BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050H15

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007026989.1|  Cell division protease ftsH isoform 1              227   1e-65   
emb|CDP06599.1|  unnamed protein product                                226   4e-65   Coffea canephora [robusta coffee]
ref|XP_009772661.1|  PREDICTED: ATP-dependent zinc metalloproteas...    223   5e-64   Nicotiana sylvestris
gb|KJB16964.1|  hypothetical protein B456_002G257200                    219   7e-63   Gossypium raimondii
ref|XP_009598017.1|  PREDICTED: ATP-dependent zinc metalloproteas...    219   9e-63   Nicotiana tomentosiformis
gb|KHG12964.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    218   2e-62   Gossypium arboreum [tree cotton]
ref|XP_006349501.1|  PREDICTED: ATP-dependent zinc metalloproteas...    216   3e-62   Solanum tuberosum [potatoes]
ref|XP_006349499.1|  PREDICTED: ATP-dependent zinc metalloproteas...    217   3e-62   Solanum tuberosum [potatoes]
ref|XP_006349500.1|  PREDICTED: ATP-dependent zinc metalloproteas...    216   3e-62   Solanum tuberosum [potatoes]
ref|XP_011094876.1|  PREDICTED: ATP-dependent zinc metalloproteas...    216   1e-61   Sesamum indicum [beniseed]
ref|XP_011094875.1|  PREDICTED: ATP-dependent zinc metalloproteas...    216   1e-61   Sesamum indicum [beniseed]
gb|KDP35648.1|  hypothetical protein JCGZ_09086                         214   4e-61   Jatropha curcas
gb|KDO51173.1|  hypothetical protein CISIN_1g005738mg                   213   5e-61   Citrus sinensis [apfelsine]
ref|XP_006480880.1|  PREDICTED: ATP-dependent zinc metalloproteas...    213   9e-61   
ref|XP_006429118.1|  hypothetical protein CICLE_v10011087mg             213   9e-61   Citrus clementina [clementine]
ref|XP_010262544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    213   1e-60   Nelumbo nucifera [Indian lotus]
gb|KJB55846.1|  hypothetical protein B456_009G097900                    213   1e-60   Gossypium raimondii
gb|KJB55847.1|  hypothetical protein B456_009G097900                    213   1e-60   Gossypium raimondii
ref|XP_008464106.1|  PREDICTED: ATP-dependent zinc metalloproteas...    213   2e-60   Cucumis melo [Oriental melon]
ref|XP_010256889.1|  PREDICTED: ATP-dependent zinc metalloproteas...    213   2e-60   Nelumbo nucifera [Indian lotus]
gb|AFX67028.1|  putative AAA-metalloprotease FtsH                       202   3e-60   Solanum tuberosum [potatoes]
ref|XP_002530989.1|  Mitochondrial respiratory chain complexes as...    212   4e-60   
ref|XP_002323508.2|  hypothetical protein POPTR_0016s10620g             211   7e-60   
ref|XP_003537985.1|  PREDICTED: ATP-dependent zinc metalloproteas...    211   1e-59   Glycine max [soybeans]
gb|KHG20351.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    211   1e-59   Gossypium arboreum [tree cotton]
gb|KHN21936.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    210   1e-59   Glycine soja [wild soybean]
gb|EYU41737.1|  hypothetical protein MIMGU_mgv1a001461mg                209   3e-59   Erythranthe guttata [common monkey flower]
ref|XP_011007151.1|  PREDICTED: ATP-dependent zinc metalloproteas...    208   4e-59   Populus euphratica
ref|XP_011007150.1|  PREDICTED: ATP-dependent zinc metalloproteas...    208   7e-59   Populus euphratica
ref|XP_007208082.1|  hypothetical protein PRUPE_ppa001525mg             207   2e-58   
ref|XP_009345397.1|  PREDICTED: ATP-dependent zinc metalloproteas...    207   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_009338598.1|  PREDICTED: ATP-dependent zinc metalloproteas...    207   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_004143122.1|  PREDICTED: ATP-dependent zinc metalloproteas...    206   3e-58   Cucumis sativus [cucumbers]
ref|XP_010106514.1|  ATP-dependent zinc metalloprotease FTSH 10         206   3e-58   Morus notabilis
ref|XP_008369915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    206   4e-58   
ref|XP_006592192.1|  PREDICTED: ATP-dependent zinc metalloproteas...    204   6e-58   
ref|XP_006592191.1|  PREDICTED: ATP-dependent zinc metalloproteas...    204   1e-57   Glycine max [soybeans]
gb|KHN32138.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    204   1e-57   Glycine soja [wild soybean]
gb|ABR26136.1|  osftsh8 - oryza sativa ftsh protease, homologue o...    191   1e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_003539663.1|  PREDICTED: ATP-dependent zinc metalloproteas...    204   1e-57   Glycine max [soybeans]
gb|KDO72822.1|  hypothetical protein CISIN_1g047690mg                   204   2e-57   Citrus sinensis [apfelsine]
ref|XP_008240759.1|  PREDICTED: ATP-dependent zinc metalloproteas...    204   2e-57   Prunus mume [ume]
ref|XP_004142062.1|  PREDICTED: ATP-dependent zinc metalloproteas...    204   2e-57   Cucumis sativus [cucumbers]
ref|XP_004164623.1|  PREDICTED: ATP-dependent zinc metalloproteas...    204   3e-57   
ref|XP_006349497.1|  PREDICTED: ATP-dependent zinc metalloproteas...    203   4e-57   Solanum tuberosum [potatoes]
ref|XP_006349498.1|  PREDICTED: ATP-dependent zinc metalloproteas...    203   4e-57   Solanum tuberosum [potatoes]
ref|XP_004249560.1|  PREDICTED: ATP-dependent zinc metalloproteas...    203   4e-57   Solanum lycopersicum
ref|XP_010312354.1|  PREDICTED: ATP-dependent zinc metalloproteas...    203   4e-57   Solanum lycopersicum
ref|XP_008448063.1|  PREDICTED: ATP-dependent zinc metalloproteas...    203   6e-57   Cucumis melo [Oriental melon]
ref|XP_008448079.1|  PREDICTED: ATP-dependent zinc metalloproteas...    202   6e-57   Cucumis melo [Oriental melon]
ref|XP_006488359.1|  PREDICTED: ATP-dependent zinc metalloproteas...    202   7e-57   Citrus sinensis [apfelsine]
ref|XP_006424865.1|  hypothetical protein CICLE_v10027837mg             202   7e-57   Citrus clementina [clementine]
ref|XP_006341014.1|  PREDICTED: ATP-dependent zinc metalloproteas...    202   7e-57   Solanum tuberosum [potatoes]
ref|XP_010043512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   8e-57   
ref|XP_007016370.1|  FTSH protease 10                                   202   1e-56   
ref|XP_010931245.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   1e-56   
ref|XP_002283273.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   2e-56   Vitis vinifera
gb|KCW85528.1|  hypothetical protein EUGRSUZ_B02325                     201   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010043511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   2e-56   Eucalyptus grandis [rose gum]
ref|XP_009384843.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008777200.1|  PREDICTED: ATP-dependent zinc metalloproteas...    199   3e-56   
ref|XP_009384842.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931243.1|  PREDICTED: ATP-dependent zinc metalloproteas...    200   4e-56   Elaeis guineensis
ref|XP_010931244.1|  PREDICTED: ATP-dependent zinc metalloproteas...    200   4e-56   Elaeis guineensis
ref|XP_008777193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    200   7e-56   Phoenix dactylifera
dbj|BAF01982.1|  hypothetical protein                                   186   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009600786.1|  PREDICTED: ATP-dependent zinc metalloproteas...    199   1e-55   Nicotiana tomentosiformis
ref|XP_003539662.1|  PREDICTED: ATP-dependent zinc metalloproteas...    199   1e-55   Glycine max [soybeans]
ref|XP_004246405.1|  PREDICTED: ATP-dependent zinc metalloproteas...    199   1e-55   Solanum lycopersicum
gb|AAK77908.1|AF397903_1  AAA-metalloprotease FtsH                      198   2e-55   Pisum sativum [garden pea]
ref|XP_009416148.1|  PREDICTED: ATP-dependent zinc metalloproteas...    198   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387530.1|  PREDICTED: ATP-dependent zinc metalloproteas...    197   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937593.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    197   4e-55   
gb|KHN32140.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    197   5e-55   Glycine soja [wild soybean]
gb|KFK32242.1|  hypothetical protein AALP_AA6G216200                    197   6e-55   Arabis alpina [alpine rockcress]
ref|XP_009375915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    197   6e-55   Pyrus x bretschneideri [bai li]
ref|XP_011089809.1|  PREDICTED: ATP-dependent zinc metalloproteas...    197   6e-55   Sesamum indicum [beniseed]
ref|XP_009140963.1|  PREDICTED: ATP-dependent zinc metalloproteas...    197   7e-55   Brassica rapa
ref|XP_009804923.1|  PREDICTED: ATP-dependent zinc metalloproteas...    196   1e-54   Nicotiana sylvestris
ref|XP_007207144.1|  hypothetical protein PRUPE_ppa001491mg             196   2e-54   Prunus persica
ref|XP_009364366.1|  PREDICTED: ATP-dependent zinc metalloproteas...    196   2e-54   Pyrus x bretschneideri [bai li]
gb|AAU44017.1|  putative AAA-metalloprotease FtsH (fragment)            191   3e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CDY31753.1|  BnaA04g16890D                                          195   3e-54   Brassica napus [oilseed rape]
gb|KFK43073.1|  hypothetical protein AALP_AA1G075200                    195   3e-54   Arabis alpina [alpine rockcress]
ref|XP_008384940.1|  PREDICTED: ATP-dependent zinc metalloproteas...    195   4e-54   
ref|XP_006417796.1|  hypothetical protein EUTSA_v10006814mg             195   4e-54   Eutrema salsugineum [saltwater cress]
emb|CDX77230.1|  BnaC04g40250D                                          194   4e-54   
ref|XP_004294648.1|  PREDICTED: ATP-dependent zinc metalloproteas...    194   5e-54   Fragaria vesca subsp. vesca
ref|XP_004961860.1|  PREDICTED: ATP-dependent zinc metalloproteas...    194   5e-54   Setaria italica
ref|XP_008359096.1|  PREDICTED: ATP-dependent zinc metalloproteas...    194   6e-54   
ref|XP_008222305.1|  PREDICTED: ATP-dependent zinc metalloproteas...    194   9e-54   Prunus mume [ume]
ref|XP_006293791.1|  hypothetical protein CARUB_v10022773mg             193   9e-54   
ref|XP_010487557.1|  PREDICTED: ATP-dependent zinc metalloproteas...    193   1e-53   
ref|XP_008356937.1|  PREDICTED: ATP-dependent zinc metalloproteas...    193   1e-53   Malus domestica [apple tree]
ref|XP_010487541.1|  PREDICTED: ATP-dependent zinc metalloproteas...    193   2e-53   Camelina sativa [gold-of-pleasure]
gb|KDP42240.1|  hypothetical protein JCGZ_02970                         193   2e-53   Jatropha curcas
ref|XP_010475511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    193   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010475512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    193   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010043509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    193   2e-53   Eucalyptus grandis [rose gum]
gb|KCW85527.1|  hypothetical protein EUGRSUZ_B02324                     192   2e-53   Eucalyptus grandis [rose gum]
ref|XP_010043510.1|  PREDICTED: ATP-dependent zinc metalloproteas...    192   3e-53   Eucalyptus grandis [rose gum]
ref|XP_010920548.1|  PREDICTED: ATP-dependent zinc metalloproteas...    192   3e-53   Elaeis guineensis
ref|XP_010685724.1|  PREDICTED: ATP-dependent zinc metalloproteas...    192   3e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009781386.1|  PREDICTED: ATP-dependent zinc metalloproteas...    192   5e-53   Nicotiana sylvestris
ref|XP_010469994.1|  PREDICTED: ATP-dependent zinc metalloproteas...    191   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004302718.2|  PREDICTED: ATP-dependent zinc metalloproteas...    191   7e-53   Fragaria vesca subsp. vesca
ref|NP_001055745.1|  Os05g0458400                                       191   7e-53   
gb|EEC79350.1|  hypothetical protein OsI_20217                          191   9e-53   Oryza sativa Indica Group [Indian rice]
gb|EEE63976.1|  hypothetical protein OsJ_18802                          191   1e-52   Oryza sativa Japonica Group [Japonica rice]
gb|ACN36802.1|  unknown                                                 186   1e-52   Zea mays [maize]
ref|XP_010414442.1|  PREDICTED: ATP-dependent zinc metalloproteas...    191   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002439915.1|  hypothetical protein SORBIDRAFT_09g022490          190   1e-52   Sorghum bicolor [broomcorn]
ref|XP_003568313.1|  PREDICTED: ATP-dependent zinc metalloproteas...    190   1e-52   Brachypodium distachyon [annual false brome]
ref|XP_010521866.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_010521865.1|  PREDICTED: ATP-dependent zinc metalloproteas...    190   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_002881027.1|  hypothetical protein ARALYDRAFT_344684             190   2e-52   
ref|XP_009611240.1|  PREDICTED: ATP-dependent zinc metalloproteas...    190   2e-52   Nicotiana tomentosiformis
ref|XP_010542637.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   3e-52   Tarenaya hassleriana [spider flower]
ref|XP_006306790.1|  hypothetical protein CARUB_v10008328mg             189   4e-52   Capsella rubella
emb|CBI30537.3|  unnamed protein product                                180   4e-52   Vitis vinifera
ref|XP_003606687.1|  Cell division protease ftsH-like protein           189   4e-52   Medicago truncatula
ref|XP_010510537.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002313426.1|  FtsH protease family protein                       189   5e-52   
gb|AFW82207.1|  hypothetical protein ZEAMMB73_958383                    188   7e-52   
ref|NP_850129.1|  FTSH protease 3                                       188   9e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAL36270.1|  putative AAA-type ATPase                                188   9e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAC33234.1|  putative AAA-type ATPase                                188   9e-52   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98430.1|  AAA-type like ATPase                                   181   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007133225.1|  hypothetical protein PHAVU_011G162000g             187   1e-51   Phaseolus vulgaris [French bean]
ref|NP_172231.2|  FTSH protease 10                                      187   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79577.1|AC022464_35  F22G5.10                                     188   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118433.1|  PREDICTED: ATP-dependent zinc metalloproteas...    187   2e-51   Brassica rapa
emb|CDP09082.1|  unnamed protein product                                187   2e-51   Coffea canephora [robusta coffee]
emb|CDY39531.1|  BnaC04g15300D                                          187   2e-51   Brassica napus [oilseed rape]
ref|XP_009125053.1|  PREDICTED: ATP-dependent zinc metalloproteas...    187   3e-51   Brassica rapa
ref|XP_006409951.1|  hypothetical protein EUTSA_v10016261mg             186   3e-51   Eutrema salsugineum [saltwater cress]
emb|CDY47876.1|  BnaA07g14210D                                          186   4e-51   Brassica napus [oilseed rape]
ref|XP_006655377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    186   6e-51   
ref|XP_002889652.1|  FTSH10                                             185   1e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_008799731.1|  PREDICTED: ATP-dependent zinc metalloproteas...    185   1e-50   Phoenix dactylifera
ref|XP_011032280.1|  PREDICTED: ATP-dependent zinc metalloproteas...    185   1e-50   Populus euphratica
ref|XP_004970544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    183   4e-50   Setaria italica
ref|XP_003567261.1|  PREDICTED: ATP-dependent zinc metalloproteas...    182   5e-50   
ref|XP_004507174.1|  PREDICTED: ATP-dependent zinc metalloproteas...    183   5e-50   Cicer arietinum [garbanzo]
emb|CDY09913.1|  BnaC08g45380D                                          183   6e-50   Brassica napus [oilseed rape]
ref|XP_006644995.1|  PREDICTED: ATP-dependent zinc metalloproteas...    182   1e-49   Oryza brachyantha
ref|XP_008784613.1|  PREDICTED: ATP-dependent zinc metalloproteas...    182   2e-49   Phoenix dactylifera
ref|NP_001044774.1|  Os01g0842600                                       181   3e-49   
gb|EAY76461.1|  hypothetical protein OsI_04395                          181   4e-49   Oryza sativa Indica Group [Indian rice]
