BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050H22

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               198   1e-60   Nicotiana sylvestris
gb|ABR25693.1|  putative elongation factor 1-alpha                      195   4e-60   Oryza sativa Indica Group [Indian rice]
gb|AAR83865.1|  elongation factor 1-alpha                               196   1e-59   Capsicum annuum
emb|CAA09041.1|  elongation factor 1-alpha                              193   6e-59   Cicer arietinum [garbanzo]
ref|XP_010456401.1|  PREDICTED: elongation factor 1-alpha 1             191   2e-58   Camelina sativa [gold-of-pleasure]
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        192   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    193   2e-58   Camelina sativa [gold-of-pleasure]
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     193   3e-58   Glycine max [soybeans]
gb|ACF81592.1|  unknown                                                 193   3e-58   Zea mays [maize]
dbj|BAH20400.1|  AT1G07940                                              193   4e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAC06383.1|  elongation factor 1 alpha                               191   5e-58   Malus domestica [apple tree]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            192   6e-58   
gb|KJB73628.1|  hypothetical protein B456_011G2414001                   190   8e-58   Gossypium raimondii
dbj|BAF75826.1|  hypothetical protein                                   192   9e-58   Malus domestica [apple tree]
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   192   9e-58   Gossypium raimondii
gb|AAQ90154.1|  putative translation elongation factor protein          194   1e-57   Solanum tuberosum [potatoes]
dbj|BAF75825.1|  hypothetical protein                                   191   1e-57   Malus domestica [apple tree]
dbj|BAO57272.1|  elongation factor 1-alpha                              198   2e-57   Ipomoea nil [qian niu]
gb|ABW74483.1|  elongation factor                                       191   3e-57   Paeonia suffruticosa [moutan peony]
dbj|BAN42602.1|  putative elongation factor 1-alpha                     190   7e-57   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    194   1e-56   
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          197   1e-56   Nicotiana sylvestris
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          196   1e-56   Nicotiana sylvestris
dbj|BAA34348.1|  elongation factor-1 alpha                              196   1e-56   Nicotiana paniculata
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          196   1e-56   Nicotiana tomentosiformis
gb|AFW76429.1|  putative translation elongation factor Tu family ...    192   2e-56   
emb|CAL25349.1|  elongation factor 1 alpha                              189   2e-56   Platanus x hispanica [London plane tree]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    196   3e-56   Nicotiana tabacum [American tobacco]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               196   3e-56   Nicotiana tomentosiformis
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               196   3e-56   Nicotiana sylvestris
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               196   3e-56   Nicotiana tomentosiformis
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             194   3e-56   Solanum tuberosum [potatoes]
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  194   3e-56   Solanum tuberosum [potatoes]
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          196   3e-56   Solanum lycopersicum
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    195   4e-56   
gb|AGZ15393.1|  elongation factor 1-alpha                               191   4e-56   Phaseolus vulgaris [French bean]
gb|KHG20498.1|  Elongation factor 1-alpha                               195   4e-56   Gossypium arboreum [tree cotton]
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      192   4e-56   Cicer arietinum [garbanzo]
emb|CAA65453.1|  elongation factor                                      189   4e-56   Narcissus pseudonarcissus
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   191   5e-56   Gossypium raimondii
ref|NP_001275481.1|  elongation factor 1-alpha-like                     195   5e-56   Solanum tuberosum [potatoes]
gb|EEE58429.1|  hypothetical protein OsJ_09630                          194   5e-56   Oryza sativa Japonica Group [Japonica rice]
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         189   5e-56   Jatropha curcas
dbj|BAN42601.1|  putative elongation factor 1-alpha                     188   6e-56   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          195   6e-56   Tarenaya hassleriana [spider flower]
dbj|BAA23658.1|  EF-1 alpha                                             195   6e-56   Oryza sativa [red rice]
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   191   6e-56   Gossypium raimondii
ref|NP_001234035.1|  elongation factor 1-alpha                          195   6e-56   Solanum lycopersicum
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          195   7e-56   Tarenaya hassleriana [spider flower]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             194   7e-56   Solanum tuberosum [potatoes]
gb|ABB86283.1|  elongation factor-1 alpha-like                          194   7e-56   Solanum tuberosum [potatoes]
ref|NP_001049145.1|  Os03g0177400                                       194   7e-56   
dbj|BAC23049.1|  Elongation factor 1-alpha                              194   7e-56   Solanum tuberosum [potatoes]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          194   7e-56   Oryza brachyantha
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          194   7e-56   Solanum tuberosum [potatoes]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          194   8e-56   Oryza sativa Japonica Group [Japonica rice]
gb|AAC15413.1|  translation elongation factor-1 alpha                   194   8e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          194   9e-56   Sesamum indicum [beniseed]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            191   9e-56   
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    194   1e-55   Theobroma cacao [chocolate]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    194   1e-55   Theobroma cacao [chocolate]
gb|KJB48746.1|  hypothetical protein B456_008G084000                    193   1e-55   Gossypium raimondii
dbj|BAH56641.1|  elongation factor 1a                                   192   1e-55   Nelumbo nucifera [Indian lotus]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    194   1e-55   Gossypium raimondii
emb|CAL07988.1|  translation elongation factor 1 alpha                  188   1e-55   Platanus x hispanica [London plane tree]
gb|AGZ90153.1|  elongation factor 1-alpha                               188   1e-55   Litsea cubeba [may chang]
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       190   1e-55   Cucumis sativus [cucumbers]
ref|XP_004173991.1|  PREDICTED: elongation factor 1-alpha-like          184   1e-55   
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   194   1e-55   Lilium longiflorum [Easter lily]
gb|AIX10769.1|  elongation factor 1 alpha                               194   1e-55   Panax notoginseng [san-qi]
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        194   2e-55   Salsola komarovii
gb|AGH55661.1|  elongation factor 1-alpha                               191   2e-55   Atropa belladonna [deadly nightshade]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               194   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          193   2e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    193   2e-55   Gossypium raimondii
