPGRSPVVGILTR  739

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  740  HDFTPEHILGMHPFLVKSR  758



>ref|XP_006349289.1| PREDICTED: chloride channel protein CLC-c-like [Solanum tuberosum]
Length=776

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR++GLRH+ +VPK      +P+VGILTR
Sbjct  700  EMEMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLCVVPK--TTKRNPIVGILTR  757

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I  ++PHL   K
Sbjct  758  HDFMPEHIKGLYPHLVHHK  776



>tpg|DAA35721.1| TPA: hypothetical protein ZEAMMB73_781870 [Zea mays]
Length=810

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  719  ELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPK--SSKRAPVVGILTR  776

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  777  HDFMPEHILGLHPFLFKSR  795



>ref|XP_009403198.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=831

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 13/97 (13%)
 Frame = -1

Query  461  RCGSDKYE-----------MEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLI  315
            +CGS K+E           M+MY+DLHP TNT+P+TV E++S+AKA +LFR+VGLRH+LI
Sbjct  714  KCGSGKHENVEGIELTAEEMDMYIDLHPFTNTSPYTVVETMSLAKAGILFREVGLRHLLI  773

Query  314  VPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  204
            VPK  ++  +PVVGILTR D     IL + P L +S+
Sbjct  774  VPK--SSSTTPVVGILTRHDFMPELILGLHPVLLQSR  808



>gb|KJB46914.1| hypothetical protein B456_008G001200 [Gossypium raimondii]
Length=761

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E +MYVDLHP+ NT+P+TV E++S+AKA VLFR++GLRHM +VPK Q  G  P+VGILTR
Sbjct  685  EWDMYVDLHPIANTSPYTVVETMSLAKAAVLFRELGLRHMCVVPKSQ--GRPPIVGILTR  742

Query  260  QDLRAHNILAVFPHL  216
             D +  +IL ++PH+
Sbjct  743  HDFQPEHILGLYPHI  757



>dbj|BAB97267.1| chloride channel [Oryza sativa Japonica Group]
Length=801

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E++MYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  725  ELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  782

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +I  +FP+L KS
Sbjct  783  HDFMHEHIHGLFPNLGKS  800



>ref|XP_008227672.1| PREDICTED: chloride channel protein CLC-c-like [Prunus mume]
 ref|XP_008227673.1| PREDICTED: chloride channel protein CLC-c-like [Prunus mume]
 ref|XP_008227674.1| PREDICTED: chloride channel protein CLC-c-like [Prunus mume]
Length=777

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = -1

Query  437  MEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTRQ  258
            M+MYVDLHP+TN +P+TV E++S+AKA +LFRQ+GLRH+ +VPK Q  G  P+VGILTR 
Sbjct  703  MDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--GRPPIVGILTRH  760

Query  257  DLRAHNILAVFPHL  216
            D    +IL ++PH+
Sbjct  761  DFMPEHILGLYPHI  774



>gb|KHG08138.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=708

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E +MYVDLHP+ NT+P+TV E++S+AKA VLFR++GLRHM +VPK Q  G  P+VGILTR
Sbjct  632  EWDMYVDLHPIANTSPYTVVETMSLAKAAVLFRELGLRHMCVVPKSQ--GRPPIVGILTR  689

Query  260  QDLRAHNILAVFPHL  216
             D +  +IL ++PH+
Sbjct  690  HDFQPEHILGLYPHV  704



>ref|XP_002447212.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
 gb|EES11540.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
Length=814

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  723  ELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPK--SSKRAPVVGILTR  780

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L KS+
Sbjct  781  HDFMPEHILGLHPFLFKSR  799



>ref|XP_011016274.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP+TNT+P+TV ES+S+AKA VLFR++GLRH+ +V K    G  P+VGILTR
Sbjct  690  EMEMYIDLHPITNTSPYTVVESMSLAKAAVLFRELGLRHLCVVSK--TPGRPPIVGILTR  747

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L ++PH+   K
Sbjct  748  HDFTPEHVLGLYPHIKPHK  766



>ref|XP_003573678.1| PREDICTED: putative chloride channel-like protein CLC-g [Brachypodium 
distachyon]
Length=806

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VGLRH+L+VPK  A   SPVVGILTR
Sbjct  704  EMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSPVVGILTR  761

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L   +
Sbjct  762  HDFMPEHILGLHPVLLGGR  780