dbj|BAJ98147.1|  predicted protein                                      181   5e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006845226.1|  hypothetical protein AMTR_s00005p00256120          179   1e-48   Amborella trichopoda
ref|XP_007132051.1|  hypothetical protein PHAVU_011G062800g             179   2e-48   Phaseolus vulgaris [French bean]
gb|KJB16965.1|  hypothetical protein B456_002G257200                    178   3e-48   Gossypium raimondii
gb|EYU38460.1|  hypothetical protein MIMGU_mgv1a001496mg                178   4e-48   Erythranthe guttata [common monkey flower]
ref|XP_002458748.1|  hypothetical protein SORBIDRAFT_03g039540          177   1e-47   Sorghum bicolor [broomcorn]
gb|EMS50561.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    176   1e-47   Triticum urartu
gb|KJB36698.1|  hypothetical protein B456_006G171800                    174   3e-47   Gossypium raimondii
gb|EMT04659.1|  Cell division protease ftsH-like protein, mitocho...    174   4e-47   
ref|XP_008358519.1|  PREDICTED: ATP-dependent zinc metalloproteas...    171   1e-45   
emb|CDM84966.1|  unnamed protein product                                169   3e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001785268.1|  predicted protein                                  168   6e-45   
gb|EPS71434.1|  hypothetical protein M569_03325                         168   1e-44   Genlisea aurea
gb|EMT07840.1|  Cell division protease ftsH-like protein, mitocho...    169   1e-44   
gb|EMS48627.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    168   2e-44   Triticum urartu
gb|KEH23850.1|  ATP-dependent zinc metalloprotease FTSH protein         157   5e-41   Medicago truncatula
ref|XP_001782950.1|  predicted protein                                  159   5e-41   
ref|NP_001145329.1|  uncharacterized protein LOC100278654               155   6e-41   
ref|XP_006845235.1|  hypothetical protein AMTR_s00005p00257870          153   1e-40   
ref|XP_001759881.1|  predicted protein                                  154   6e-40   
gb|AES75793.2|  ATP-dependent zinc metalloprotease FTSH protein         147   1e-37   Medicago truncatula
ref|XP_003619575.1|  Cell division protease ftsH-like protein           147   4e-37   
ref|XP_003624038.1|  Cell division protease ftsH-like protein           144   3e-36   
ref|XP_006845231.1|  hypothetical protein AMTR_s00005p00257390          138   1e-34   
ref|XP_002981661.1|  hypothetical protein SELMODRAFT_115113             137   1e-33   
ref|XP_002967857.1|  hypothetical protein SELMODRAFT_169256             137   2e-33   
emb|CDY48537.1|  BnaC04g43120D                                          126   3e-33   Brassica napus [oilseed rape]
ref|XP_003631103.1|  Cell division protease ftsH-like protein           131   2e-32   
gb|KEH16019.1|  ATP-dependent zinc metalloprotease FTSH protein         126   2e-30   Medicago truncatula
ref|XP_002980658.1|  hypothetical protein SELMODRAFT_233533             123   3e-29   
ref|XP_002984562.1|  hypothetical protein SELMODRAFT_234574             123   3e-29   
gb|KHG19679.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    121   1e-28   Gossypium arboreum [tree cotton]
ref|XP_005651157.1|  ATP-dependent metallopeptidase Hfl                 120   1e-27   Coccomyxa subellipsoidea C-169
gb|AIE43895.1|  WRKY transcription factor 38                            119   5e-27   Gossypium hirsutum [American cotton]
ref|XP_002505472.1|  predicted protein                                  112   7e-25   Micromonas commoda
ref|XP_011400128.1|  ATP-dependent zinc metalloprotease FTSH 10, ...    112   2e-24   Auxenochlorella protothecoides
ref|XP_005850885.1|  hypothetical protein CHLNCDRAFT_140544             110   5e-24   Chlorella variabilis
ref|XP_002741203.1|  PREDICTED: AFG3-like protein 2                     107   3e-23   Saccoglossus kowalevskii
ref|XP_003082962.1|  FtsH protease, putative (ISS)                      107   4e-23   Ostreococcus tauri
ref|XP_007509883.1|  predicted protein                                  107   5e-23   Bathycoccus prasinos
ref|XP_001422694.1|  predicted protein                                  105   6e-23   Ostreococcus lucimarinus CCE9901
gb|ETO21279.1|  hypothetical protein RFI_15925                          102   1e-22   Reticulomyxa filosa
ref|XP_001689949.1|  membrane AAA-metalloprotease                       105   3e-22   Chlamydomonas reinhardtii
emb|CDS28120.1|  afg3 protein 2                                         103   1e-21   Hymenolepis microstoma
gb|ETO15947.1|  hypothetical protein RFI_21410                          103   1e-21   Reticulomyxa filosa
gb|EUB61794.1|  AFG3-like protein 2                                     103   2e-21   Echinococcus granulosus
ref|XP_011407709.1|  PREDICTED: AFG3-like protein 2                     102   2e-21   Amphimedon queenslandica
ref|XP_010774059.1|  PREDICTED: AFG3-like protein 2                   97.4    2e-21   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010747102.1|  PREDICTED: AFG3-like protein 1 isoform X1          102   3e-21   
ref|XP_010747103.1|  PREDICTED: AFG3-like protein 1 isoform X2          102   3e-21   
emb|CDJ01436.1|  afg3 protein 2                                         102   3e-21   
ref|XP_002956710.1|  hypothetical protein VOLCADRAFT_107358           99.0    4e-21   Volvox carteri f. nagariensis
ref|XP_002410299.1|  ATPase, putative                                 99.0    5e-21   
dbj|GAM28243.1|  hypothetical protein SAMD00019534_114190               101   6e-21   Acytostelium subglobosum LB1
ref|XP_003383809.1|  PREDICTED: AFG3-like protein 2                     101   6e-21   Amphimedon queenslandica
ref|XP_003059742.1|  predicted protein                                  100   7e-21   Micromonas pusilla CCMP1545
gb|AAH91419.1|  Afg3l2 protein                                        95.9    7e-21   Rattus norvegicus [brown rat]
gb|AAH22577.1|  Afg3l2 protein                                        95.9    8e-21   Mus musculus [mouse]
gb|EGI59447.1|  AFG3-like protein 2                                     100   9e-21   Acromyrmex echinatior
ref|XP_011064066.1|  PREDICTED: AFG3-like protein 2 isoform X1          100   1e-20   Acromyrmex echinatior
ref|XP_011064067.1|  PREDICTED: AFG3-like protein 2 isoform X2          100   1e-20   Acromyrmex echinatior
ref|XP_005706412.1|  AAA-type ATPase                                    100   2e-20   Galdieria sulphuraria
ref|XP_008309809.1|  PREDICTED: AFG3-like protein 1                     100   2e-20   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_783782.2|  PREDICTED: AFG3-like protein 2                        100   2e-20   
ref|XP_008191461.1|  PREDICTED: AFG3-like protein 2                   99.8    2e-20   Tribolium castaneum [rust-red flour beetle]
gb|EXX70583.1|  m-AAA protease subunit YTA12                          99.8    2e-20   Rhizophagus irregularis DAOM 197198w
ref|WP_018336842.1|  peptidase M41                                    99.4    2e-20   Butyricimonas synergistica
emb|CDQ93828.1|  unnamed protein product                              95.5    3e-20   Oncorhynchus mykiss
ref|XP_638674.1|  peptidase M41, FtsH domain-containing protein       99.4    3e-20   Dictyostelium discoideum AX4
ref|XP_003967322.1|  PREDICTED: AFG3-like protein 2-like              99.4    3e-20   
ref|XP_011160232.1|  PREDICTED: AFG3-like protein 2 isoform X2        99.4    3e-20   Solenopsis invicta [imported red fire ant]
ref|XP_011160223.1|  PREDICTED: AFG3-like protein 2 isoform X1        99.4    3e-20   Solenopsis invicta [imported red fire ant]
gb|ESA05195.1|  hypothetical protein GLOINDRAFT_66340                 99.0    3e-20   
ref|XP_005816528.1|  PREDICTED: AFG3-like protein 1-like              99.0    3e-20   
dbj|GAN02747.1|  ATP-dependent metallopeptidase Hfl                   99.0    4e-20   Mucor ambiguus
gb|KDR07700.1|  AFG3-like protein 2                                   99.0    4e-20   Zootermopsis nevadensis
ref|XP_008408894.1|  PREDICTED: AFG3-like protein 1 isoform X1        98.6    5e-20   Poecilia reticulata
ref|WP_041883641.1|  peptidase M41                                    98.6    5e-20   Pedobacter lusitanus
gb|EMP33437.1|  AFG3-like protein 2                                   93.6    5e-20   Chelonia mydas [green seaturtle]
gb|EIE80123.1|  hypothetical protein RO3G_04828                       98.2    6e-20   Rhizopus delemar RA 99-880
ref|XP_005770144.1|  ATP-dependent metalloprotease FtsH               97.4    7e-20   Emiliania huxleyi CCMP1516
ref|XP_004362632.1|  peptidase M41                                    98.6    8e-20   Cavenderia fasciculata
ref|XP_006612551.1|  PREDICTED: AFG3-like protein 2-like              98.2    8e-20   Apis dorsata [rock honeybee]
gb|ELT94890.1|  hypothetical protein CAPTEDRAFT_177529                98.2    9e-20   Capitella teleta
gb|EPB90189.1|  AFG3 family protein                                   97.8    9e-20   Mucor circinelloides f. circinelloides 1006PhL
emb|CEI94349.1|  Putative AFG3 family protein                         97.8    9e-20   Rhizopus microsporus
ref|XP_001956786.1|  GF24400                                          97.8    1e-19   Drosophila ananassae
ref|XP_003979383.1|  PREDICTED: AFG3-like protein 2-like              95.1    1e-19   
emb|CEJ01398.1|  Putative Cell division protease ftsH                 97.8    1e-19   Rhizopus microsporus
ref|XP_003693602.1|  PREDICTED: AFG3-like protein 2-like              97.8    1e-19   Apis florea [dwarf honeybee]
ref|XP_624548.2|  PREDICTED: AFG3-like protein 2-like                 97.8    1e-19   Apis mellifera [bee]
ref|XP_004566226.1|  PREDICTED: AFG3-like protein 1-like              97.4    1e-19   Maylandia zebra
ref|XP_005946781.1|  PREDICTED: AFG3-like protein 1-like              97.4    1e-19   Haplochromis burtoni
ref|XP_005748823.1|  PREDICTED: AFG3-like protein 1-like              97.4    1e-19   Pundamilia nyererei
ref|WP_037533932.1|  peptidase M41                                    97.1    1e-19   Sphingobacterium thalpophilum
ref|XP_001744500.1|  hypothetical protein                             97.1    2e-19   Monosiga brevicollis MX1
ref|WP_041502017.1|  MULTISPECIES: cell division protein FtsH         97.1    2e-19   Porphyromonadaceae
emb|CAF92797.1|  unnamed protein product                              97.1    2e-19   Tetraodon nigroviridis
ref|XP_006805466.1|  PREDICTED: AFG3-like protein 1-like              97.1    2e-19   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003737319.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  96.7    2e-19   
ref|WP_037443193.1|  peptidase M41                                    96.7    2e-19   Pedobacter antarcticus
dbj|GAA31340.2|  AFG3 family protein                                  97.1    2e-19   Clonorchis sinensis [oriental liver fluke]
ref|XP_008286028.1|  PREDICTED: AFG3-like protein 1                   96.7    2e-19   Stegastes partitus
emb|CEG68111.1|  Putative Cell division protease ftsH                 96.7    2e-19   Rhizopus microsporus
gb|AFM03376.1|  membrane protease FtsH catalytic subunit              96.7    2e-19   Bernardetia litoralis DSM 6794
emb|CEG68110.1|  Putative YALI0A10615p                                96.7    2e-19   Rhizopus microsporus
ref|XP_011254538.1|  PREDICTED: AFG3-like protein 2 isoform X2        96.7    2e-19   
ref|XP_003292084.1|  hypothetical protein DICPUDRAFT_39991            95.5    2e-19   Dictyostelium purpureum
ref|XP_011254537.1|  PREDICTED: AFG3-like protein 2 isoform X1        96.7    3e-19   Camponotus floridanus
ref|XP_002030868.1|  GM24348                                          96.3    3e-19   Drosophila sechellia
ref|XP_005182326.1|  PREDICTED: AFG3-like protein 2                   96.3    3e-19   Musca domestica
ref|XP_007568550.1|  PREDICTED: AFG3-like protein 1                   96.3    3e-19   Poecilia formosa
gb|EPB86387.1|  AFG3 family protein                                   96.3    3e-19   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006641297.1|  PREDICTED: AFG3-like protein 1-like              96.3    3e-19   
ref|XP_005100797.1|  PREDICTED: AFG3-like protein 2-like              96.3    3e-19   Aplysia californica
ref|XP_002085240.1|  GD12422                                          96.3    4e-19   Drosophila simulans
ref|XP_004656566.1|  PREDICTED: AFG3-like protein 2                   96.3    4e-19   
ref|XP_003439591.1|  PREDICTED: AFG3-like protein 1-like              95.9    4e-19   Oreochromis niloticus
dbj|GAN09452.1|  ATP-dependent metallopeptidase Hfl                   95.9    5e-19   Mucor ambiguus
dbj|GAL71617.1|  cell division protein FtsH                           90.1    5e-19   Jejuia pallidilutea
ref|WP_013664355.1|  peptidase M41                                    95.5    5e-19   Sphingobacterium sp. 21
gb|EFA84387.1|  peptidase M41                                         95.5    6e-19   Heterostelium album PN500
ref|NP_730250.1|  CG6512, isoform B                                   95.5    6e-19   Drosophila melanogaster
ref|NP_730248.2|  CG6512, isoform A                                   95.5    6e-19   Drosophila melanogaster
gb|KHJ47643.1|  ATP-dependent metallopeptidase HflB                   95.5    6e-19   Trichuris suis
ref|XP_005946480.1|  PREDICTED: AFG3-like protein 2-like isoform X3   95.5    6e-19   Haplochromis burtoni
ref|XP_005946478.1|  PREDICTED: AFG3-like protein 2-like isoform X1   95.5    6e-19   Haplochromis burtoni
ref|XP_005946479.1|  PREDICTED: AFG3-like protein 2-like isoform X2   95.5    6e-19   Haplochromis burtoni
dbj|GAN09644.1|  ATP-dependent metallopeptidase Hfl                   95.5    7e-19   Mucor ambiguus
ref|XP_010637318.1|  PREDICTED: AFG3-like protein 2 isoform X2        94.7    7e-19   Fukomys damarensis [Damara mole rat]
ref|XP_011484595.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  95.1    7e-19   
ref|XP_001632616.1|  predicted protein                                94.7    7e-19   
ref|WP_039053642.1|  peptidase M41                                    94.7    8e-19   
ref|XP_003487066.1|  PREDICTED: AFG3-like protein 2-like              95.1    8e-19   
ref|WP_041264331.1|  peptidase M41                                    94.7    8e-19   
ref|XP_004853318.1|  PREDICTED: AFG3-like protein 2 isoform X2        94.7    8e-19   
ref|WP_027202918.1|  cell division protein FtsH                       94.7    9e-19   
ref|WP_037497088.1|  peptidase M41                                    94.7    9e-19   
ref|XP_011300136.1|  PREDICTED: AFG3-like protein 2                   95.1    9e-19   
emb|CDS12867.1|  hypothetical protein LRAMOSA05051                    94.7    1e-18   
ref|XP_003396802.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  95.1    1e-18   
gb|EFZ22674.1|  hypothetical protein SINV_06415                       94.7    1e-18   
gb|EHH60668.1|  hypothetical protein EGM_12089                        94.4    1e-18   
gb|EQB80316.1|  hypothetical protein L950_08340                       94.0    1e-18   
ref|WP_021069372.1|  peptidase M41                                    94.4    1e-18   
ref|WP_043706423.1|  peptidase M41                                    94.0    2e-18   
ref|XP_007517251.1|  PREDICTED: AFG3-like protein 2                   94.4    2e-18   
gb|EIE90722.1|  hypothetical protein RO3G_15433                       94.4    2e-18   
ref|XP_006807100.1|  PREDICTED: AFG3-like protein 2-like              93.6    2e-18   
ref|XP_010146788.1|  PREDICTED: AFG3-like protein 2                   89.7    2e-18   
gb|EFN79635.1|  AFG3-like protein 2                                   92.4    2e-18   
ref|XP_004989050.1|  AFG3-like protein 2                              94.4    2e-18   
ref|XP_010637317.1|  PREDICTED: AFG3-like protein 2 isoform X1        94.0    2e-18   
ref|XP_001354111.1|  GA19652                                          94.0    2e-18   
ref|XP_005476931.1|  PREDICTED: AFG3-like protein 2 isoform X2        94.0    2e-18   
ref|XP_005476933.1|  PREDICTED: AFG3-like protein 2 isoform X4        94.0    2e-18   
emb|CEG83210.1|  Putative AFG3 family protein                         93.2    2e-18   
ref|XP_005476932.1|  PREDICTED: AFG3-like protein 2 isoform X3        94.0    2e-18   
ref|XP_005476934.1|  PREDICTED: AFG3-like protein 2 isoform X5        94.0    2e-18   
ref|XP_003924961.2|  PREDICTED: AFG3-like protein 2 isoform X2        94.0    2e-18   
ref|XP_008467468.1|  PREDICTED: AFG3-like protein 2                   94.0    2e-18   