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               193   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          193   2e-55   Nelumbo nucifera [Indian lotus]
emb|CDX70032.1|  BnaA10g23810D                                          191   2e-55   
gb|AGH32502.1|  translation elongation factor-1 alpha                   193   2e-55   Stylosanthes guianensis [stylo]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     187   2e-55   Vitis vinifera
gb|AAN77897.1|  elongation factor 1 alpha                               193   2e-55   Stevia rebaudiana
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          193   2e-55   Solanum tuberosum [potatoes]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                189   2e-55   Ricinus communis
gb|ABV26710.1|  elongation factor 1 alpha                               193   2e-55   Gerbera hybrid cultivar
gb|AHE76183.1|  elongation factor 1-alpha                               193   3e-55   Chrysanthemum indicum
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               193   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               193   3e-55   Fragaria vesca subsp. vesca
ref|XP_002539209.1|  elongation factor 1-alpha, putative                189   3e-55   Ricinus communis
ref|WP_033581549.1|  elongation factor 1-alpha                          184   3e-55   
gb|ABA12218.1|  translation elongation factor 1A-2                      193   3e-55   Gossypium hirsutum [American cotton]
emb|CAD60652.1|  elongation factor                                      193   3e-55   Solanum tuberosum [potatoes]
gb|AGT16628.1|  elongation factor 1 alpha                               192   3e-55   Saccharum hybrid cultivar R570
gb|ABA12223.1|  translation elongation factor 1A-7                      193   3e-55   Gossypium hirsutum [American cotton]
gb|KHG26926.1|  Elongation factor 1-alpha                               193   3e-55   Gossypium arboreum [tree cotton]
ref|NP_001077483.1|  elongation factor 1-alpha 2                        191   3e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16893.1|  elongation factor 1-alpha                               193   3e-55   Saccharum hybrid cultivar R570
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     192   3e-55   Eucalyptus grandis [rose gum]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    193   3e-55   Setaria italica
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          193   3e-55   
gb|ABA12221.1|  translation elongation factor 1A-5                      193   4e-55   Gossypium hirsutum [American cotton]
ref|NP_001237425.1|  elongation factor-1A                               192   4e-55   
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    192   4e-55   Glycine max [soybeans]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         192   4e-55   
gb|KHN18669.1|  Elongation factor 1-alpha                               192   4e-55   Glycine soja [wild soybean]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          192   4e-55   Tarenaya hassleriana [spider flower]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          192   4e-55   Eucalyptus grandis [rose gum]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    192   4e-55   Eucalyptus grandis [rose gum]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          192   4e-55   Tarenaya hassleriana [spider flower]
gb|AFY06644.1|  elongation factor 1-alpha                               189   4e-55   Carica papaya [mamon]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    192   4e-55   
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    192   5e-55   Glycine max [soybeans]
ref|NP_001152668.1|  LOC100286309                                       192   5e-55   Zea mays [maize]
gb|ABA12222.1|  translation elongation factor 1A-6                      192   5e-55   Gossypium hirsutum [American cotton]
gb|AAX54511.1|  elongation factor 1 alpha                               192   5e-55   Actinidia deliciosa [Chinese gooseberry]
gb|ADC68236.1|  elongation factor 1-alpha                               186   5e-55   Dendrobium nobile
dbj|BAL14665.1|  elongation factor 1-alpha                              192   6e-55   Chrysanthemum seticuspe f. boreale
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             192   6e-55   Citrus clementina [clementine]
gb|AAL79775.1|  elongation factor 1 alpha                               192   6e-55   Saccharum hybrid cultivar CP72-2086
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          192   6e-55   Cicer arietinum [garbanzo]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    192   6e-55   Eucalyptus grandis [rose gum]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          192   7e-55   Setaria italica
gb|ABS10822.1|  elongation factor 1-alpha                               185   7e-55   Phaseolus vulgaris [French bean]
gb|ACR38047.1|  unknown                                                 192   7e-55   Zea mays [maize]
gb|ABU63160.1|  elongation factor                                       192   7e-55   Saccharum officinarum [noble cane]
emb|CDX88757.1|  BnaA03g08920D                                          191   7e-55   
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             192   7e-55   Eutrema salsugineum [saltwater cress]
gb|AFC88830.1|  putative elongation factor 1-alpha                      192   8e-55   Miscanthus sinensis
emb|CDY22710.1|  BnaC08g43440D                                          191   8e-55   Brassica napus [oilseed rape]
gb|ABA12225.1|  translation elongation factor 1A-9                      192   9e-55   Gossypium hirsutum [American cotton]
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          187   9e-55   Cucumis melo [Oriental melon]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     192   9e-55   Zea mays [maize]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     192   9e-55   Saccharum hybrid cultivar CP65-357
gb|KHG23927.1|  Elongation factor 1-alpha                               192   9e-55   Gossypium arboreum [tree cotton]
gb|ABA12220.1|  translation elongation factor 1A-4                      192   9e-55   Gossypium hirsutum [American cotton]
gb|KHG01531.1|  Elongation factor 1-alpha                               192   9e-55   Gossypium arboreum [tree cotton]
gb|ABA12217.1|  translation elongation factor 1A-1                      192   1e-54   Gossypium hirsutum [American cotton]
gb|ACG31866.1|  elongation factor 1-alpha                               192   1e-54   Zea mays [maize]
emb|CDY61938.1|  BnaCnng38780D                                          191   1e-54   Brassica napus [oilseed rape]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    191   1e-54   Zea mays [maize]
gb|AGY80449.1|  elongation factor 1-alpha                               191   1e-54   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          191   1e-54   Zea mays [maize]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               191   1e-54   Vitis vinifera
gb|ABR16818.1|  unknown                                                 183   1e-54   Picea sitchensis
gb|ABK26215.1|  unknown                                                 181   1e-54   Picea sitchensis
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    191   1e-54   Sesamum indicum [beniseed]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               191   1e-54   Sesamum indicum [beniseed]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             191   1e-54   Brassica rapa
ref|XP_002528020.1|  elongation factor 1-alpha, putative                189   1e-54   
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        191   1e-54   Brassica rapa
gb|AEN79476.1|  elongation factor 1-alpha                               191   1e-54   Ziziphus jujuba [Chinese jujube]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        191   1e-54   Brassica rapa