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EME+YVDLHP+TN +P+TV E++S+AKA +LFR++GLRH+ +VPK    G  P+VGILTR
Sbjct  697  EMELYVDLHPITNASPYTVVETMSLAKAALLFRELGLRHLCVVPK--TPGRPPIVGILTR  754

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++P+L   K
Sbjct  755  HDFTPEHILGIYPNLKAQK  773



>ref|XP_008379004.1| PREDICTED: chloride channel protein CLC-c [Malus domestica]
Length=597

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMY+DLHP+TNT+P+TV E++S+AKA + FR +GLRH+L+VPK    G  P+VGILTR
Sbjct  521  EMEMYLDLHPITNTSPYTVVETMSLAKAAIFFRALGLRHLLVVPK--TPGRPPIVGILTR  578

Query  260  QDLRAHNILAVFPHL  216
             D    +IL +FP L
Sbjct  579  HDFMPEHILELFPQL  593



>gb|KDO42564.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=789

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP+TNT+P+TV E++S+AKA VLFRQ+ LRH+ +VPK    G  P+VGILTR
Sbjct  712  EMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TPGRPPIVGILTR  769

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  770  HDFMPEHVLGLYPHI  784



>ref|XP_006431490.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44730.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=789

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM+VDLHP+TNT+P+TV E++S+AKA VLFRQ+ LRH+ +VPK    G  P+VGILTR
Sbjct  712  EMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLALRHLCVVPK--TPGRPPIVGILTR  769

Query  260  QDLRAHNILAVFPHL  216
             D    ++L ++PH+
Sbjct  770  HDFMPEHVLGLYPHI  784



>gb|EAY94258.1| hypothetical protein OsI_16029 [Oryza sativa Indica Group]
Length=803

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E++MYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  727  ELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  784

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +I  +FP+L KS
Sbjct  785  HDFMHEHIHGLFPNLGKS  802



>ref|XP_004952777.1| PREDICTED: chloride channel protein CLC-c-like [Setaria italica]
Length=950

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+MYVDLHP+TNT+P+TV E++S+AKA +LFR++GLRH+L+VPK  A    P+VGILTR
Sbjct  866  EMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELGLRHLLVVPK--APDRPPIVGILTR  923

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +I ++FP+L   K
Sbjct  924  HDFMPEHIHSLFPNLNPHK  942



>ref|XP_004977021.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Setaria italica]
Length=820

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VGLRH+L++PK  ++  +PVVGILTR
Sbjct  726  ELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPK--SSTRAPVVGILTR  783

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    ++L + P L KS+
Sbjct  784  HDFMPEHVLGLHPFLFKSR  802



>gb|EMT06377.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=816

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEMYVDLHP TN +P+TV E++S+AKA+VLFR+VGLRH+L+VPK  A   SPVVGILTR
Sbjct  714  EMEMYVDLHPFTNASPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSPVVGILTR  771

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P L   K
Sbjct  772  HDFMPEHILGLHPVLLGGK  790



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EMEM++DLHP TN +P+TV E++S+AKA VLFR+VGLRH+L++PK  +   SPVVGILTR
Sbjct  684  EMEMFLDLHPFTNASPYTVVETMSLAKACVLFREVGLRHLLVIPKISSR--SPVVGILTR  741

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL + P LA S+
Sbjct  742  HDFMPEHILGLHPFLASSR  760



>ref|XP_010241599.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g [Nelumbo nucifera]
Length=781

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            EM+M++DLHP TN +P+TV E++S+AK+++LFR VGLRH+L+VPK   +  SPVVGILTR
Sbjct  685  EMDMFIDLHPFTNASPYTVVETMSLAKSLILFRGVGLRHLLVVPK--TSNWSPVVGILTR  742

Query  260  QDLRAHNILAVFPHLAKSK  204
             D    +IL ++P L KS+
Sbjct  743  HDFMPEHILGLYPXLQKSR  761



>gb|EEE60792.1| hypothetical protein OsJ_14377 [Oryza sativa Japonica Group]
Length=773

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -1

Query  440  EMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTR  261
            E++MYVDLHP+TNT+P+TV E++S+AKA VLFR +GLRH+L+VPK    G  P+VGILTR
Sbjct  697  ELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALGLRHLLVVPK--TPGRPPIVGILTR  754

Query  260  QDLRAHNILAVFPHLAKS  207
             D    +I  +FP+L KS
Sbjct  755  HDFMHEHIHGLFPNLGKS  772



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920