gb|KFO26923.1|  AFG3-like protein 2                                   94.0    2e-18   
ref|XP_011245300.1|  PREDICTED: AFG3-like protein 2 isoform X1        94.0    2e-18   
ref|XP_003707659.1|  PREDICTED: AFG3-like protein 2-like              94.0    2e-18   
ref|XP_004572477.1|  PREDICTED: AFG3-like protein 2-like              94.0    2e-18   
emb|CEP09595.1|  hypothetical protein                                 93.6    2e-18   
ref|XP_009061516.1|  hypothetical protein LOTGIDRAFT_127065           93.6    2e-18   
ref|XP_010333888.1|  PREDICTED: AFG3-like protein 2 isoform X1        94.0    2e-18   
emb|CEP11573.1|  hypothetical protein                                 94.0    2e-18   
ref|XP_005752595.1|  PREDICTED: AFG3-like protein 2-like              94.0    2e-18   
ref|XP_008299957.1|  PREDICTED: AFG3-like protein 2                   94.0    2e-18   
ref|XP_003458166.1|  PREDICTED: AFG3-like protein 2 isoform X1        94.0    2e-18   
emb|CCD81709.1|  Afg3-like protein 2 (M41 family)                     93.6    2e-18   
ref|WP_040539886.1|  peptidase M41                                    93.6    2e-18   
ref|WP_044224255.1|  peptidase M41                                    93.6    2e-18   
ref|XP_004903784.1|  PREDICTED: AFG3-like protein 2                   93.6    3e-18   
ref|XP_005999264.1|  PREDICTED: AFG3-like protein 1-like              93.6    3e-18   
dbj|BAE29204.1|  unnamed protein product                              93.6    3e-18   
gb|EHB14938.1|  AFG3-like protein 2                                   93.6    3e-18   
ref|NP_001104667.1|  AFG3-like protein 2                              93.6    3e-18   
ref|XP_008049841.1|  PREDICTED: AFG3-like protein 2                   93.2    3e-18   
ref|XP_008977688.1|  PREDICTED: AFG3-like protein 2 isoform X2        93.6    3e-18   
emb|CDS03562.1|  hypothetical protein LRAMOSA00964                    93.6    3e-18   
ref|XP_004526190.1|  PREDICTED: AFG3-like protein 2-like isoform X1   93.6    3e-18   
ref|XP_002757077.1|  PREDICTED: AFG3-like protein 2 isoform X1        93.6    3e-18   
ref|XP_011235404.1|  PREDICTED: AFG3-like protein 2                   93.6    3e-18   
gb|EFB23538.1|  hypothetical protein PANDA_019250                     93.6    3e-18   
gb|EDL09647.1|  mCG127904                                             93.2    3e-18   
ref|XP_001950696.1|  PREDICTED: AFG3-like protein 2                   93.6    3e-18   
ref|WP_038701774.1|  peptidase M41                                    93.2    3e-18   
ref|XP_002095038.1|  GE22168                                          93.6    3e-18   
gb|EDM14729.1|  AFG3(ATPase family gene 3)-like 2 (yeast)             93.2    3e-18   
gb|EGW00718.1|  AFG3-like protein 2                                   92.4    3e-18   
ref|XP_010956423.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  93.2    3e-18   
ref|XP_003464473.2|  PREDICTED: AFG3-like protein 2                   93.2    3e-18   
ref|XP_001972966.1|  GG15828                                          93.2    3e-18   
ref|NP_081406.1|  AFG3-like protein 2                                 93.2    4e-18   
ref|NP_001128336.1|  AFG3-like protein 2                              93.2    4e-18   
ref|XP_008552422.1|  PREDICTED: AFG3-like protein 2                   93.2    4e-18   
ref|XP_005372622.1|  PREDICTED: AFG3-like protein 2 isoform X3        93.2    4e-18   
ref|XP_005372621.1|  PREDICTED: AFG3-like protein 2 isoform X2        93.2    4e-18   
ref|XP_005969601.1|  PREDICTED: AFG3-like protein 2                   93.2    4e-18   
ref|XP_010223803.1|  PREDICTED: AFG3-like protein 2                   93.2    4e-18   
ref|XP_005372620.1|  PREDICTED: AFG3-like protein 2 isoform X1        93.2    4e-18   
ref|WP_039990218.1|  peptidase M41                                    92.8    4e-18   
ref|WP_037460377.1|  peptidase M41                                    92.8    5e-18   
gb|KGL73505.1|  AFG3-like 2                                           92.8    5e-18   
ref|XP_007531819.1|  PREDICTED: AFG3-like protein 1                   92.8    5e-18   
ref|XP_001518600.2|  PREDICTED: AFG3-like protein 2                   89.4    5e-18   
ref|WP_014682322.1|  peptidase M41                                    92.8    5e-18   
ref|WP_012780210.1|  peptidase M41                                    92.8    5e-18   
ref|XP_010374004.1|  PREDICTED: AFG3-like protein 2                   92.8    5e-18   
ref|XP_004684027.1|  PREDICTED: AFG3-like protein 2                   92.8    5e-18   
ref|WP_008241678.1|  peptidase M41                                    92.8    5e-18   
gb|EFK59817.1|  ATP-dependent metallopeptidase HflB                   92.4    5e-18   
gb|EEI91234.1|  ATP-dependent metallopeptidase HflB                   92.4    5e-18   
ref|XP_007109863.1|  PREDICTED: AFG3-like protein 2                   92.4    5e-18   
ref|XP_002115797.1|  hypothetical protein TRIADDRAFT_30182            92.8    6e-18   
ref|XP_008580361.1|  PREDICTED: AFG3-like protein 2                   92.8    6e-18   
ref|XP_004581871.1|  PREDICTED: AFG3-like protein 2                   92.8    6e-18   
ref|WP_026897433.1|  peptidase M41                                    92.4    6e-18   
ref|XP_002068945.1|  GK18042                                          92.8    6e-18   
gb|EAX01551.1|  AFG3 ATPase family gene 3-like 2 (yeast), isoform...  92.4    6e-18   
ref|XP_010857368.1|  PREDICTED: AFG3-like protein 2 isoform X3        92.4    6e-18   
gb|EFX85159.1|  hypothetical protein DAPPUDRAFT_194014                92.0    6e-18   
gb|KGB42039.1|  AFG3-like protein 2                                   92.0    7e-18   
gb|EHH29159.1|  AFG3-like protein 2                                   92.4    7e-18   
ref|XP_010857367.1|  PREDICTED: AFG3-like protein 2 isoform X2        92.4    7e-18   
ref|XP_011337563.1|  PREDICTED: AFG3-like protein 2                   92.4    7e-18   
ref|XP_004069425.1|  PREDICTED: AFG3-like protein 1                   92.4    7e-18   
ref|XP_006164216.1|  PREDICTED: AFG3-like protein 2                   92.4    7e-18   
emb|CDQ84917.1|  unnamed protein product                              92.4    7e-18   
ref|XP_003276764.2|  PREDICTED: AFG3-like protein 2                   92.4    7e-18   
gb|AAH24282.1|  Similar to AFG3 ATPase family gene 3-like 2 (yeast)   92.4    7e-18   
gb|KFH71888.1|  AFG3 family protein                                   92.4    7e-18   
ref|XP_010857366.1|  PREDICTED: AFG3-like protein 2 isoform X1        92.4    7e-18   
gb|ELK30619.1|  AFG3-like protein 2                                   92.4    7e-18   
ref|XP_003461259.2|  PREDICTED: AFG3-like protein 1-like              92.4    7e-18   
ref|NP_001072759.1|  AFG3-like AAA ATPase 2                           92.4    7e-18   
gb|ELR58811.1|  AFG3-like protein 2                                   92.4    7e-18   
ref|XP_011201975.1|  PREDICTED: AFG3-like protein 2                   92.4    7e-18   
ref|XP_004649068.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3 ATPase ...  92.4    8e-18   
ref|XP_003800531.1|  PREDICTED: AFG3-like protein 2                   92.4    8e-18   
emb|CEI95939.1|  Putative Mitochondrial inner membrane AAA protea...  92.0    8e-18   
ref|NP_006787.2|  AFG3-like protein 2                                 92.4    8e-18   
ref|XP_005892435.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  92.0    8e-18   
ref|XP_007236622.1|  PREDICTED: AFG3-like protein 2-like              92.0    8e-18   
ref|XP_005587287.1|  PREDICTED: AFG3-like protein 2 isoform X2        92.0    8e-18   
ref|XP_007463350.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  92.0    8e-18   
ref|XP_006008878.1|  PREDICTED: AFG3-like protein 2 isoform X1        92.0    8e-18   
ref|XP_512199.2|  PREDICTED: AFG3-like protein 2                      92.0    8e-18   
ref|XP_006763325.1|  PREDICTED: AFG3-like protein 2 isoform X2        92.0    8e-18   
ref|XP_004020561.1|  PREDICTED: AFG3-like protein 2                   92.0    8e-18   
ref|XP_005334950.1|  PREDICTED: AFG3-like protein 2                   92.0    8e-18   
ref|XP_007085973.1|  PREDICTED: AFG3-like protein 2                   92.0    8e-18   
ref|XP_001094146.1|  PREDICTED: AFG3 ATPase family gene 3-like 2 ...  92.0    8e-18   
emb|CAB48398.1|  paraplegin-like protein                              92.0    9e-18   
ref|XP_002828063.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|XP_009190611.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|XP_007643641.1|  PREDICTED: AFG3-like protein 2 isoform X1        92.0    9e-18   
ref|XP_004421113.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|XP_005587286.1|  PREDICTED: AFG3-like protein 2 isoform X1        92.0    9e-18   
ref|XP_011286260.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|NP_001039676.1|  AFG3-like protein 2                              92.0    9e-18   
ref|XP_006043088.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|XP_008527813.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|XP_008700356.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|XP_004408531.1|  PREDICTED: AFG3-like protein 2                   92.0    9e-18   
ref|XP_006008879.1|  PREDICTED: AFG3-like protein 2 isoform X2        92.0    9e-18   
ref|XP_006763324.1|  PREDICTED: AFG3-like protein 2 isoform X1        92.0    9e-18   
emb|CEG69908.1|  Putative Mitochondrial inner membrane AAA protea...  92.0    9e-18   
ref|XP_004470052.1|  PREDICTED: AFG3-like protein 2-like              92.0    9e-18   
dbj|BAB28211.3|  unnamed protein product                              87.8    9e-18   
emb|CDT09988.1|  ATP-dependent zinc metalloprotease FtsH              91.7    9e-18   
ref|XP_007633119.1|  PREDICTED: AFG3-like protein 2 isoform X2        92.0    1e-17   
ref|WP_039450881.1|  peptidase M41                                    91.7    1e-17   
ref|XP_011146865.1|  PREDICTED: AFG3-like protein 2                   92.0    1e-17   
gb|EPB89883.1|  AFG3 family protein                                   92.0    1e-17   
dbj|BAE30959.1|  unnamed protein product                              92.0    1e-17   
ref|XP_007244085.1|  PREDICTED: AFG3-like protein 1-like              92.0    1e-17   
ref|XP_009698917.1|  PREDICTED: AFG3-like protein 2                   88.6    1e-17   
ref|XP_005282733.1|  PREDICTED: AFG3-like protein 2 isoform X1        92.0    1e-17   
gb|EPQ08204.1|  AFG3-like protein 2                                   92.0    1e-17   
ref|XP_005866972.1|  PREDICTED: AFG3-like protein 2 isoform X3        91.7    1e-17   
ref|XP_005074768.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
ref|XP_006897077.1|  PREDICTED: AFG3-like protein 2-like              92.0    1e-17   
ref|XP_008162617.1|  PREDICTED: AFG3-like protein 2 isoform X2        92.0    1e-17   
ref|XP_005866970.1|  PREDICTED: AFG3-like protein 2 isoform X1        91.7    1e-17   
ref|XP_004742741.1|  PREDICTED: AFG3-like protein 2                   92.0    1e-17   
ref|XP_005866971.1|  PREDICTED: AFG3-like protein 2 isoform X2        91.7    1e-17   
gb|EPY79354.1|  AFG3-like protein                                     91.7    1e-17   
ref|XP_008157913.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
ref|XP_002132138.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
emb|CEI89004.1|  Putative Matrix AAA protease MAP-1                   91.7    1e-17   
ref|WP_010180173.1|  peptidase M41                                    91.3    1e-17   
ref|XP_006970131.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
ref|XP_004059249.1|  PREDICTED: AFG3-like protein 2                   92.0    1e-17   
ref|XP_007196273.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  91.7    1e-17   
ref|XP_006213680.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
ref|XP_005697290.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
ref|XP_011379633.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
gb|AAC27764.1|  RcaA                                                  89.0    1e-17   
gb|ERL87558.1|  hypothetical protein D910_04949                       90.5    1e-17   
gb|ELK15046.1|  AFG3-like protein 2                                   91.7    1e-17   
gb|ERE86162.1|  AFG3-like protein 2                                   91.7    1e-17   
ref|XP_003482084.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  90.9    1e-17   
ref|XP_007062432.1|  PREDICTED: AFG3-like protein 2                   91.7    1e-17   
gb|ETN66093.1|  paraplegin                                            91.7    1e-17   
ref|XP_006117557.1|  PREDICTED: AFG3-like protein 2 isoform X2        91.7    1e-17   
emb|CDS05549.1|  hypothetical protein LRAMOSA08077                    91.3    1e-17   
ref|XP_006117556.1|  PREDICTED: AFG3-like protein 2 isoform X1        91.7    1e-17   
ref|XP_006089365.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  91.3    2e-17   
ref|XP_010975290.1|  PREDICTED: AFG3-like protein 2                   91.3    2e-17   
ref|WP_009033571.1|  peptidase M41                                    91.3    2e-17   
ref|XP_006187022.1|  PREDICTED: AFG3-like protein 2                   91.3    2e-17   
ref|XP_006909289.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  91.3    2e-17   
ref|WP_033563684.1|  peptidase M41                                    90.9    2e-17   
ref|XP_004385868.1|  PREDICTED: AFG3-like protein 2                   91.3    2e-17   
ref|XP_008212944.1|  PREDICTED: AFG3-like protein 2 isoform X2        91.3    2e-17   
ref|XP_001602382.2|  PREDICTED: AFG3-like protein 2 isoform X1        90.9    2e-17   
ref|XP_006868771.1|  PREDICTED: AFG3-like protein 2-like              90.9    2e-17   
ref|WP_013187331.1|  peptidase M41                                    90.5    2e-17   
ref|XP_004702927.1|  PREDICTED: AFG3-like protein 2-like              90.9    2e-17   
ref|XP_006675531.1|  hypothetical protein BATDEDRAFT_22321            90.9    2e-17   
ref|XP_006749993.1|  PREDICTED: AFG3-like protein 2                   90.9    2e-17   
ref|XP_547682.2|  PREDICTED: AFG3-like protein 2                      90.9    2e-17   
ref|WP_035757649.1|  peptidase M41                                    90.5    2e-17   
ref|WP_009136328.1|  peptidase M41                                    90.5    2e-17   
ref|XP_005356281.1|  PREDICTED: AFG3-like protein 2                   90.9    3e-17   
emb|CDQ74128.1|  unnamed protein product                              90.5    3e-17   
ref|WP_040611669.1|  cell division protein FtsH                       90.5    3e-17   
ref|XP_007887524.1|  PREDICTED: AFG3-like protein 2                   90.5    3e-17   
ref|WP_026951332.1|  peptidase M41                                    90.5    3e-17   
ref|XP_008048239.1|  PREDICTED: AFG3-like protein 1                   90.5    3e-17   
ref|XP_006634560.1|  PREDICTED: AFG3-like protein 2-like              90.5    3e-17   
ref|XP_009195382.1|  PREDICTED: AFG3-like protein 1                   90.5    3e-17   
ref|XP_007949876.1|  PREDICTED: AFG3-like protein 2                   90.5    3e-17   
ref|WP_026968576.1|  peptidase M41                                    90.1    3e-17   
ref|XP_004620195.1|  PREDICTED: AFG3-like protein 2                   90.5    3e-17   
ref|XP_004315445.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  90.5    3e-17   
ref|XP_004276015.1|  PREDICTED: AFG3-like protein 2                   90.5    3e-17   
ref|WP_026902710.1|  peptidase M41                                    90.1    4e-17   
ref|XP_004645075.1|  PREDICTED: AFG3-like protein 1                   90.1    4e-17   
ref|XP_010376787.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...  90.5    4e-17   
emb|CAF90270.1|  unnamed protein product                              90.1    4e-17   
gb|EHJ64116.1|  hypothetical protein KGM_08960                        89.4    4e-17   
ref|XP_002430349.1|  conserved hypothetical protein                   90.1    4e-17   
ref|XP_001653295.1|  AAEL008565-PA                                    90.1    4e-17   
gb|KFO11702.1|  AFG3-like 2                                           88.2    4e-17   
ref|XP_006860314.1|  PREDICTED: AFG3-like protein 1-like              89.7    5e-17   
ref|WP_044213238.1|  peptidase M41                                    89.7    5e-17   