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       188   1e-54   Cucumis sativus [cucumbers]
gb|AAL57653.1|  At1g07930/T6D22_3                                       191   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ACG34498.1|  elongation factor 1-alpha                               191   1e-54   Zea mays [maize]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          191   1e-54   Eucalyptus grandis [rose gum]
ref|NP_200847.1|  elongation factor 1-alpha 4                           191   1e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CAA34456.1|  elongation factor 1-alpha                              191   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             191   1e-54   Capsella rubella
dbj|BAF02151.1|  elongation factor 1-alpha                              191   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     191   1e-54   Glycine max [soybeans]
gb|AAL69396.1|  elongation factor 1-alpha                               191   1e-54   Elaeis oleifera
gb|AAK82537.1|  At1g07930/T6D22_3                                       191   1e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  186   1e-54   Plantago major [cart-track plant]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    191   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ACS68200.1|  elongation factor 1 alpha                               191   2e-54   Brassica napus [oilseed rape]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    191   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          191   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX93604.1|  BnaA06g04440D                                          191   2e-54   
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    191   2e-54   Populus euphratica
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          191   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          191   2e-54   Fragaria vesca subsp. vesca
gb|KHN42761.1|  Elongation factor 1-alpha                               191   2e-54   Glycine soja [wild soybean]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          191   2e-54   Populus euphratica
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    191   2e-54   Populus euphratica
gb|KHN14872.1|  Elongation factor 1-alpha                               191   2e-54   Glycine soja [wild soybean]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             191   2e-54   Citrus clementina [clementine]
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         190   2e-54   Jatropha curcas
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               191   2e-54   Pyrus x bretschneideri [bai li]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  191   2e-54   Citrus sinensis [apfelsine]
ref|NP_001105617.1|  elongation factor alpha3                           191   2e-54   Zea mays [maize]
ref|NP_001105933.1|  elongation factor alpha2                           191   2e-54   
gb|ADI24333.1|  elongation factor 1-alpha                               191   2e-54   Miscanthus sinensis
ref|NP_001105587.1|  elongation factor 1-alpha                          191   2e-54   Zea mays [maize]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               191   2e-54   Malus domestica [apple tree]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    191   2e-54   Zea mays [maize]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             191   2e-54   Phaseolus vulgaris [French bean]
gb|AID52924.1|  elongation factor 1-alpha                               191   3e-54   Carthamus tinctorius
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    191   3e-54   Pisum sativum [garden pea]
gb|ADW83729.1|  elongation factor 1-alpha                               183   3e-54   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               191   3e-54   Elaeis guineensis
ref|NP_001288465.1|  elongation factor 1-alpha-like                     191   3e-54   Zea mays [maize]
gb|ABA12219.1|  translation elongation factor 1A-3                      191   3e-54   Gossypium hirsutum [American cotton]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               190   3e-54   Prunus mume [ume]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   190   3e-54   Lilium longiflorum [Easter lily]
gb|AHB86963.1|  elongation factor 1-alpha                               190   3e-54   Sedum alfredii
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             190   3e-54   Prunus persica
gb|AFW77593.1|  putative translation elongation factor Tu family ...    190   3e-54   
emb|CDX95108.1|  BnaC05g05630D                                          191   3e-54   
gb|ACU31840.1|  translation elongation factor 1 alpha                   180   3e-54   Populus trichocarpa x Populus deltoides
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    190   3e-54   Vicia faba [broad bean]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               190   3e-54   Cucumis melo [Oriental melon]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          190   4e-54   Phoenix dactylifera
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             190   4e-54   Citrus clementina [clementine]
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    186   4e-54   
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          190   4e-54   Malus domestica [apple tree]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             190   4e-54   Prunus persica
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         189   4e-54   Jatropha curcas
gb|AEQ75495.1|  elongation factor 1-alpha                               190   4e-54   Rosa multiflora [Japanese rose]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          190   4e-54   Elaeis guineensis
gb|AAR82894.1|  elongation factor 1-alpha                               190   5e-54   Cichorium intybus [radicchio]
gb|KHG27341.1|  Elongation factor 1-alpha                               190   5e-54   Gossypium arboreum [tree cotton]
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          190   5e-54   Cucumis sativus [cucumbers]
gb|AGJ50595.1|  EF1alpha                                                190   5e-54   Pericallis cruenta
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    190   5e-54   
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               190   5e-54   Cucumis melo [Oriental melon]
gb|ACI96243.1|  elongation factor 1-alpha                               189   5e-54   Prunus persica
gb|KHG24249.1|  Elongation factor 1-alpha                               188   6e-54   Gossypium arboreum [tree cotton]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    189   6e-54   Theobroma cacao [chocolate]
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         187   6e-54   Medicago truncatula
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          189   7e-54   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY58828.1|  BnaAnng15460D                                          192   7e-54   Brassica napus [oilseed rape]
gb|AFO68185.1|  elongation factor 1A                                    179   8e-54   Anthurium andraeanum [flamingo-lily]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   189   8e-54   Lilium longiflorum [Easter lily]
gb|KHG28979.1|  Elongation factor 1-alpha                               189   8e-54   Gossypium arboreum [tree cotton]
ref|NP_001105565.1|  elongation factor alpha5                           189   8e-54   
gb|AHA84124.1|  elongation factor 1-alpha                               189   8e-54   Phaseolus vulgaris [French bean]
gb|ABA12224.1|  translation elongation factor 1A-8                      189   9e-54   Gossypium hirsutum [American cotton]
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         189   9e-54   Jatropha curcas
dbj|BAM13874.1|  elongation factor 1 alpha                              189   9e-54   Symplocarpus renifolius
gb|AAF99703.1|  elongation factor                                       189   9e-54   Saccharum officinarum [noble cane]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               189   9e-54   Phoenix dactylifera
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          189   9e-54   Eucalyptus grandis [rose gum]
gb|AEI29162.1|  EF1a-like protein                                       188   9e-54   Phalaenopsis hybrid cultivar
gb|ABF00115.1|  elongation factor 1-alpha                               189   1e-53   Litchi chinensis [litchi]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               189   1e-53   Elaeis guineensis
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          189   1e-53   Amborella trichopoda
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          186   1e-53   Populus euphratica
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               189   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          189   1e-53   Phoenix dactylifera
ref|XP_002518073.1|  elongation factor 1-alpha, putative                189   1e-53   Ricinus communis
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     189   1e-53   Glycine max [soybeans]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         189   1e-53   Jatropha curcas
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             189   1e-53   Phaseolus vulgaris [French bean]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                189   1e-53   
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               189   1e-53   Vitis vinifera
dbj|BAH19898.1|  AT1G07930                                              189   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AFP44110.1|  elongation factor 1-alpha                               189   1e-53   Lycoris longituba
gb|AGC94754.1|  elongation factor 1 alpha                               189   1e-53   Euphorbia lathyris
gb|AIZ68131.1|  translation elongation factor 1-alpha                   189   1e-53   Ornithogalum longebracteatum [sea-onion]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    189   1e-53   Gossypium raimondii
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        188   2e-53   Brassica rapa
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    188   2e-53   
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    188   2e-53   Daucus carota [carrots]
gb|AAY56337.1|  elongation factor-1 alpha                               188   2e-53   Musa acuminata [banana]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          188   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN51228.1|  Elongation factor 1-alpha                               187   2e-53   Cucumis sativus [cucumbers]
gb|AAV92325.1|  translation elongation factor-1 alpha                   182   2e-53   Pseudotsuga menziesii var. menziesii
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          188   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001290506.1|  elongation factor 1-alpha                          188   2e-53   Elaeis guineensis
gb|AIM48895.1|  elongation factor 1-alpha                               187   2e-53   Cinnamomum camphora
ref|NP_001280807.1|  elongation factor 1-alpha-like                     188   2e-53   Malus domestica [apple tree]
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             188   2e-53   Prunus persica
gb|AFJ04514.1|  elongation factor 1-alpha                               187   3e-53   Vernicia fordii [tung oil tree]
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               188   3e-53   Eucalyptus grandis [rose gum]
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          188   3e-53   Cucumis sativus [cucumbers]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        188   3e-53   Hevea brasiliensis [jebe]
ref|XP_003604823.1|  Elongation factor 1-alpha                          188   3e-53   
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          188   3e-53   
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          187   3e-53   Elaeis guineensis
dbj|BAM13877.1|  elongation factor 1 alpha                              187   3e-53   Arum maculatum [cuckoo-pint]
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          187   3e-53   Elaeis guineensis
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               187   3e-53   Fragaria vesca subsp. vesca
ref|XP_003588821.1|  Elongation factor 1-alpha                          188   3e-53   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             187   4e-53   
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               187   4e-53   Prunus mume [ume]
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        187   4e-53   Suaeda japonica
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         188   4e-53   Medicago truncatula
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        187   4e-53   Hevea brasiliensis [jebe]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          187   4e-53   
gb|AAL32631.1|  putative elongation factor 1-a                          187   4e-53   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         187   4e-53   
ref|NP_001105934.1|  elongation factor alpha7                           187   4e-53   
ref|NP_001104938.1|  elongation factor 1 alpha                          187   5e-53   
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          187   5e-53   
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          187   5e-53   
ref|XP_001763198.1|  predicted protein                                  185   5e-53   
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         187   5e-53   
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         187   5e-53   
dbj|BAC66180.1|  elongation factor 1A                                   187   5e-53   
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              187   6e-53   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    186   6e-53   
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          187   6e-53   
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               187   6e-53   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          187   6e-53   
gb|ABD66072.1|  elongation factor 1-alpha                               181   7e-53   
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          187   7e-53   
ref|NP_001105935.1|  elongation factor alpha8                           187   7e-53   
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    187   7e-53   
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             187   7e-53   
ref|NP_001183947.1|  uncharacterized protein LOC100502553               186   8e-53   
gb|AGS43120.1|  elongation factor alpha5                                176   8e-53   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         186   8e-53   
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        186   9e-53   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             186   9e-53   
dbj|BAL41369.1|  elongation factor 1-alpha                              177   9e-53   
gb|ABD66517.1|  EF-1 alpha                                              186   1e-52   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          186   1e-52   
gb|AEE98365.1|  elongation factor 1-alpha                               176   1e-52   
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       184   1e-52   
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          186   1e-52   
gb|EPS66340.1|  elongation factor 1-alpha                               186   1e-52   
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          186   1e-52   