>ref|XP_007026989.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOY07491.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=817

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++AL M+KPYS+KT AIID+EVREW+ KAYE TVQLIEE
Sbjct  680  YAQVAVYGFSDKVGLLSFPQRDDALEMTKPYSSKTGAIIDSEVREWVGKAYERTVQLIEE  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFK SEPTNYDRFK GF E+ + E+KDT E
Sbjct  740  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKPSEPTNYDRFKRGFQEENK-ESKDTTE  798

Query  265  NKSTKDDDSSPLQPEVVP  212
            +K+  DD S+PL+PEVVP
Sbjct  799  SKTVGDDGSAPLEPEVVP  816



>emb|CDP06599.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   MSKPYS+KTAAIIDNEVREW++KAYE T+QLIEE
Sbjct  685  YAQVAVYGFSDKVGLLSFPQRDDTFEMSKPYSSKTAAIIDNEVREWVSKAYERTIQLIEE  744

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HVAQIAELLLEKEVLH  DLVRVLGERPFKSSEPTNYDRFK+GF+ED +   KD+ E
Sbjct  745  HKDHVAQIAELLLEKEVLHHGDLVRVLGERPFKSSEPTNYDRFKEGFIEDDKEVVKDSPE  804

Query  265  NKSTKDDDSSPLQPEVVP  212
             KS +DD S PL P+VVP
Sbjct  805  GKSVQDDSSPPLDPDVVP  822



>ref|XP_009772661.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=820

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   MSKPYS+KTAAIID+EVREW++KAYE TVQLIEE
Sbjct  683  YAQVAVYGFSDKVGLLSFPQREDGFEMSKPYSSKTAAIIDSEVREWVSKAYERTVQLIEE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVA+IAELLLEKEVLHQEDLVRVLGERPFKS EPTNYDRFK GF E++  E K+  E
Sbjct  743  HKEHVAKIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDRFKQGF-EEENKETKNNPE  801

Query  265  NKSTKDDDSSPLQPEVVPV  209
            NK+ +D  SSP++PEVVPV
Sbjct  802  NKTVEDKGSSPVEPEVVPV  820



>gb|KJB16964.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=817

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++A  M+KPYS+KT AIID+EVREW+ KAY  TVQLIEE
Sbjct  679  YAQVAVYGFSDKVGLLSFPQRDDAFEMTKPYSSKTGAIIDSEVREWVGKAYNRTVQLIEE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GF E+ ++    + E
Sbjct  739  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKKGFQEEDKSSKDTSTE  798

Query  265  NKSTKDDDSSPLQPEVVP  212
            +K+  D+ S+PL+PEVVP
Sbjct  799  SKTVDDNGSTPLEPEVVP  816



>ref|XP_009598017.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=821

 Score =   219 bits (558),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   MSKPYS+KTAAIID+EVREW++KAYE TVQLIEE
Sbjct  683  YAQVAVYGFSDKVGLLSFPQREDGFEMSKPYSSKTAAIIDSEVREWVSKAYERTVQLIEE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVA+IAELLLEKEVLHQEDLVRVLGERPFKS EPTNYDRFK GF E++  E K+  E
Sbjct  743  HKEHVAKIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDRFKQGF-EEENKETKNNPE  801

Query  265  NKSTKDD-DSSPLQPEVVPV  209
            NK+ +D+  SSP++PEVVPV
Sbjct  802  NKTVEDNGSSSPVEPEVVPV  821



>gb|KHG12964.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=817

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++A  M+KPYS+KT AIID+EVREW+ KAY+ TVQLIEE
Sbjct  679  YAQVAVYGFSDKVGLLSFPQRDDAFEMTKPYSSKTGAIIDSEVREWVGKAYDRTVQLIEE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKS+EPTNYDRFK GF E+ +     + E
Sbjct  739  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSTEPTNYDRFKKGFQEEDKASKDTSTE  798

Query  265  NKSTKDDDSSPLQPEVVP  212
            +K+  D+ S+PL+PEVVP
Sbjct  799  SKTVDDNGSTPLEPEVVP  816



>ref|XP_006349501.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Solanum tuberosum]
Length=688

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+AL  SKPYS+KTAA+IDNEVR+W+AKAY+ T+QLIEE
Sbjct  533  YAQVAVYGFSDKVGLLSFPQREDALETSKPYSSKTAALIDNEVRKWVAKAYDRTLQLIEE  592

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAELLLEKEVLHQED+ +VLGERPF+SSEPTNY RFK GF E++  E KD+ +
Sbjct  593  HREHVAQIAELLLEKEVLHQEDMAQVLGERPFESSEPTNYYRFKQGF-EEENGETKDSTD  651

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K+T+DD SSP++P++VPV
Sbjct  652  GKTTQDDRSSPVEPKIVPV  670



>ref|XP_006349499.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=716

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+AL  SKPYS+KTAA+IDNEVR+W+AKAY+ T+QLIEE
Sbjct  533  YAQVAVYGFSDKVGLLSFPQREDALETSKPYSSKTAALIDNEVRKWVAKAYDRTLQLIEE  592

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAELLLEKEVLHQED+ +VLGERPF+SSEPTNY RFK GF E++  E KD+ +
Sbjct  593  HREHVAQIAELLLEKEVLHQEDMAQVLGERPFESSEPTNYYRFKQGF-EEENGETKDSTD  651

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K+T+DD SSP++P++VPV
Sbjct  652  GKTTQDDRSSPVEPKIVPV  670



>ref|XP_006349500.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=700

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+AL  SKPYS+KTAA+IDNEVR+W+AKAY+ T+QLIEE
Sbjct  533  YAQVAVYGFSDKVGLLSFPQREDALETSKPYSSKTAALIDNEVRKWVAKAYDRTLQLIEE  592

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAELLLEKEVLHQED+ +VLGERPF+SSEPTNY RFK GF E++  E KD+ +
Sbjct  593  HREHVAQIAELLLEKEVLHQEDMAQVLGERPFESSEPTNYYRFKQGF-EEENGETKDSTD  651

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K+T+DD SSP++P++VPV
Sbjct  652  GKTTQDDRSSPVEPKIVPV  670



>ref|XP_011094876.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=815

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFS+KVGLLSFP  E    MSKPYS+KTAAIIDNEVREW  KAY  TVQLIEE
Sbjct  678  YDQVAVYGFSEKVGLLSFPQREQGFEMSKPYSSKTAAIIDNEVREWTGKAYTRTVQLIEE  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GFVE+KE E     +
Sbjct  738  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKQGFVENKE-ETTSIPK  796

Query  265  NKSTKDDDSSPLQPEVVPV  209
              +++DD SS L+P VVP 
Sbjct  797  GNNSEDDRSSSLEPHVVPT  815



>ref|XP_011094875.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=817

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFS+KVGLLSFP  E    MSKPYS+KTAAIIDNEVREW  KAY  TVQLIEE
Sbjct  680  YDQVAVYGFSEKVGLLSFPQREQGFEMSKPYSSKTAAIIDNEVREWTGKAYTRTVQLIEE  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GFVE+KE E     +
Sbjct  740  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKQGFVENKE-ETTSIPK  798

Query  265  NKSTKDDDSSPLQPEVVPV  209
              +++DD SS L+P VVP 
Sbjct  799  GNNSEDDRSSSLEPHVVPT  817



>gb|KDP35648.1| hypothetical protein JCGZ_09086 [Jatropha curcas]
Length=828

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   M+KPYS+KT AIID+EVREW+AKAY+ T+QLIEE
Sbjct  691  YAQVAVYGFSEKVGLLSFPQREDMFEMTKPYSSKTGAIIDSEVREWVAKAYDRTIQLIEE  750

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HVA+IAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYD+FK+GF +D++ E+K+T +
Sbjct  751  HKDHVAEIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDKFKEGF-QDEDKESKETTK  809

Query  265  NKSTKDDDSSPLQPEVVP  212
            N +  DD S+PL P+VVP
Sbjct  810  NGTVVDDGSAPLDPQVVP  827



>gb|KDO51173.1| hypothetical protein CISIN_1g005738mg [Citrus sinensis]
Length=680

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KPYS+KT AIIDNEVREW+ KAY+ TV+LIEE
Sbjct  542  YAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEE  601

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAE LLEKEVLHQ+DLVRVLGERPFK SEPTNYDRFK GF+ED + E+K+T E
Sbjct  602  HREHVAQIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLED-DKESKETKE  660

Query  265  NKSTKDDD-SSPLQPEVVP  212
              + +DD+ SSPL+PEVVP
Sbjct  661  GGTAEDDNSSSPLEPEVVP  679



>ref|XP_006480880.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006480881.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=818

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KPYS+KT AIIDNEVREW+ KAY+ TV+LIEE
Sbjct  680  YAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEE  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAE LLEKEVLHQ+DLVRVLGERPFK SEPTNYDRFK GF+ED + E+K+T E
Sbjct  740  HREHVAQIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLED-DKESKETKE  798

Query  265  NKSTKDDD-SSPLQPEVVPV  209
              + +DD+ SSPL+PEVVP 
Sbjct  799  GGTAEDDNSSSPLEPEVVPT  818



>ref|XP_006429118.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
 gb|ESR42358.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
Length=818

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KPYS+KT AIIDNEVREW+ KAY+ TV+LIEE
Sbjct  680  YAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEE  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAE LLEKEVLHQ+DLVRVLGERPFK SEPTNYDRFK GF+ED + E+K+T E
Sbjct  740  HREHVAQIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLED-DKESKETKE  798

Query  265  NKSTKDDD-SSPLQPEVVPV  209
              + +DD+ SSPL+PEVVP 
Sbjct  799  GGTAEDDNSSSPLEPEVVPT  818



>ref|XP_010262544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=821

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KPYS+K  AIIDNEVREW+AKAYE TVQLIEE
Sbjct  685  YAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKMGAIIDNEVREWVAKAYERTVQLIEE  744

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYDRFK GF ED+++  + T E
Sbjct  745  HKEQVAQIAELLLEKEVLHQEDLVRVLGERPFKSIEPTNYDRFKQGFQEDEKS--RQTTE  802

Query  265  NKSTKDDDSSPLQPEVVPV  209
              S + D SSPL+P+VVP 
Sbjct  803  VGSVEGDRSSPLEPDVVPT  821



>gb|KJB55846.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=816

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   MSKPYSNKT AIID EVREW+AKAYE TVQLIEE
Sbjct  678  YAQVAVYGFSDKVGLLSFPLREDGFEMSKPYSNKTGAIIDGEVREWVAKAYEKTVQLIEE  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDLVRVLGERPFKSSE TNYDRFK GF ED+ET++  T E
Sbjct  738  HKEQVAQIAELLLEKEVLHQEDLVRVLGERPFKSSELTNYDRFKQGF-EDEETKSMQTPE  796

Query  265  NKSTKDDDSS-PLQPEVVP  212
                 DD S+ PL P+VVP
Sbjct  797  GGIADDDGSAPPLVPQVVP  815



>gb|KJB55847.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=785

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   MSKPYSNKT AIID EVREW+AKAYE TVQLIEE
Sbjct  647  YAQVAVYGFSDKVGLLSFPLREDGFEMSKPYSNKTGAIIDGEVREWVAKAYEKTVQLIEE  706

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDLVRVLGERPFKSSE TNYDRFK GF ED+ET++  T E
Sbjct  707  HKEQVAQIAELLLEKEVLHQEDLVRVLGERPFKSSELTNYDRFKQGF-EDEETKSMQTPE  765

Query  265  NKSTKDDDSS-PLQPEVVP  212
                 DD S+ PL P+VVP
Sbjct  766  GGIADDDGSAPPLVPQVVP  784



>ref|XP_008464106.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis melo]
Length=818

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E++  MSKPYS+KTAAIID+EVREW+ KAYE TV+LIEE
Sbjct  681  YAQVAVYGFSDKVGLLSFPPREDSFEMSKPYSSKTAAIIDSEVREWVGKAYERTVKLIEE  740

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDLVRVLGERPFK SE TNYDRFK GFVE  E ++ +T  
Sbjct  741  HKEQVAQIAELLLEKEVLHQEDLVRVLGERPFKPSEVTNYDRFKQGFVEADE-KSVETPP  799

Query  265  NKSTKDDDSSPLQPEVVP  212
             ++  DD SSPL+P+VVP
Sbjct  800  VEAADDDGSSPLEPQVVP  817



>ref|XP_010256889.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=820

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 118/141 (84%), Gaps = 5/141 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KP+S+KT AIIDNEVREW+AKAYE TV LIEE
Sbjct  683  YAQVAVYGFSDKVGLLSFPQRDDTFEMTKPFSSKTGAIIDNEVREWVAKAYERTVNLIEE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF--VEDKETEAKDT  272
            HKE VAQIAE+LLEKEVLHQEDLVR+LGERPFKS+EPTNYDRFK+GF  V++K  EA D 
Sbjct  743  HKEQVAQIAEVLLEKEVLHQEDLVRILGERPFKSAEPTNYDRFKEGFREVDEKSREATDV  802

Query  271  AENKSTKDDDSSPLQPEVVPV  209
                +  DD SSPL+PEVVP 
Sbjct  803  G---TMGDDGSSPLEPEVVPT  820



>gb|AFX67028.1| putative AAA-metalloprotease FtsH, partial [Solanum tuberosum]
Length=318

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   MSKPYS+KTAAIID EVREW++KAYE TVQLIE+
Sbjct  181  YAQVAVYGFSDKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYERTVQLIEK  240

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYD FK GF E++  E KD  E
Sbjct  241  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDIFKQGF-EEENKERKDNPE  299

Query  265  NKSTKDDDS  239
            NK+ +D+ S
Sbjct  300  NKTVEDNGS  308



>ref|XP_002530989.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
 gb|EEF31401.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
Length=833

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   MSKPYS+KT AIID+EVREW+ KAY+ T+QL+EE
Sbjct  696  YAQVAVYGFSDKVGLLSFPQRDDTFEMSKPYSSKTGAIIDSEVREWVGKAYQRTLQLVEE  755