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          186   1e-52   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    186   1e-52   
gb|AGV54713.1|  elongation factor 1-alpha                               186   1e-52   
ref|NP_001104939.1|  elongation factor alpha6                           186   1e-52   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                186   1e-52   
ref|XP_002892424.1|  T6D22.2                                            191   2e-52   
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          186   2e-52   
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    186   2e-52   
ref|NP_001151074.1|  elongation factor 1-alpha                          186   2e-52   
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               186   2e-52   
ref|XP_002312029.1|  ADR12-2 family protein                             186   2e-52   
ref|XP_002311107.1|  ADR12-2 family protein                             186   2e-52   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             186   2e-52   
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          186   2e-52   
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          186   2e-52   
gb|AGI15328.1|  elongation factor 1                                     186   2e-52   
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  185   2e-52   
ref|XP_001766482.1|  predicted protein                                  185   2e-52   
gb|AAF79822.1|AC026875_2  T6D22.2                                       191   2e-52   
ref|XP_003591959.1|  Elongation factor 1-alpha                          187   2e-52   
ref|WP_039311837.1|  hypothetical protein                               175   3e-52   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             185   3e-52   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             185   4e-52   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             185   4e-52   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             185   4e-52   
gb|AAP80665.1|AF479046_1  elongation factor-1 alpha                     176   4e-52   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    187   5e-52   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             182   5e-52   
ref|XP_002311106.1|  ADR12-2 family protein                             184   5e-52   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             184   5e-52   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          184   5e-52   
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             184   6e-52   
gb|EPS66069.1|  elongation factor 1-alpha                               184   6e-52   
gb|ADK73624.1|  elongation factor 1 alpha                               180   7e-52   
ref|XP_001763201.1|  predicted protein                                  184   8e-52   
ref|XP_001753167.1|  predicted protein                                  184   9e-52   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    184   9e-52   
ref|XP_001763194.1|  predicted protein                                  184   9e-52   
ref|XP_001753181.1|  predicted protein                                  184   1e-51   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 184   1e-51   
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               183   1e-51   
ref|XP_003604587.1|  Elongation factor 1-alpha                          183   1e-51   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        183   1e-51   
gb|ACN40740.1|  unknown                                                 183   2e-51   
gb|ABK24265.1|  unknown                                                 183   2e-51   
emb|CAC27139.1|  translation elongation factor-1 alpha                  183   2e-51   
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    176   2e-51   
gb|ACN41180.1|  unknown                                                 183   2e-51   
gb|ABK25072.1|  unknown                                                 183   2e-51   
gb|ACN40081.1|  unknown                                                 183   2e-51   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          182   2e-51   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    188   2e-51   
gb|EMS52529.1|  Elongation factor 1-alpha                               182   6e-51   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    182   6e-51   
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             181   6e-51   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 181   7e-51   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                181   7e-51   
gb|EMS59091.1|  Elongation factor 1-alpha                               182   1e-50   
ref|XP_003618775.1|  Elongation factor 1-alpha                          186   1e-50   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    186   2e-50   
gb|AHZ58493.1|  translation elongation factor alpha                     180   3e-50   
gb|ABK24843.1|  unknown                                                 180   3e-50   
gb|AGI78242.1|  elongation factor 1 alpha                               180   3e-50   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   179   4e-50   
gb|ABR17675.1|  unknown                                                 179   4e-50   
gb|EMS65134.1|  Elongation factor 1-alpha                               182   6e-50   
ref|XP_004169868.1|  PREDICTED: elongation factor 1-alpha-like          169   9e-50   
ref|XP_001753059.1|  predicted protein                                  178   9e-50   
gb|EMS49772.1|  Elongation factor 1-alpha                               178   1e-49   
gb|EMT09703.1|  Elongation factor 1-alpha                               181   1e-49   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    177   2e-49   
gb|AER42621.1|  elongation factor 1 alpha                               177   2e-49   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    177   2e-49   
gb|EMT12343.1|  Elongation factor 1-alpha                               177   2e-49   
gb|ABQ81942.1|  elongation factor 1-alpha                               171   3e-49   
gb|KHG15275.1|  Elongation factor 1-alpha                               177   3e-49   
gb|AEE98364.1|  elongation factor 1-alpha                               177   3e-49   
gb|ABE01407.1|  translation elongation factor 1a-1                      164   9e-48   
gb|AGO97079.1|  elongation factor 1-alpha                               166   9e-48   
gb|ABE01408.1|  translation elongation factor 1a-2                      164   1e-47   
gb|ABQ81936.1|  elongation factor 1-alpha                               172   2e-47   
dbj|BAK08744.1|  elongation factor 1-alpha                              172   2e-47   
dbj|BAK08818.1|  elongation factor 1-alpha                              172   2e-47   
dbj|BAK08819.1|  elongation factor 1-alpha                              172   3e-47   
gb|AGO97080.1|  elongation factor 1-alpha                               164   7e-47   
gb|AJF94634.1|  elongation factor 1-alpha                               162   8e-47   
gb|AGO97078.1|  elongation factor 1-alpha                               164   8e-47   
ref|NP_174788.1|  elongation factor Tu C-terminal domain-containi...    160   2e-46   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    163   1e-45   
gb|ADP36952.1|  hypothetical protein                                    159   2e-45   
gb|AFN42763.1|  elongation factor 1-alpha                               162   3e-45   
dbj|BAD94755.1|  elongation factor 1-alpha                              156   4e-45   
gb|AHZ44777.1|  elongation factor 1 alpha                               156   8e-45   
gb|AAO61852.1|  translation elongation factor-1 alpha                   164   2e-44   
gb|AAK94429.1|AF398148_1  translation elongation factor 1 alpha c...    155   2e-44   
gb|AIM46989.1|  translation elongation factor 1-alpha                   164   3e-44   
gb|EPY33803.1|  elongation factor 1-alpha                               160   5e-44   
gb|EPY25861.1|  elongation factor 1-alpha                               161   5e-44   
gb|ACL97363.1|  elongation factor-1 alpha                               162   9e-44   
gb|ADK90073.1|  elongation factor 1 alpha                               162   2e-43   
gb|EMS24916.1|  translation elongation factor EF-1 alpha subunit        153   3e-43   
gb|AAH99609.1|  Eef1a1 protein                                          152   3e-43   
gb|EPY27955.1|  elongation factor 1-alpha                               161   3e-43   
gb|AAF79371.1|AC007887_30  F15O4.37                                     164   4e-43   
gb|ABD64137.1|  elongation factor-1 alpha                               152   4e-43   
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     161   4e-43   
gb|AAV34150.1|  EF-1 alpha                                              155   6e-43   
ref|XP_002806374.1|  PREDICTED: elongation factor 1-alpha 1-like        152   7e-43   
ref|XP_009387472.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    153   8e-43   
emb|CEI96289.1|  Putative Elongation factor 1-alpha                     153   9e-43   
ref|XP_011069517.1|  PREDICTED: elongation factor 1-alpha               151   9e-43   
ref|WP_043641907.1|  hypothetical protein                               150   1e-42   
gb|ACO50109.1|  elongation factor 1 alpha                               156   1e-42   
gb|ADG23104.1|  elongation factor 1-alpha                               152   1e-42   
ref|XP_005650451.1|  translation elongation factor                      159   1e-42   
gb|AAZ81003.1|  eukaryotic translation elongation factor 1 alpha 1      152   1e-42   
gb|AAH12509.1|  EEF1A1 protein                                          152   1e-42   
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    156   2e-42   
gb|EDL77720.1|  rCG25445, isoform CRA_b                                 152   2e-42   
gb|EDL26405.1|  mCG15232, isoform CRA_f                                 152   2e-42   
gb|EKG07919.1|  elongation factor 1-alpha (ef-1-alpha), putative        152   2e-42   
gb|AGW80518.1|  elongation factor 1-alpha 1                             152   2e-42   
ref|XP_010898590.1|  PREDICTED: elongation factor 1-alpha, oocyte...    152   2e-42   
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    159   2e-42   
gb|ACL97366.1|  elongation factor-1 alpha                               158   2e-42   
ref|XP_003873869.1|  elongation factor 1-alpha                          153   2e-42   
ref|XP_007524539.1|  PREDICTED: elongation factor 1-alpha 2-like        150   3e-42   
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 159   3e-42   
gb|ADB55729.1|  elongation factor 1-alpha                               159   3e-42   
gb|ACF70735.1|  eukaryotic translation elongation factor 1              152   3e-42   
gb|EWC64676.1|  hypothetical protein W893_14860                         151   4e-42   
emb|CCW70819.1|  unnamed protein product                                153   4e-42   
gb|KFH03380.1|  elongation factor 1-alpha                               150   5e-42   
gb|ACO50115.1|  elongation factor 1 alpha                               157   5e-42   
gb|ABB46371.1|  elongation factor-1 alpha                               152   6e-42   
gb|ADO22142.1|  translation elongation factor 1 alpha                   157   7e-42   
gb|AEG78376.1|  elongation factor 1 alpha                               152   7e-42   
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  157   7e-42   
ref|XP_005675615.1|  PREDICTED: elongation factor 1-alpha 1-like        152   8e-42   
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  157   8e-42   
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   157   8e-42   
gb|EDL26404.1|  mCG15232, isoform CRA_e                                 152   9e-42   
gb|KEH40223.1|  GTP-binding elongation factor Tu family protein         157   9e-42   
ref|XP_008712228.1|  elongation factor 1-alpha                          157   1e-41   
gb|ACR58252.1|  elongation factor-1 alpha                               148   1e-41   
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   157   1e-41   
gb|EKF27061.1|  elongation factor 1-alpha (ef-1-alpha), putative        150   1e-41   
gb|KHN00035.1|  Elongation factor 1-alpha                               149   1e-41   
emb|CBQ70305.1|  probable translation elongation factor eEF-1 alp...    157   1e-41   
gb|ACO50110.1|  elongation factor 1 alpha                               157   1e-41   
dbj|GAK62779.1|  elongation factor 1-alpha                              150   1e-41   
emb|CAA40028.1|  42Sp48                                                 154   1e-41   
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  157   1e-41   
ref|XP_822464.1|  elongation factor 1-alpha                             155   1e-41   
ref|XP_001551786.1|  elongation factor 1-alpha                          157   1e-41   
gb|ESZ89813.1|  elongation factor 1-alpha                               157   1e-41   
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             157   1e-41   
emb|CDH51884.1|  elongation factor 1-alpha                              152   1e-41   
emb|CCC51155.1|  putative elongation factor 1-alpha                     157   1e-41   
gb|EDL88757.1|  eukaryotic translation elongation factor 1 alpha ...    150   1e-41   
emb|CCC51157.1|  putative EF-1-alpha                                    157   1e-41   
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             157   1e-41   
emb|CCX05343.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    157   1e-41   
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        157   2e-41   
dbj|BAH23674.1|  elongation factor 1-alpha                              150   2e-41   
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    157   2e-41   
ref|XP_003037261.1|  translation elongation factor 1a                   157   2e-41   
ref|XP_007671812.1|  hypothetical protein BAUCODRAFT_28973              157   2e-41   
ref|XP_007921049.1|  hypothetical protein MYCFIDRAFT_209593             156   2e-41   
emb|CAM12250.1|  elongation factor 1a                                   149   2e-41   
gb|ABC75588.1|  elongation factor 1-alpha                               149   2e-41   
dbj|BAI40097.1|  elongation factor-1 alpha                              149   2e-41   
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   156   2e-41   
gb|ELK00148.1|  Elongation factor 1-alpha 1                             151   3e-41   
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  156   3e-41   
emb|CDQ71533.1|  unnamed protein product                                152   3e-41   
gb|ADO22134.1|  translation elongation factor 1 alpha                   155   3e-41   
ref|XP_003716248.1|  elongation factor 1-alpha                          156   3e-41   
ref|XP_002392294.1|  hypothetical protein MPER_08150                    153   3e-41   
gb|AAY34910.1|  elongation factor 1 alpha                               146   3e-41   
gb|AAK72105.1|  elongation factor-1 alpha                               146   3e-41   
emb|CBY16376.1|  unnamed protein product                                151   3e-41   
gb|AAH14892.1|  Unknown (protein for IMAGE:3909122)                     151   3e-41   
gb|AGG40755.1|  elongation factor 1-alpha                               151   3e-41   
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             156   3e-41   
ref|XP_002835319.1|  hypothetical protein                               154   3e-41   
gb|KFX50753.1|  Elongation factor 1-alpha                               155   3e-41   