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEH+A+IAELLLEKEVLHQEDL+RVLGERPFKSSEPTNYDRFK+GF ED + E+K+T +
Sbjct  756  HKEHIAEIAELLLEKEVLHQEDLIRVLGERPFKSSEPTNYDRFKEGFQED-DKESKETTK  814

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  DD S+ L+P+V P
Sbjct  815  GGTLDDDGSTTLEPQVAP  832



>ref|XP_002323508.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
 gb|EEF05269.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
Length=814

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++A  MSKPYS++T AIID+EVREW+ KAY+ TV+LIEE
Sbjct  680  YAQVAVYGFSDKVGLLSFPQRDDAFEMSKPYSSETGAIIDSEVREWVGKAYDSTVKLIEE  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DLVRVLGERPFK+SEPTNYDRFK GF +D     K+TA+
Sbjct  740  HKEQVAQIAELLLEKEVLHQDDLVRVLGERPFKTSEPTNYDRFKQGFEQDD----KETAK  795

Query  265  NKSTKDDDSSPLQPEVVP  212
             ++  DD SSP++P+VVP
Sbjct  796  GETFDDDGSSPIEPQVVP  813



>ref|XP_003537985.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +  +SKPYS+KTAAIIDNEVR+W+ KAYE TVQLI+E
Sbjct  673  YAQVAVYGFSDKVGLLSFPPTEGSYEISKPYSSKTAAIIDNEVRDWVNKAYEHTVQLIKE  732

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL+RVLGERPFK +EPTNYDRFK GF+E++E  A+ T +
Sbjct  733  HKEQVAQIAELLLEKEVLHQDDLLRVLGERPFKVTEPTNYDRFKQGFIEEEEKVAESTID  792

Query  265  NKSTKDDDSSPLQPEVVP  212
                K   SSPL+P+VVP
Sbjct  793  TPE-KGGGSSPLEPQVVP  809



>gb|KHG20351.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=816

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   MSKPYSNKT AIID EVREW+AKAYE TVQLIEE
Sbjct  678  YAQVAVYGFSDKVGLLSFPQREDGFEMSKPYSNKTGAIIDGEVREWVAKAYEKTVQLIEE  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDLVRVLGERPFKSSE TNYDRFK GF E++ET++  T E
Sbjct  738  HKEQVAQIAELLLEKEVLHQEDLVRVLGERPFKSSELTNYDRFKLGF-EEEETKSMQTPE  796

Query  265  NKSTKDDDSS-PLQPEVVP  212
                 DD S+ PL P+VVP
Sbjct  797  GGIADDDGSAPPLVPQVVP  815



>gb|KHN21936.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +  +SKPYS+KTAAIIDNEVR+W+ KAYE TVQLI+E
Sbjct  673  YAQVAVYGFSDKVGLLSFPPTEGSYEISKPYSSKTAAIIDNEVRDWVNKAYEHTVQLIKE  732

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL+RVLGERPFK +EPTNYDRFK GF+E++E  A+ T +
Sbjct  733  HKEQVAQIAELLLEKEVLHQDDLLRVLGERPFKVTEPTNYDRFKQGFIEEEEKVAESTID  792

Query  265  NKSTKDDDSSPLQPEVVP  212
                K   SSPL+P+VVP
Sbjct  793  TPE-KGGGSSPLEPQVVP  809



>gb|EYU41737.1| hypothetical protein MIMGU_mgv1a001461mg [Erythranthe guttata]
Length=815

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 115/143 (80%), Gaps = 5/143 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   MSKPYS+KTAAIID EVREW+ KAY  T+QLIEE
Sbjct  674  YAQVAVYGFSEKVGLLSFPQKEDGFEMSKPYSSKTAAIIDTEVREWVGKAYARTIQLIEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+H++QIAELLLEKEVLHQ+DLVRVLGERPF SSEPTNYDRFK GF+ED   ++     
Sbjct  734  HKDHISQIAELLLEKEVLHQDDLVRVLGERPFTSSEPTNYDRFKKGFIEDDNGKSGSNG-  792

Query  265  NKSTK----DDDSSPLQPEVVPV  209
            N +TK    DD   PL PEVVPV
Sbjct  793  NTTTKGKKIDDGPLPLAPEVVPV  815



>ref|XP_011007151.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Populus euphratica]
Length=709

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 118/138 (86%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++A  MSKPYS++T AIID+EVREW+ KAY+ TV+LIEE
Sbjct  574  YAQVAVYGFSDKVGLLSFPQRDDAFEMSKPYSSETGAIIDSEVREWVGKAYDSTVKLIEE  633

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DLVRVLGERPFK+SEPTNYDRFK GF +D +  A   A+
Sbjct  634  HKEQVAQIAELLLEKEVLHQDDLVRVLGERPFKTSEPTNYDRFKQGFEQDDKEAA---AK  690

Query  265  NKSTKDDDSSPLQPEVVP  212
             ++  DD SSP++P+VVP
Sbjct  691  GETFDDDGSSPMEPQVVP  708



>ref|XP_011007150.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=815

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 118/138 (86%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++A  MSKPYS++T AIID+EVREW+ KAY+ TV+LIEE
Sbjct  680  YAQVAVYGFSDKVGLLSFPQRDDAFEMSKPYSSETGAIIDSEVREWVGKAYDSTVKLIEE  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DLVRVLGERPFK+SEPTNYDRFK GF +D +  A   A+
Sbjct  740  HKEQVAQIAELLLEKEVLHQDDLVRVLGERPFKTSEPTNYDRFKQGFEQDDKEAA---AK  796

Query  265  NKSTKDDDSSPLQPEVVP  212
             ++  DD SSP++P+VVP
Sbjct  797  GETFDDDGSSPMEPQVVP  814



>ref|XP_007208082.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
 gb|EMJ09281.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
Length=808

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++A  M+KPYS+KT AIID+EVREW+AKAY  T++LIEE
Sbjct  671  YAQVAVYGFSDKVGLLSFPQRDDAFEMAKPYSSKTGAIIDSEVREWVAKAYVRTIELIEE  730

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE V QIAELLLEKEVLHQ+DLVRVLGERPFKS+EPTNYDRFK+GF E+ + E K+T E
Sbjct  731  HKEQVGQIAELLLEKEVLHQDDLVRVLGERPFKSNEPTNYDRFKEGFQEE-DKEPKETTE  789

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  D  S P+QP+VVP
Sbjct  790  GGNVDDGRSPPIQPDVVP  807



>ref|XP_009345397.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 117/137 (85%), Gaps = 5/137 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++  M+KPYS+KT AIID+EVREW+ KAY  TVQLIEE
Sbjct  681  YAQVAVYGFSDKVGLLSFPQREDSFEMTKPYSSKTGAIIDSEVREWVGKAYFRTVQLIEE  740

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHV QIAELLLEKEVLHQEDL+RVLGERPFKS+EPTNYDRFK+GF E+ + EAK+T  
Sbjct  741  HKEHVGQIAELLLEKEVLHQEDLIRVLGERPFKSNEPTNYDRFKEGFQEE-DKEAKET--  797

Query  265  NKSTKDDDSSPLQPEVV  215
              + KD  S P+QP+VV
Sbjct  798  --NAKDGRSPPIQPDVV  812



>ref|XP_009338598.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009338599.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 117/137 (85%), Gaps = 5/137 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++  M+KPYS+KT AIID+EVREW+ KAY  TVQLIEE
Sbjct  681  YAQVAVYGFSDKVGLLSFPQREDSFEMTKPYSSKTGAIIDSEVREWVGKAYFRTVQLIEE  740

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHV QIAELLLEKEVLHQEDL+RVLGERPFKS+EPTNYDRFK+GF E+ + EAK+T  
Sbjct  741  HKEHVGQIAELLLEKEVLHQEDLIRVLGERPFKSNEPTNYDRFKEGFQEE-DKEAKET--  797

Query  265  NKSTKDDDSSPLQPEVV  215
              + KD  S P+QP+VV
Sbjct  798  --NAKDGRSPPIQPDVV  812



>ref|XP_004143122.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004163225.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 10, mitochondrial-like [Cucumis sativus]
 gb|KGN47136.1| hypothetical protein Csa_6G190270 [Cucumis sativus]
Length=818

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 7/141 (5%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E++  MSKPYS+KTAAIID+EVREW+ KAY+ TV+LIEE
Sbjct  681  YAQVAVYGFSDKVGLLSFPPREDSFEMSKPYSSKTAAIIDSEVREWVGKAYKRTVELIEE  740

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDL+R+LGERPFK SE TNYDRFK GFVE  E     + E
Sbjct  741  HKEQVAQIAELLLEKEVLHQEDLLRILGERPFKPSEVTNYDRFKQGFVEADE----KSVE  796

Query  265  N---KSTKDDDSSPLQPEVVP  212
            N   ++ +D+ SSPL+P+VVP
Sbjct  797  NPPVEAAEDNGSSPLEPQVVP  817



>ref|XP_010106514.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
 gb|EXC10690.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
Length=817

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M KPYS+KTAAIIDNEVREW+ KAYE TVQLIEE
Sbjct  679  YAQVAVYGFSDKVGLLSFPQREDTFEMIKPYSSKTAAIIDNEVREWVGKAYERTVQLIEE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQ+DL++VLGERPFKS E TNYDRFK GF E+ E   +    
Sbjct  739  HKEHVAQIAELLLEKEVLHQDDLLKVLGERPFKSVEVTNYDRFKQGFQEEDEKPVEVPLN  798

Query  265  NKSTKDDDSSPLQPEVVP  212
            + S ++D SSPL P+VVP
Sbjct  799  DASEEEDGSSPLDPQVVP  816



>ref|XP_008369915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=815

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 116/137 (85%), Gaps = 5/137 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++  M+KPYS+KT AIID EVREW+ KAY  TVQLIEE
Sbjct  681  YAQVAVYGFSDKVGLLSFPQREDSFEMTKPYSSKTGAIIDXEVREWVGKAYFRTVQLIEE  740

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHV QIAELLLEKEVLHQEDL+RVLGERPFKS+EPTNYDRFK+GF E+ + EAK+T  
Sbjct  741  HKEHVGQIAELLLEKEVLHQEDLIRVLGERPFKSNEPTNYDRFKEGFQEE-DKEAKET--  797

Query  265  NKSTKDDDSSPLQPEVV  215
              + KD  S P+QP+VV
Sbjct  798  --NAKDGRSPPIQPDVV  812



>ref|XP_006592192.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Glycine max]
Length=674

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +   SKPYS+KTAAIID EVREW+ KAY+ T+QLIEE
Sbjct  537  YAQVAVYGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEE  596

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE V +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +
Sbjct  597  HKEQVTEIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTID  656

Query  265  NKSTKDDDSSPLQPEVVP  212
                +   SSPL+P+VVP
Sbjct  657  TPE-EGGGSSPLEPQVVP  673



>ref|XP_006592191.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Glycine max]
Length=782

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +   SKPYS+KTAAIID EVREW+ KAY+ T+QLIEE
Sbjct  645  YAQVAVYGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEE  704

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE V +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +
Sbjct  705  HKEQVTEIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTID  764

Query  265  NKSTKDDDSSPLQPEVVP  212
                +   SSPL+P+VVP
Sbjct  765  TPE-EGGGSSPLEPQVVP  781



>gb|KHN32138.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=771

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +   SKPYS+KTAAIID EVREW+ KAY+ T+QLIEE
Sbjct  634  YAQVAVYGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEE  693

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE V +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +
Sbjct  694  HKEQVTEIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTID  753

Query  265  NKSTKDDDSSPLQPEVVP  212
                +   SSPL+P+VVP
Sbjct  754  TPE-EGGGSSPLEPQVVP  770



>gb|ABR26136.1| osftsh8 - oryza sativa ftsh protease, homologue of atftsh3/10 
[Oryza sativa Indica Group]
Length=157

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  20   YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITE  79

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A 
Sbjct  80   HKEQVAKIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAA  138

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 DDD +P   EVVP 
Sbjct  139  KTPQPDDDGTPSLGEVVPT  157



>ref|XP_003539663.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Glycine max]
Length=806

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +   SKPYS+KTAAIID EVREW+ KAY+ T+QLIEE
Sbjct  669  YAQVAVYGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEE  728

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE V +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +
Sbjct  729  HKEQVTEIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTID  788

Query  265  NKSTKDDDSSPLQPEVVP  212
                +   SSPL+P+VVP
Sbjct  789  TPE-EGGGSSPLEPQVVP  805



>gb|KDO72822.1| hypothetical protein CISIN_1g047690mg [Citrus sinensis]
Length=811

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 113/138 (82%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   MSKPYS+KT AIID EVREW+ KAY  TVQLIEE
Sbjct  676  YAQVAVYGFSDKVGLLSFPQREDTFEMSKPYSSKTGAIIDAEVREWVGKAYVRTVQLIEE  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK GF E++++ A     
Sbjct  736  HKEHVAQIAELLLEKEVLHQDDLLRVLGERPFKSSELTNYDRFKQGFEEEEKSSA---PP  792

Query  265  NKSTKDDDSSPLQPEVVP  212
               T DD SSPL+P+V P
Sbjct  793  ETGTVDDGSSPLEPQVAP  810



>ref|XP_008240759.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Prunus mume]
Length=816

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++A  M+KPYS+KT AIID+EVREW+AKAY  T++LIEE
Sbjct  679  YAQVAVYGFSDKVGLLSFPQRDDAFEMAKPYSSKTGAIIDSEVREWVAKAYVRTIELIEE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  V QIAELLLEKEVLHQ+DLVRVLGERPFKS+EPTNYDRFK+GF E+ + E K+T E
Sbjct  739  HKVQVGQIAELLLEKEVLHQDDLVRVLGERPFKSNEPTNYDRFKEGFQEEGK-EPKETTE  797

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  D  S P+QP+VVP
Sbjct  798  GGNVDDGRSPPIQPDVVP  815



>ref|XP_004142062.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 gb|KGN54261.1| hypothetical protein Csa_4G296150 [Cucumis sativus]
Length=824

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    MSKPYS+KT AIID+EVREW+ KAYE TVQLIEE
Sbjct  686  YAQVAVYGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYERTVQLIEE  745

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFK+ EPTNYDRFK+GF  D+   AK+  E
Sbjct  746  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKTLEPTNYDRFKEGF-RDEVDGAKEKTE  804

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  +  S PL+P++VP
Sbjct  805  RGNPGNSSSPPLEPDIVP  822



>ref|XP_004164623.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
Length=824

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    MSKPYS+KT AIID+EVREW+ KAYE TVQLIEE
Sbjct  686  YAQVAVYGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYERTVQLIEE  745

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFK+ EPTNYDRFK+GF  D+   AK+  E
Sbjct  746  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKTLEPTNYDRFKEGF-RDEVDGAKEKTE  804

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  +  S PL+P++VP
Sbjct  805  RGNPGNSSSPPLEPDIVP  822



>ref|XP_006349497.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=816

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 118/140 (84%), Gaps = 6/140 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++   +KPY +KTAAIID EVREW+AKAY+ TVQL+E+
Sbjct  682  YAQVAVYGFSDKVGLLSFPQREDSFE-AKPYGSKTAAIIDTEVREWVAKAYDHTVQLVEK  740

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAE+LLEKEVLHQEDL++VLGERPF S EPTNYDRFK GF    E E KD AE
Sbjct  741  HKEHVAQIAEMLLEKEVLHQEDLIQVLGERPFVSVEPTNYDRFKQGF----EEENKDGAE  796

Query  265  NKSTKDD-DSSPLQPEVVPV  209
             K+ +DD  SSP++PE+VPV
Sbjct  797  AKTAQDDGSSSPVEPEIVPV  816



>ref|XP_006349498.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=815

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 118/140 (84%), Gaps = 6/140 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++   +KPY +KTAAIID EVREW+AKAY+ TVQL+E+
Sbjct  681  YAQVAVYGFSDKVGLLSFPQREDSFE-AKPYGSKTAAIIDTEVREWVAKAYDHTVQLVEK  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAE+LLEKEVLHQEDL++VLGERPF S EPTNYDRFK GF    E E KD AE
Sbjct  740  HKEHVAQIAEMLLEKEVLHQEDLIQVLGERPFVSVEPTNYDRFKQGF----EEENKDGAE  795