>ref|XP_009773066.1| PREDICTED: elongation factor 1-alpha, partial [Nicotiana sylvestris]
Length=149

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  44   GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  103

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  104  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  138



>gb|ABR25693.1| putative elongation factor 1-alpha [Oryza sativa Indica Group]
Length=108

 Score =   195 bits (496),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  3    GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  62

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  63   TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  97



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  61   GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  120

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  121  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  155



>emb|CAA09041.1| elongation factor 1-alpha [Cicer arietinum]
Length=130

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  25   GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  84

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  85   TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  119



>ref|XP_010456401.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 dbj|BAD94936.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CDY69678.1| BnaAnng31190D [Brassica napus]
 emb|CDY67376.1| BnaC03g71530D [Brassica napus]
 emb|CDY06288.1| BnaA09g49150D [Brassica napus]
 emb|CDY06290.1| BnaA09g49130D [Brassica napus]
Length=115

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  8    GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  67

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  68   TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  102



>dbj|BAD95246.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
Length=143

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  36   GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  95

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  96   TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  130



>ref|XP_010458012.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
Length=165

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  58   GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  117

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  118  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  152



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  88   GNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  147

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  148  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  182



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  79   GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  138

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  139  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  173



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  79   GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  138

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  139  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  173



>gb|AAC06383.1| elongation factor 1 alpha, partial [Malus domestica]
Length=143

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  38   GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVE  97

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  98   TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  132



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   192 bits (489),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  81   GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  140

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  141  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  175



>gb|KJB73628.1| hypothetical protein B456_011G2414001, partial [Gossypium raimondii]
Length=131

 Score =   190 bits (483),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  24   GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  83

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  84   TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  118



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   192 bits (487),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  79   GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  138

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  139  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  173



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   192 bits (487),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  81   GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  140

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  141  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  175



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  181  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  240

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  241  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  275



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  79   GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVE  138

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  139  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  173



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  79   GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  138

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMR+TVAVGVIK+VDKKDPTG
Sbjct  139  TFSEYPPLGRFAVRDMRRTVAVGVIKSVDKKDPTG  173



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   190 bits (482),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPT+PMVVE
Sbjct  96   GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTRPMVVE  155

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  156  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  190



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  241  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  300

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  301  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  335



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  188  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  247

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  248  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  94   GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  153

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  154  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  188



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  294  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  353

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  354  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  294  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  353

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  354  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPSG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  188  GNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  247

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  248  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  221  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  280

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  281  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  315



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAV+FAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  137  GNGYAPVLDCHTSHIAVRFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  196

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPP+GRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  197  TFAEYPPMGRFAVRDMRQTVAVGVIKSVEKKDPTG  231



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   191 bits (485),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  195  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  254

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  255  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  289



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  322  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  381

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  382  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  416



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  142  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  201

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  202  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  236



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            G GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  96   GQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  155

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  156  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  190



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  217  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  276

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  277  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  311



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  343  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  402

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  403  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  437



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  344  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  403

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  438



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   194 bits (494),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK+P+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKEPSG  436



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  218  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  277

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  278  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  312



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  294  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  353

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  354  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  261  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  320

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  321  TFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  355



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  131  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  190

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  191  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  225



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  134  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  193

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  194  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  228



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  188  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  247

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  248  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_004173991.1| PREDICTED: elongation factor 1-alpha-like, partial [Cucumis sativus]
Length=112

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  5    GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  64

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK V+KKD +G
Sbjct  65   TFSAYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  99



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  436



>dbj|BAC22127.1| eukaryotic elongation factor 1A [Salsola komarovii]
Length=447

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFA +LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  229  GNGYAPVLDCHTSHIAVKFAXILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  288

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  289  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  323



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010669660.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669661.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  321  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  380

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  381  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  415



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  237  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  296

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  297  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  331



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  121  GNGYAPVLDCHTSHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  180

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  181  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  215



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  188  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  247

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  248  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  188  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  247

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  248  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|WP_033581549.1| elongation factor 1-alpha, partial [Dickeya zeae]
Length=147

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  56   GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  115

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  348
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  116  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  147



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  294  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  353

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  354  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  265  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  324

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  325  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  359



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  323  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  382

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  383  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  417



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  229  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  288

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  289  TFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  323



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM+PT+PMVVE
Sbjct  134  GNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTRPMVVE  193

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  194  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  228



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  336  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  395

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  396  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  430



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   185 bits (469),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  106  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVE  165

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP  345
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct  166  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  198



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX88757.1| BnaA03g08920D [Brassica napus]
Length=401

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  294  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  353

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  354  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  388



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  320  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  379

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  380  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPM+VE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMLVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   187 bits (475),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  166  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  225

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK V+KKD +G
Sbjct  226  TFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  260



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG++KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGLIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  321  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  380

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  381  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  415



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ABR16818.1| unknown [Picea sitchensis]
Length=167

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE++TK+DRRSGKELE+EPKFLKNGDAG +KM+P+KPMVVE
Sbjct  61   GNGYAPVLDCHTSHIAVKFAEIMTKVDRRSGKELEREPKFLKNGDAGFIKMIPSKPMVVE  120

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  342
            TFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDPT
Sbjct  121  TFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPT  154



>gb|ABK26215.1| unknown [Picea sitchensis]
Length=113

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHT HIAVKF+E++TK+DRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  8    GNGYAPVLDCHTCHIAVKFSEIMTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  67

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK V+KKDPTG
Sbjct  68   TFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTG  102



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  241  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  300

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  301  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  335



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE+EPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEREPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  225  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKMIPTKPMVVE  284

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  285  TFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  319



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+P+KPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPSKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            G GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  142  GQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  201

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  202  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  236



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  353  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  412

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  413  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  447



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGD+GMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  239  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  298

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  299  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  333



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFQELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>sp|Q41011.1|EF1A_PEA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Pisum 
sativum]
 emb|CAA65391.1| elongation factor 1-alpha [Pisum sativum]
Length=447

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADW83729.1| elongation factor 1-alpha [Musa acuminata AAA Group]
Length=191

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            G GYAPVLDCH SHIAVKFAELLTKIDRRSGK LEKEPKFLKNGDAG VKM+P+KPMVVE
Sbjct  86   GIGYAPVLDCHASHIAVKFAELLTKIDRRSGKALEKEPKFLKNGDAGFVKMIPSKPMVVE  145

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  146  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  180



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIKNV+KK+PTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKEPTG  436



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  363  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  422

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  423  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  457



>gb|ACU31840.1| translation elongation factor 1 alpha, partial [Populus trichocarpa 
x Populus deltoides]
Length=106

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -1

Query  617  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  438
            GYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  1    GYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  60

Query  437  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            S YPPLGRFAVRDMRQTVA GVIK+V+KKDP+G
Sbjct  61   SAYPPLGRFAVRDMRQTVAXGVIKSVEKKDPSG  93



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSSYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  188  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  247

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  248  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  294  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  353

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  354  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAR82894.1| elongation factor 1-alpha [Cichorium intybus]
Length=448

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF  LLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  341  GNGYAPVLDCHTSHIAVKFQXLLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  400

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGV KNVDKKDPTG
Sbjct  401  TFAEYPPLGRFAVRDMRQTVAVGVTKNVDKKDPTG  435



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMMPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  294  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  353

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  354  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHT HIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTCHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVE
Sbjct  241  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVE  300

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  301  TFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  335



>ref|XP_010669658.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFAEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVE
Sbjct  320  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVE  379

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  380  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>gb|AFO68185.1| elongation factor 1A, partial [Anthurium andraeanum]
Length=101

 Score =   179 bits (453),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -1

Query  608  PVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEY  429
            PVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEY
Sbjct  1    PVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEY  60

Query  428  PPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            PPLGRFAVRDMRQTVAVGVIK V+KKDPTG
Sbjct  61   PPLGRFAVRDMRQTVAVGVIKAVEKKDPTG  90



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVK +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKVSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAV DMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVLDMRQTVAVGVIKSVEKKDPTG  436



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKE KFLKNGDAGMVKM+PTKPMVVE
Sbjct  343  GNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEAKFLKNGDAGMVKMIPTKPMVVE  402

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVG+IK+V+KKDPTG
Sbjct  403  TFSEYPPLGRFAVRDMRQTVAVGIIKSVEKKDPTG  437



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  293  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  352

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  353  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  387



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  341  GNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGYVKMIPTKPMVVE  400

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  401  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  435



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD +G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDASG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  233  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  292

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  342
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD +
Sbjct  293  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDAS  326



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMV M PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVMMTPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+P+KPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMVPSKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  402  TFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  623  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  444
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVE
Sbjct  342  GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVE  401

Query  443  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  339
            TFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  402  TFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950