Query  265  NKSTKDD-DSSPLQPEVVPV  209
             K+ +DD  SSP++PE+VPV
Sbjct  796  AKTAQDDGSSSPVEPEIVPV  815



>ref|XP_004249560.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum lycopersicum]
Length=812

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 6/140 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++   +KPY +KTAAIID EVREW+AKAY+ TVQL+EE
Sbjct  678  YAQVAVYGFSDKVGLLSFPQREDSFD-AKPYGSKTAAIIDTEVREWVAKAYDRTVQLVEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAE+LLEKEVLHQEDL++VLGERPF S E TNYDRFK GF    E E KD+AE
Sbjct  737  HREHVAQIAEMLLEKEVLHQEDLIQVLGERPFTSVEATNYDRFKQGF----EEENKDSAE  792

Query  265  NKSTKDD-DSSPLQPEVVPV  209
            +K+ +DD  SSP++PE+VPV
Sbjct  793  SKTAQDDGSSSPVEPEIVPV  812



>ref|XP_010312354.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Solanum lycopersicum]
Length=813

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 6/140 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++   +KPY +KTAAIID EVREW+AKAY+ TVQL+EE
Sbjct  679  YAQVAVYGFSDKVGLLSFPQREDSFD-AKPYGSKTAAIIDTEVREWVAKAYDRTVQLVEE  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAE+LLEKEVLHQEDL++VLGERPF S E TNYDRFK GF    E E KD+AE
Sbjct  738  HREHVAQIAEMLLEKEVLHQEDLIQVLGERPFTSVEATNYDRFKQGF----EEENKDSAE  793

Query  265  NKSTKDD-DSSPLQPEVVPV  209
            +K+ +DD  SSP++PE+VPV
Sbjct  794  SKTAQDDGSSSPVEPEIVPV  813



>ref|XP_008448063.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
 ref|XP_008448071.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=825

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    MSKPYS+KT AIID+EVREW+ KAY+ TVQLIEE
Sbjct  687  YAQVAVYGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYQRTVQLIEE  746

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQ+DLVRVLGERPFK+ EPTNYDRFK+GF +D+   AK+  E
Sbjct  747  HKEHVAQIAELLLEKEVLHQDDLVRVLGERPFKTLEPTNYDRFKEGF-KDEVDGAKEKTE  805

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  +  S PL+P++VP
Sbjct  806  RGNAGNSSSPPLEPDIVP  823



>ref|XP_008448079.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=824

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    MSKPYS+KT AIID+EVREW+ KAY+ TVQLIEE
Sbjct  686  YAQVAVYGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYQRTVQLIEE  745

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQ+DLVRVLGERPFK+ EPTNYDRFK+GF +D+   AK+  E
Sbjct  746  HKEHVAQIAELLLEKEVLHQDDLVRVLGERPFKTLEPTNYDRFKEGF-KDEVDGAKEKTE  804

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  +  S PL+P++VP
Sbjct  805  RGNAGNSSSPPLEPDIVP  822



>ref|XP_006488359.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=810

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 113/138 (82%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   MSKPYS+KT AIID EVREW+ KAY  TVQLIEE
Sbjct  675  YAQVAVYGFSEKVGLLSFPQREDTFEMSKPYSSKTGAIIDAEVREWVGKAYVRTVQLIEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK GF E++++ A     
Sbjct  735  HKEHVAQIAELLLEKEVLHQDDLLRVLGERPFKSSELTNYDRFKQGFEEEEKSSA---PP  791

Query  265  NKSTKDDDSSPLQPEVVP  212
               T DD SSPL+P+V P
Sbjct  792  ETGTVDDGSSPLEPQVAP  809



>ref|XP_006424865.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
 ref|XP_006488358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Citrus sinensis]
 gb|ESR38105.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
Length=811

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 113/138 (82%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   MSKPYS+KT AIID EVREW+ KAY  TVQLIEE
Sbjct  676  YAQVAVYGFSEKVGLLSFPQREDTFEMSKPYSSKTGAIIDAEVREWVGKAYVRTVQLIEE  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK GF E++++ A     
Sbjct  736  HKEHVAQIAELLLEKEVLHQDDLLRVLGERPFKSSELTNYDRFKQGFEEEEKSSA---PP  792

Query  265  NKSTKDDDSSPLQPEVVP  212
               T DD SSPL+P+V P
Sbjct  793  ETGTVDDGSSPLEPQVAP  810



>ref|XP_006341014.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum tuberosum]
Length=817

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   MSKPYS+KTAAIID EVREW++KAYE TVQLIE+
Sbjct  680  YAQVAVYGFSDKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYERTVQLIEK  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYD FK GF E++  E KD  E
Sbjct  740  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDIFKQGF-EEENKERKDNPE  798

Query  265  NKSTKDDDS  239
            NK+ +D+ S
Sbjct  799  NKTVEDNGS  807



>ref|XP_010043512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010043513.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
Length=683

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFSDKVGLLSFP  E+   M+KPYS+KTAA+ID EVREW+ KAYECT++LI E
Sbjct  546  YAQVAIYGFSDKVGLLSFPQREDGSEMTKPYSSKTAALIDGEVREWVNKAYECTLELITE  605

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDL+RVLGERPF+SSE TNYDR+K GF  ++E ++ +T E
Sbjct  606  HKEHVAQIAELLLEKEVLHQEDLLRVLGERPFQSSEMTNYDRYKLGF--EEEEKSTETPE  663

Query  265  NKSTKDDDS-SPLQPEVVP  212
              + +DD+S  PL P+VVP
Sbjct  664  TGAVEDDESPRPLDPQVVP  682



>ref|XP_007016370.1| FTSH protease 10 [Theobroma cacao]
 gb|EOY33989.1| FTSH protease 10 [Theobroma cacao]
Length=813

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   MSKPYSNKT AIID EVR+W+ KAYE TVQLIEE
Sbjct  676  YAQVAVYGFSEKVGLLSFPQRDDGFEMSKPYSNKTGAIIDGEVRKWVGKAYEKTVQLIEE  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DLVRVLGERPFKSSE TNYDRFK GF E++  ++    E
Sbjct  736  HKEQVAEIAELLLEKEVLHQDDLVRVLGERPFKSSELTNYDRFKQGF-EEEANKSMQAPE  794

Query  265  NKSTKDDDSSPLQPEVVP  212
              S ++D S+PL P+VVP
Sbjct  795  VGSVENDGSAPLDPQVVP  812



>ref|XP_010931245.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=678

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYS+KT AIID EVREW+AKAY+ TV+LI+E
Sbjct  540  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIKE  599

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HV QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E +E +++ T+E
Sbjct  600  HKDHVMQIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEQEEQKSQQTSE  659

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  DD  S L  EVVP
Sbjct  660  AATMADDGPSSLDGEVVP  677



>ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Vitis vinifera]
 emb|CBI16104.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYS+KT AIID EVREW+ KAYE T+QLIEE
Sbjct  682  YAQVAVYGFSDKVGLLSFPQREDGFEMTKPYSSKTGAIIDTEVREWVGKAYERTLQLIEE  741

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL RVLGERPFKS EP+NYDRFK GF E+ +  A     
Sbjct  742  HKEQVAQIAELLLEKEVLHQDDLTRVLGERPFKSLEPSNYDRFKQGFEEENDKSAITQDS  801

Query  265  NKSTKDDDSSPLQPEVVP  212
            +++  ++ + PL+PEVVP
Sbjct  802  SRTEPENGAPPLEPEVVP  819



>gb|KCW85528.1| hypothetical protein EUGRSUZ_B02325 [Eucalyptus grandis]
Length=816

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 3/140 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFSDKVGLLSFP  E+   M+KPYS+KTAA+ID EVREW+ KAYECT++LI E
Sbjct  679  YAQVAIYGFSDKVGLLSFPQREDGSEMTKPYSSKTAALIDGEVREWVNKAYECTLELITE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDL+RVLGERPF+SSE TNYDR+K GF  ++E ++ +T E
Sbjct  739  HKEHVAQIAELLLEKEVLHQEDLLRVLGERPFQSSEMTNYDRYKLGF--EEEEKSTETPE  796

Query  265  NKSTKDDDS-SPLQPEVVPV  209
              + +DD+S  PL P+VVP 
Sbjct  797  TGAVEDDESPRPLDPQVVPT  816



>ref|XP_010043511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Eucalyptus grandis]
Length=847

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFSDKVGLLSFP  E+   M+KPYS+KTAA+ID EVREW+ KAYECT++LI E
Sbjct  710  YAQVAIYGFSDKVGLLSFPQREDGSEMTKPYSSKTAALIDGEVREWVNKAYECTLELITE  769

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDL+RVLGERPF+SSE TNYDR+K GF  ++E ++ +T E
Sbjct  770  HKEHVAQIAELLLEKEVLHQEDLLRVLGERPFQSSEMTNYDRYKLGF--EEEEKSTETPE  827

Query  265  NKSTKDDDS-SPLQPEVVP  212
              + +DD+S  PL P+VVP
Sbjct  828  TGAVEDDESPRPLDPQVVP  846



>ref|XP_009384843.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=821

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYSNKT AIID EVREWI+KAYE TV+LI+E
Sbjct  682  YAQVAVYGFSDKVGLLSFPQREDGFEMTKPYSNKTGAIIDTEVREWISKAYERTVELIKE  741

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HVAQIAELLL+KEVLHQ+DL +VLGERPFK +EPTNYDRFK GF E  E ++++T E
Sbjct  742  HKDHVAQIAELLLKKEVLHQDDLAQVLGERPFKLTEPTNYDRFKQGFQEATEKKSQETLE  801

Query  265  NKSTKD-DDSSPLQPEVVPV  209
                 D D SS L  EVVP 
Sbjct  802  GSIVADGDGSSSLDGEVVPT  821



>ref|XP_008777200.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=679

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYS+KT AIID EVREW+AKAY+ TV+LI E
Sbjct  540  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIRE  599

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HV QIAELLLEKEVLHQ+DLV+VLGERPFK SEPTNYDRFK GF + +E + + T+E
Sbjct  600  HKDHVIQIAELLLEKEVLHQDDLVQVLGERPFKLSEPTNYDRFKQGFQDQEEQKGQQTSE  659

Query  265  NKSTKDDD-SSPLQPEVVP  212
              +  DDD SS L  EVVP
Sbjct  660  AATMADDDGSSSLDGEVVP  678



>ref|XP_009384842.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=833

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYSNKT AIID EVREWI+KAYE TV+LI+E
Sbjct  694  YAQVAVYGFSDKVGLLSFPQREDGFEMTKPYSNKTGAIIDTEVREWISKAYERTVELIKE  753

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HVAQIAELLL+KEVLHQ+DL +VLGERPFK +EPTNYDRFK GF E  E ++++T E
Sbjct  754  HKDHVAQIAELLLKKEVLHQDDLAQVLGERPFKLTEPTNYDRFKQGFQEATEKKSQETLE  813

Query  265  NKSTKD-DDSSPLQPEVVPV  209
                 D D SS L  EVVP 
Sbjct  814  GSIVADGDGSSSLDGEVVPT  833



>ref|XP_010931243.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=821

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYS+KT AIID EVREW+AKAY+ TV+LI+E
Sbjct  683  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIKE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HV QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E +E +++ T+E
Sbjct  743  HKDHVMQIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEQEEQKSQQTSE  802

Query  265  NKSTKDDDSSPLQPEVVPV  209
              +  DD  S L  EVVP 
Sbjct  803  AATMADDGPSSLDGEVVPT  821



>ref|XP_010931244.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=816

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYS+KT AIID EVREW+AKAY+ TV+LI+E
Sbjct  678  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIKE  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HV QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E +E +++ T+E
Sbjct  738  HKDHVMQIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEQEEQKSQQTSE  797

Query  265  NKSTKDDDSSPLQPEVVPV  209
              +  DD  S L  EVVP 
Sbjct  798  AATMADDGPSSLDGEVVPT  816



>ref|XP_008777193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=822

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYS+KT AIID EVREW+AKAY+ TV+LI E
Sbjct  683  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIRE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HV QIAELLLEKEVLHQ+DLV+VLGERPFK SEPTNYDRFK GF + +E + + T+E
Sbjct  743  HKDHVIQIAELLLEKEVLHQDDLVQVLGERPFKLSEPTNYDRFKQGFQDQEEQKGQQTSE  802

Query  265  NKSTKDDD-SSPLQPEVVPV  209
              +  DDD SS L  EVVP 
Sbjct  803  AATMADDDGSSSLDGEVVPT  822



>dbj|BAF01982.1| hypothetical protein [Arabidopsis thaliana]
Length=173

 Score =   186 bits (473),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  37   YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  94

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  95   HKEQVAQIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEESEKESQKESVP  154

Query  265  NKSTKDDDSSPLQPEVVP  212
             K  +DD   PL+P+VVP
Sbjct  155  VKPVEDDGIPPLEPQVVP  172



>ref|XP_009600786.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009600787.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=716

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++    SKPYS+KTAAIID+EVREWIAKAY+ T+QLIEE
Sbjct  533  YAQVAVYGFSDKVGLLSFPQRDDTFETSKPYSSKTAAIIDDEVREWIAKAYDRTLQLIEE  592

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAELLLEKEVLH EDLV+VLGERPF+SSE TNY+RFK GF E++  E KD  +
Sbjct  593  HREHVAQIAELLLEKEVLHHEDLVQVLGERPFESSELTNYNRFKQGF-EEENGEIKDIPK  651

Query  265  NKSTKDDDSSPLQPEVVPV  209
            + + +D+ SS  + EVVP+
Sbjct  652  DMTAQDNQSSSEESEVVPI  670



>ref|XP_003539662.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +   SKPYS+KTAAIID+EVR+W+ KAY+ T+QLIEE
Sbjct  673  YAQVAVYGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDSEVRDWVDKAYKHTIQLIEE  732

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE V QIAELLLEKEVLHQ+DL+RVLGERPFK++E TNYDRFK GF+E++E   + T +
Sbjct  733  HKEQVTQIAELLLEKEVLHQDDLLRVLGERPFKATELTNYDRFKQGFIEEEEKVVESTVD  792

Query  265  NKSTKDDDSSPLQPEVVP  212
                +   SSPL+P+VVP
Sbjct  793  TPE-EGGGSSPLEPQVVP  809



>ref|XP_004246405.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum lycopersicum]
Length=813

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   MSKPYS+KTAAIID EVREW++KAY+ TVQLIE+
Sbjct  676  YAQVAVYGFSDKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYDRTVQLIEK  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYD FK GF E++  E K   E
Sbjct  736  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSHEPTNYDIFKQGF-EEENKETKVNPE  794

Query  265  NKSTKDDDS  239
            NK+ +D+ S
Sbjct  795  NKTVEDNGS  803



>gb|AAK77908.1|AF397903_1 AAA-metalloprotease FtsH [Pisum sativum]
Length=810

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+++ M+KPYS+KT AIID EVREW+ KAYE T+QLIEE
Sbjct  674  YAQVAVYGFSEKVGLLSFPQREDSMEMTKPYSSKTGAIIDTEVREWVNKAYERTIQLIEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  VA+IAELLLEKEVLHQEDL+RVLGERPF+S+EPT+YDRFK GF +  E +  +T  
Sbjct  734  HKAKVAEIAELLLEKEVLHQEDLLRVLGERPFQSAEPTHYDRFKLGFQD--EEKVVETTV  791

Query  265  NKSTKDDDSSPLQPEVVP  212
            N++  D  SSPL+PEVVP
Sbjct  792  NEAKDDGGSSPLEPEVVP  809



>ref|XP_009416148.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=809

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 5/131 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYS+KT AIIDNEVREWI+KAYE TV+LI+E
Sbjct  683  YAQVAVYGFSDKVGLLSFPQREDGFEMTKPYSSKTGAIIDNEVREWISKAYEKTVELIKE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HVAQ+A+LLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GF E++E ++     
Sbjct  743  HKDHVAQVAKLLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKQGFQEEEENKS-----  797

Query  265  NKSTKDDDSSP  233
            +  T DDD  P
Sbjct  798  SLETLDDDVVP  808



>ref|XP_009387530.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=818

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS KVGLLSFP  ++ L M+KPYS+KT AIID EVREW++KAYE TV LI+E
Sbjct  681  YAQVAVYGFSSKVGLLSFPQRDDTLEMTKPYSSKTGAIIDEEVREWVSKAYERTVALIKE  740

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HV QIAELLLEKEVLHQEDLVRVLGERPF SSEPTNYD+F  GF +D++  + +  E
Sbjct  741  HKDHVIQIAELLLEKEVLHQEDLVRVLGERPFVSSEPTNYDKFIQGF-QDEDNTSNNLPE  799

Query  265  NKSTKDDDSSPLQPEVVPV  209
            + + +DD SSPL  EVVP 
Sbjct  800  DAALEDDGSSPLNGEVVPT  818



>ref|XP_010937593.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial-like [Elaeis guineensis]
Length=820

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KPYS+KTAAIID+EVREW+ KAY+ TV+LI+E
Sbjct  683  YAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKTAAIIDSEVREWVTKAYQRTVELIKE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+ V QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E+ E E ++ ++
Sbjct  743  HKDQVIQIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEEAEDEGREPSK  802

Query  265  NKSTKDDDSSPLQPEVVPV  209
                +DD SS L  EVVP 
Sbjct  803  -AIEEDDRSSSLSGEVVPT  820



>gb|KHN32140.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E +   SKPYS+KTAAIID+EVR+W+ KAY+ T+QLIEE
Sbjct  673  YAQVAVYGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDSEVRDWVDKAYKHTIQLIEE  732

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE V +IAELLLEKEVLHQ+DL+RVLGERPFK++E TNYDRFK GF+E++E   + T +
Sbjct  733  HKEQVTEIAELLLEKEVLHQDDLLRVLGERPFKATELTNYDRFKQGFIEEEEKVVESTVD  792

Query  265  NKSTKDDDSSPLQPEVVP  212
                +   SSPL+P+VVP
Sbjct  793  TPE-EGGGSSPLEPQVVP  809



>gb|KFK32242.1| hypothetical protein AALP_AA6G216200 [Arabis alpina]
Length=802

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVREW++KAYE TV+LIEE
Sbjct  665  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYEKTVELIEE  724

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+ VAQIAELLLEKEVLHQ+DL++VLGERPFKS+E TNYDRFK GF E+ E E   T  
Sbjct  725  HKDQVAQIAELLLEKEVLHQDDLLKVLGERPFKSAEVTNYDRFKSGF-EESEQEPTTTTV  783

Query  265  NKSTKDDDSSPLQPEVVP  212
            N    +    PL+P+VVP
Sbjct  784  NPVVDEGAPPPLEPQVVP  801



>ref|XP_009375915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E +  MSKPYS+KT A+ID EVREW+ KAY  TV+L+EE
Sbjct  675  YAQVAVYGFSDKVGLLSFPQREESFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE +AQIAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K+ E      
Sbjct  735  HKEQIAQIAELLLEKEVLHQDDLIKVLGERPYKPAEATNYDRFKDGF-EEKDAEKTVETP  793

Query  265  NKSTKDDDSSPLQPEVVPV  209
               ++DD SSPL+P+V+P 
Sbjct  794  LVGSEDDGSSPLEPQVLPT  812



>ref|XP_011089809.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Sesamum indicum]
Length=826

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   MSKPYS+KTAAIID EVREW++KAYE TV+LI+E
Sbjct  689  YAQVAVYGFSEKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYERTVELIQE  748

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA++AELLLEKE L+QEDLV++LGERPFK SE TNYD+FK GF  + E   + TAE
Sbjct  749  HKEQVAKMAELLLEKETLYQEDLVQLLGERPFKPSEMTNYDKFKQGFQGENEKSGQ-TAE  807

Query  265  NKSTKDDDSSPLQPEVVPV  209
            + +T+DD SSPL P+VVP 
Sbjct  808  DGTTEDDGSSPLVPDVVPT  826



>ref|XP_009140963.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brassica rapa]
Length=803

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    +KPYSNKT AIID EVREW+AKAY  TV+LIEE
Sbjct  666  YAQVAVYGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVAKAYVKTVELIEE  725

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQEDL++VLGERPFKS+E TNYDRFK GF ED E E   T  
Sbjct  726  HKEQVAEIAELLLEKEVLHQEDLLKVLGERPFKSAEVTNYDRFKSGF-EDSEKEEAATTV  784

Query  265  NKSTKDDDSSPLQPEVVP  212
                 +  S PL+P+VVP
Sbjct  785  TPVVDEGGSPPLEPQVVP  802



>ref|XP_009804923.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009804924.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
Length=716

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++    SKPYS+KTAAIID+EVREW+AKAY+ T+QLIEE
Sbjct  533  YAQVAVYGFSDKVGLLSFPLRDDTFETSKPYSSKTAAIIDDEVREWVAKAYDRTLQLIEE  592

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAELLLEKEVLHQEDLV+VLGER F++SE TNY+RFK GF E++  E KD  +
Sbjct  593  HREHVAQIAELLLEKEVLHQEDLVQVLGERSFENSELTNYNRFKQGF-EEENREIKDIPK  651

Query  265  NKSTKDDDSSPLQPEVVPV  209
            +K+ +D+ SS    EVVP+
Sbjct  652  DKTAQDNQSSSEGSEVVPI  670



>ref|XP_007207144.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
 gb|EMJ08343.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
Length=814

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KPYS+KT AIID+EVREW+ KAY  TV++IEE
Sbjct  677  YAQVAVYGFSDKVGLLSFPQRDDGFEMAKPYSSKTGAIIDSEVREWVGKAYTRTVEIIEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK+GF E+K+ E      
Sbjct  737  HKEQVAQIAELLLEKEVLHQDDLLRVLGERPFKSSEVTNYDRFKEGF-EEKDDEKIVEIP  795

Query  265  NKSTKDDDSSPLQPEVVP  212
               +++D SSPL+P+V+P
Sbjct  796  LVGSEEDGSSPLEPQVLP  813



>ref|XP_009364366.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++  MSKPYS+KT A+ID EVREW+ KAY  TV+L+EE
Sbjct  675  YAQVAVYGFSDKVGLLSFPQREDSFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE +AQIAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K  E      
Sbjct  735  HKEQIAQIAELLLEKEVLHQDDLLKVLGERPYKPAEATNYDRFKDGF-EEKNDEKTVETP  793

Query  265  NKSTKDDDSSPLQPEVVP  212
               ++DD SSPL+P+V+P
Sbjct  794  LVGSEDDGSSPLEPQVLP  811



>gb|AAU44017.1| putative AAA-metalloprotease FtsH (fragment) [Oryza sativa Japonica 
Group]
Length=475

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  338  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITE  397

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A 
Sbjct  398  HKEQVAKIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAA  456

Query  265  NKSTKDDDSSPLQPEVVP  212
                 DDD +P   EVVP
Sbjct  457  KTPQPDDDGTPSLGEVVP  474



>emb|CDY31753.1| BnaA04g16890D [Brassica napus]
Length=788

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    +KPYSNKT AIID EVREW+AKAY  TV+LIEE
Sbjct  651  YAQVAVYGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVAKAYVKTVELIEE  710

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQEDL++VLGERPFKS+E TNYDRFK GF E ++ EA  T  
Sbjct  711  HKEQVAEIAELLLEKEVLHQEDLLKVLGERPFKSAEVTNYDRFKSGFEESEKEEAATTV-  769

Query  265  NKSTKDDDSSPLQPEVVP  212
                 +  S PL+P+VVP
Sbjct  770  TPVVDEGGSPPLEPQVVP  787



>gb|KFK43073.1| hypothetical protein AALP_AA1G075200 [Arabis alpina]
Length=814

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+AKAY+ TV+L+EE
Sbjct  678  YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVAKAYKRTVELVEE  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS+E TNYDRFK GF E  +   ++T  
Sbjct  736  HKEQVAQIAELLLEKEVLHQDDLAKVLGERPFKSAEKTNYDRFKSGFEETDKKSQEETVT  795

Query  265  NKSTKDDDSSPLQPEVVP  212
             K  +DD + PL+P+VVP
Sbjct  796  TKPVEDDGAPPLEPQVVP  813



>ref|XP_008384940.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
 ref|XP_008366266.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E +  MSKPYS+KT A+ID EVREW+ KAY  TV+L+EE
Sbjct  675  YAQVAVYGFSDKVGLLSFPQREESFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE +A+IAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K+ E      
Sbjct  735  HKEQIAEIAELLLEKEVLHQDDLIKVLGERPYKPAEATNYDRFKDGF-EEKDGEKTVETP  793

Query  265  NKSTKDDDSSPLQPEVVPV  209
               ++DD SSPL+P+V+P 
Sbjct  794  LVGSEDDGSSPLEPQVLPT  812



>ref|XP_006417796.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
 gb|ESQ36149.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
Length=815

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E     SKPYSN+T A+ID EVREW+AKAY+ TV+LIEE
Sbjct  679  YAQVAVYGFSDKIGLLSFPQREE--EFSKPYSNRTGAMIDEEVREWVAKAYKRTVELIEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   ++   
Sbjct  737  HKEQVAQIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEETEKKSQEEPVT  796

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K T+DD S PL+P+VVP 
Sbjct  797  VKPTEDDGSPPLEPQVVPT  815



>emb|CDX77230.1| BnaC04g40250D [Brassica napus]
Length=789

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    +KPYSNKT AIID EVREW+ KAYE TV+LIEE
Sbjct  652  YAQVAVYGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIEE  711

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLL+KEVLHQEDL++VLGERPFKS+E TNYDRFK GF ED E E   T  
Sbjct  712  HKEQVAEIAELLLDKEVLHQEDLLKVLGERPFKSAEVTNYDRFKSGF-EDSEKEEAATTV  770

Query  265  NKSTKDDDSSPLQPEVVP  212
                 +    PL+P+VVP
Sbjct  771  TPVVDEGGPPPLEPQVVP  788



>ref|XP_004294648.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=810

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   MSKPYS+KTAA+ID EVREW+ KAY  TV L+EE
Sbjct  675  YAQVAVYGFSDKVGLLSFPQRDDGFEMSKPYSSKTAALIDGEVREWVGKAYAHTVALLEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+ VAQIAELLLEKEVLHQ+DL+RVLGERP+KSSE +NYDRFK GF ++K  EA  +  
Sbjct  735  HKDQVAQIAELLLEKEVLHQDDLLRVLGERPYKSSEVSNYDRFKQGFEDEKTVEAPVSV-  793

Query  265  NKSTKDDDSSPLQPEVVP  212
                ++D SSPL+P+V+P
Sbjct  794  --GREEDGSSPLEPQVLP  809



>ref|XP_004961860.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Setaria italica]
Length=816

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  679  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL RVLGERPFK++EPTNYD FK GF +D + +++  A+
Sbjct  739  HKEQVAQIAELLLEKEVLHQDDLTRVLGERPFKATEPTNYDLFKQGF-QDDDDKSQAPAK  797

Query  265  NKSTKDDDSSPLQPEVVPV  209
            N    DDD+SP   EVVP 
Sbjct  798  NAELPDDDASPSLGEVVPT  816



>ref|XP_008359096.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=777

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E +  MSKPYS+KT A+ID EVREW+ KAY  TV+L+EE
Sbjct  640  YAQVAVYGFSDKVGLLSFPQREESFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEE  699

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE +A+IAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K+ E      
Sbjct  700  HKEQIAEIAELLLEKEVLHQDDLIKVLGERPYKPAEATNYDRFKDGF-EEKDGEKTVETP  758

Query  265  NKSTKDDDSSPLQPEVVP  212
               ++DD SSPL+P+V+P
Sbjct  759  LVGSEDDGSSPLEPQVLP  776



>ref|XP_008222305.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Prunus mume]
Length=814

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M+KPYS+KT AIID+EVREW+ KAY  TV++IEE
Sbjct  677  YAQVAVYGFSDKVGLLSFPQRDDGFEMAKPYSSKTGAIIDSEVREWVGKAYTRTVEIIEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  VAQIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK+GF E+K+ E      
Sbjct  737  HKVQVAQIAELLLEKEVLHQDDLLRVLGERPFKSSEVTNYDRFKEGF-EEKDDEKTVEIP  795

Query  265  NKSTKDDDSSPLQPEVVP  212
               +++D SSPL+P+V+P
Sbjct  796  LVGSEEDGSSPLEPQVLP  813



>ref|XP_006293791.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
 gb|EOA26689.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
Length=679

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVREW++KAYE TV+L+EE
Sbjct  541  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYERTVELVEE  600

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF ED E ++  T  
Sbjct  601  HKEKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EDNEKDSTTTPR  659

Query  265  NKSTKDDDS-SPLQPEVVP  212
             +   D+ +  PL+P+VVP
Sbjct  660  VEPVVDEGAPPPLEPQVVP  678



>ref|XP_010487557.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Camelina sativa]
Length=815

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  679  YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  737  HKEQVAQIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKESQKESVT  796

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K  +DD   PL+P+VVP 
Sbjct  797  VKPVEDDGVPPLEPQVVPT  815



>ref|XP_008356937.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++  MSKPYS+KT A+ID EVREW+ KAY  TV+L+EE
Sbjct  675  YAQVAVYGFSDKVGLLSFPQREDSFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE +AQIAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFK+GF E+K  E      
Sbjct  735  HKEQIAQIAELLLEKEVLHQDDLLKVLGERPYKPAEVTNYDRFKEGF-EEKNDEKTVETP  793

Query  265  NKSTKDDDSSPLQPEVVPV  209
               ++DD SSPL+P+V+P 
Sbjct  794  LVGSEDDGSSPLEPQVLPT  812



>ref|XP_010487541.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=815

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  679  YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  737  HKEQVAQIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKESQKESVT  796

Query  265  NKSTKDDDSSPLQPEVVP  212
             K  +DD   PL+P+VVP
Sbjct  797  VKPVEDDGVPPLEPQVVP  814



>gb|KDP42240.1| hypothetical protein JCGZ_02970 [Jatropha curcas]
Length=803

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP E++  MSKPYS+KT A+ID EVREW+ KAYE TVQLIEE
Sbjct  671  YAQVAVYGFSDKVGLLSFPPREDSYEMSKPYSSKTGALIDGEVREWVGKAYERTVQLIEE  730

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKET  287
            HKE VAQIAELLLEKEVLHQ+DLVRVLGERPFKSSE TNYDRFK+GF E+++ 
Sbjct  731  HKEQVAQIAELLLEKEVLHQDDLVRVLGERPFKSSEVTNYDRFKEGFKEEEKV  783



>ref|XP_010475511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Camelina sativa]
Length=815

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  679  YAQVAVYGFSDKIGLLSFPQKED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  737  HKEQVAQIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKDSQKESVT  796

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K  +DD   PL+P+VVP 
Sbjct  797  LKPVEDDGVPPLEPQVVPT  815



>ref|XP_010475512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Camelina sativa]
Length=813

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  677  YAQVAVYGFSDKIGLLSFPQKED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  735  HKEQVAQIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKDSQKESVT  794

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K  +DD   PL+P+VVP 
Sbjct  795  LKPVEDDGVPPLEPQVVPT  813



>ref|XP_010043509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW85526.1| hypothetical protein EUGRSUZ_B02323 [Eucalyptus grandis]
Length=816

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 3/140 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFSDKVGLLSFP  E+   M+KPYS+KTAA+ID EVRE + KAYE T++LI E
Sbjct  679  YAQVAIYGFSDKVGLLSFPQREDGFEMTKPYSSKTAALIDGEVREVVNKAYERTLELITE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLHQEDL+RVLGERPFKSSE TNYDR+K GF  ++E ++ +T E
Sbjct  739  HKEHVAQIAELLLEKEVLHQEDLLRVLGERPFKSSEMTNYDRYKLGF--EEEEKSTETPE  796

Query  265  NKSTKDDDS-SPLQPEVVPV  209
              + +DD+S  PL P+VVP 
Sbjct  797  TGAVEDDESPPPLDPQVVPT  816



>gb|KCW85527.1| hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis]
Length=799

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 6/139 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP       M+KPYS+KTAAIID+EVREW+ KAYE T++LI E
Sbjct  665  YAQVAVYGFSDKVGLLSFP---QGYEMTKPYSSKTAAIIDSEVREWVTKAYEHTLELITE  721

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLH EDL+RVLGERPFKSSE TNYDR+K GF+E  E ++ +T+E
Sbjct  722  HKEHVAQIAELLLEKEVLHHEDLLRVLGERPFKSSEVTNYDRYKLGFLE--EEKSAETSE  779

Query  265  NKSTKDDDS-SPLQPEVVP  212
                +DD+S  PL P+VVP
Sbjct  780  TDVVEDDESPPPLDPQVVP  798



>ref|XP_010043510.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
Length=813

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 6/139 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP       M+KPYS+KTAAIID+EVREW+ KAYE T++LI E
Sbjct  679  YAQVAVYGFSDKVGLLSFP---QGYEMTKPYSSKTAAIIDSEVREWVTKAYEHTLELITE  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHVAQIAELLLEKEVLH EDL+RVLGERPFKSSE TNYDR+K GF+E  E ++ +T+E
Sbjct  736  HKEHVAQIAELLLEKEVLHHEDLLRVLGERPFKSSEVTNYDRYKLGFLE--EEKSAETSE  793

Query  265  NKSTKDDDS-SPLQPEVVP  212
                +DD+S  PL P+VVP
Sbjct  794  TDVVEDDESPPPLDPQVVP  812



>ref|XP_010920548.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Elaeis guineensis]
Length=819

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  ++   MSKPYS+KT AIID EVREW+ KAY+ TV+L++E
Sbjct  683  YAQVAVYGFSDKIGLLSFPQRDDGFEMSKPYSSKTGAIIDAEVREWVTKAYQRTVELMKE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+HV QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E  E + K    
Sbjct  743  HKDHVIQIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQE--EEDDKGGEP  800

Query  265  NKSTKDDDSSPLQPEVVPV  209
            +K+  +DD S     VVP 
Sbjct  801  SKAVDEDDGSSSLCGVVPT  819



>ref|XP_010685724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=819

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 5/141 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYSNKT AIID EVREW+ KAY+ TV+LIEE
Sbjct  682  YAQVAVYGFSDKVGLLSFPQREDGFEMTKPYSNKTGAIIDEEVREWVTKAYKRTVELIEE  741

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVE--DKETEAKDT  272
             KE VA IAELLLEKEVLHQEDLVRVLGERP+K +E TNYDRFK GF E  DK ++A   
Sbjct  742  KKEQVATIAELLLEKEVLHQEDLVRVLGERPYKPAELTNYDRFKQGFQEEPDKSSQA---  798

Query  271  AENKSTKDDDSSPLQPEVVPV  209
            ++ ++++D+ S PL P+VVP 
Sbjct  799  SKKQTSEDEGSPPLIPDVVPT  819



>ref|XP_009781386.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=808

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++    +KPY +KTAAIID+EVREW+AKAY+ TV+L+EE
Sbjct  673  YAQVAVYGFSDKVGLLSFPQRDDTFE-AKPYGSKTAAIIDSEVREWVAKAYDNTVKLVEE  731

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAELLLEKEVLHQEDLVRVLGERPF+SSEPTNYDRF  GF E++ +E  D+ E
Sbjct  732  HREHVAQIAELLLEKEVLHQEDLVRVLGERPFQSSEPTNYDRFTQGF-EEENSETTDSTE  790

Query  265  NKSTKDDDS  239
             K+ +D+ S
Sbjct  791  EKTAEDNGS  799



>ref|XP_010469994.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010469995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=812

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVREW++KAYE T++L+EE
Sbjct  674  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYERTLELVEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF ED E ++  T  
Sbjct  734  HKEKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EDSEKDSAATPR  792

Query  265  NKSTKDDDS-SPLQPEVVP  212
             +   D+ +  PL+P+VVP
Sbjct  793  VEPVVDEGAPPPLEPQVVP  811



>ref|XP_004302718.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=812

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFSDKVGLLSFP N N   M KPYS+KT AIID+EVREW+AKAY  T++LIEE
Sbjct  675  YAQVAIYGFSDKVGLLSFPQN-NEFEMMKPYSSKTGAIIDSEVREWVAKAYTRTIELIEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKEHV QIAELLLEKEVLHQEDLVRVLGERP+KS EPTNYD+FK GF E+ +   + T E
Sbjct  734  HKEHVGQIAELLLEKEVLHQEDLVRVLGERPWKSEEPTNYDKFKQGFQEEDKEAKQTTTE  793

Query  265  NKSTKDDDS  239
             K+  D  S
Sbjct  794  GKNVNDGQS  802



>ref|NP_001055745.1| Os05g0458400 [Oryza sativa Japonica Group]
 sp|Q0DHL4.1|FTSH8_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 8, mitochondrial; 
Short=OsFTSH8; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAF17659.1| Os05g0458400 [Oryza sativa Japonica Group]
Length=822

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  685  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITE  744

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A 
Sbjct  745  HKEQVAKIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAA  803

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 DDD +P   EVVP 
Sbjct  804  KTPQPDDDGTPSLGEVVPT  822



>gb|EEC79350.1| hypothetical protein OsI_20217 [Oryza sativa Indica Group]
Length=829

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  692  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITE  751

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A 
Sbjct  752  HKEQVAKIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAA  810

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 DDD +P   EVVP 
Sbjct  811  KTPQPDDDGTPSLGEVVPT  829



>gb|EEE63976.1| hypothetical protein OsJ_18802 [Oryza sativa Japonica Group]
Length=792

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  655  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITE  714

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A 
Sbjct  715  HKEQVAKIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAA  773

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 DDD +P   EVVP 
Sbjct  774  KTPQPDDDGTPSLGEVVPT  792



>gb|ACN36802.1| unknown [Zea mays]
Length=417

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    MSKPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  281  YAQVAVYGFSEKVGLLSFPQKDGGFEMSKPYSNQTASIIDDEVREWVGKAYKKTVELITE  340

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL RVLGERPFK+ E TNYD FK GF ED    ++  AE
Sbjct  341  HKEQVAQIAELLLEKEVLHQDDLTRVLGERPFKALESTNYDLFKKGF-EDGGDNSQAPAE  399

Query  265  NKSTKDDDSSPLQPEVVP  212
            N    DD S P+  +VVP
Sbjct  400  NAELPDDSSPPVG-DVVP  416



>ref|XP_010414442.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Camelina sativa]
Length=812

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVREW++KAYE T++L+EE
Sbjct  674  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYERTIELVEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E+ E ++  T  
Sbjct  734  HKEKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EESEKDSAATPR  792

Query  265  NKSTKDDDS-SPLQPEVVP  212
             +   D+ +  PL+P+VVP
Sbjct  793  VEPVVDEGAPPPLEPQVVP  811



>ref|XP_002439915.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
 gb|EES18345.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
Length=815

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVR+W+ KAY+ TV+LI E
Sbjct  679  YAQVAVYGFSEKVGLLSFPQKDDGFEMTKPYSNQTASIIDDEVRDWVGKAYKKTVELITE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL RVLGERPFK+ EPTNYD FK GF +D + +++ T+E
Sbjct  739  HKEQVAQIAELLLEKEVLHQDDLTRVLGERPFKALEPTNYDLFKQGF-QDDDDKSQATSE  797

Query  265  NKSTKDDDSSPLQPEVVPV  209
            N    DD S PL  EVVP 
Sbjct  798  NAELPDDSSPPLG-EVVPT  815



>ref|XP_003568313.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial 
[Brachypodium distachyon]
Length=814

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   M+KPYSN+TA+IID EVR+W++KAY+ TV+L+ E
Sbjct  676  YAQVAVYGFSEKVGLLSFPQREDGFEMNKPYSNQTASIIDEEVRDWVSKAYKKTVELVTE  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL+RVLGERPFK+ E TNYD FK GF +D++ ++ + A+
Sbjct  736  HKEQVAQIAELLLEKEVLHQDDLMRVLGERPFKAVELTNYDLFKQGF-QDEDGKSPEAAK  794

Query  265  NKSTKDDDSSPLQPEVV  215
            N    DDD SP+ P+VV
Sbjct  795  NAEVPDDDGSPVLPDVV  811



>ref|XP_010521866.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=679

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSNKT A+ID EVREW++KAYE TV+LIEE
Sbjct  544  YAQVAVYGFSDKIGLLSFPQREDGYDFSKPYSNKTGAMIDEEVREWVSKAYERTVELIEE  603

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             KE VAQIAELLLEKEVLHQEDLV+VLGERPFKS+E TNYDR+K GF   +E E K    
Sbjct  604  RKEQVAQIAELLLEKEVLHQEDLVKVLGERPFKSNEVTNYDRYKSGF---EEAEKKGDEA  660

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  D    PL+P+VVP
Sbjct  661  KPAEDDGGVPPLEPQVVP  678



>ref|XP_010521865.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=809

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSNKT A+ID EVREW++KAYE TV+LIEE
Sbjct  674  YAQVAVYGFSDKIGLLSFPQREDGYDFSKPYSNKTGAMIDEEVREWVSKAYERTVELIEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             KE VAQIAELLLEKEVLHQEDLV+VLGERPFKS+E TNYDR+K GF   +E E K    
Sbjct  734  RKEQVAQIAELLLEKEVLHQEDLVKVLGERPFKSNEVTNYDRYKSGF---EEAEKKGDEA  790

Query  265  NKSTKDDDSSPLQPEVVP  212
              +  D    PL+P+VVP
Sbjct  791  KPAEDDGGVPPLEPQVVP  808



>ref|XP_002881027.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57286.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVREW+AKAYE TV+L+EE
Sbjct  680  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVREWVAKAYERTVELVEE  739

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  VAQIAELLLEKEVLHQ+DL++VLGERPFKS+E TNYDRFK GF E ++  A     
Sbjct  740  HKVKVAQIAELLLEKEVLHQDDLLKVLGERPFKSAEVTNYDRFKSGFEESEKDSAPTPTV  799

Query  265  NKSTKDDDSSPLQPEVVP  212
                 +    PL+P+V+P
Sbjct  800  EPVVDEGVPPPLEPQVIP  817



>ref|XP_009611240.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=811

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 110/130 (85%), Gaps = 2/130 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+    +KPY +KTAAIID+EVREW+AKAY+ TV+LIEE
Sbjct  675  YAQVAVYGFSDKVGLLSFPQREDTFE-AKPYGSKTAAIIDSEVREWVAKAYDNTVKLIEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H+EHVAQIAELLLEKEVLHQEDLV+VLG RPFKSSEPTNYDRF  GF E++ +E   + E
Sbjct  734  HREHVAQIAELLLEKEVLHQEDLVQVLGARPFKSSEPTNYDRFTQGF-EEENSETTASTE  792

Query  265  NKSTKDDDSS  236
             K+ +D+ SS
Sbjct  793  EKTAEDNGSS  802



>ref|XP_010542637.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010542639.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
Length=817

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+K+GLLSFPP E     SKPYSNKT A+ID EVREW++KAYE TV+LI E
Sbjct  678  YAQVAVYGFSEKIGLLSFPPREEGFDFSKPYSNKTGAMIDEEVREWVSKAYERTVELIME  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQ+AELLLE+EVLHQ+DLV+VLGERPF+S E TNYDRFK GF E  +  + + + 
Sbjct  738  HKEQVAQVAELLLEREVLHQDDLVKVLGERPFQSMEVTNYDRFKSGFEESDKPASHEGSS  797

Query  265  NKSTKDDDSS-PLQPEVVP  212
            +   +D   + PL+P+VVP
Sbjct  798  SAPVEDSGGAPPLEPQVVP  816



>ref|XP_006306790.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
 gb|EOA39688.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
Length=811

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 3/139 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  676  YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  733

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFK+ E TNYDRFK GF E +E++ K++  
Sbjct  734  HKEQVAQIAELLLEKEVLHQDDLAKVLGERPFKTGETTNYDRFKSGFEETEESQ-KESVT  792

Query  265  NKSTKDDDSSPLQPEVVPV  209
             K  + D   PL+P+VVP 
Sbjct  793  VKPVEGDGVPPLEPQVVPT  811



>emb|CBI30537.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++A  M+KPYS+KT+A+IDNEVREW+AKAY+ TV+LIEE
Sbjct  122  YAQVAVYGFSEKVGLLSFPQRDDAFEMTKPYSSKTSAVIDNEVREWVAKAYDRTVKLIEE  181

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA IAEL LEK VLHQ+DLVRVLGERPFK+SEPTNYDRFK  F +D + + ++  E
Sbjct  182  HKEPVAMIAELSLEK-VLHQDDLVRVLGERPFKTSEPTNYDRFKQWF-QDGDKKNREVTE  239

Query  265  NKSTKDDDSSPLQPEV  218
            ++  +   SS  +PE+
Sbjct  240  SECVEIGRSSTFKPEM  255



>ref|XP_003606687.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES88884.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=807

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFS+KVGLLSFP NE+     KPYS  T  IID EVR+W+  AYE TVQLIEE
Sbjct  673  YAQVAIYGFSEKVGLLSFPQNED--QFGKPYSGDTGNIIDQEVRDWVNHAYERTVQLIEE  730

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE +AQIAELLLEKEVLHQEDLVR+LGERPFKS+EPTNYDRFK GF +D+E +A +T  
Sbjct  731  HKEKLAQIAELLLEKEVLHQEDLVRILGERPFKSAEPTNYDRFKLGF-QDEE-KAAETTV  788

Query  265  NKSTKDDDSSPLQPEVVP  212
            +++ +   SSPL+PEVVP
Sbjct  789  DEAEEGSGSSPLEPEVVP  806



>ref|XP_010510537.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Camelina sativa]
Length=809

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVR+W++KAYE T++L+EE
Sbjct  671  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVRDWVSKAYERTLELVEE  730

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLL+KEVLHQ+DL+++LGERPFKS+E TNYDRFK GF ED E ++  T  
Sbjct  731  HKEKVAEIAELLLDKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EDSEKDSAATPR  789

Query  265  NKSTKDDDS-SPLQPEVVPV  209
             +   D+ +  PL+P+VVP 
Sbjct  790  VEPVVDEGAPPPLEPQVVPT  809



>ref|XP_002313426.1| FtsH protease family protein [Populus trichocarpa]
 gb|EEE87381.1| FtsH protease family protein [Populus trichocarpa]
Length=786

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++  M+KPYSN+T AIID+EVREW+ KAY  TVQL+E+
Sbjct  651  YAQVAVYGFSDKVGLLSFPQKEDSFEMTKPYSNETGAIIDSEVREWVGKAYGHTVQLVEK  710

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDL+RVLGERPFKSSE +NYD FK GF E++E + +  A 
Sbjct  711  HKEQVAQIAELLLEKEVLHQEDLIRVLGERPFKSSEVSNYDIFKQGF-EEEEKKVETPAS  769

Query  265  NKSTKDDDSSPLQPEVVP  212
                 +D SSP+  E VP
Sbjct  770  TTDGDEDQSSPI--EAVP  785



>gb|AFW82207.1| hypothetical protein ZEAMMB73_958383 [Zea mays]
Length=815

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    MSKPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  679  YAQVAVYGFSEKVGLLSFPQKDGGFEMSKPYSNQTASIIDDEVREWVGKAYKKTVELITE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL RVLGERPFK+ EPTNYD FK GF ED    ++  AE
Sbjct  739  HKEQVAQIAELLLEKEVLHQDDLTRVLGERPFKALEPTNYDLFKKGF-EDGGDNSQAPAE  797

Query  265  NKSTKDDDSSPLQPEVVPV  209
            N    DD S P+  +VVP 
Sbjct  798  NAELPDDSSPPVG-DVVPT  815



>ref|NP_850129.1| FTSH protease 3 [Arabidopsis thaliana]
 sp|Q84WU8.1|FTSH3_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=AtFTSH3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22572.1| putative AAA-type ATPase [Arabidopsis thaliana]
 gb|AEC08208.1| FTSH protease 3 [Arabidopsis thaliana]
Length=809

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVR+W+AKAYE TV+L+EE
Sbjct  671  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEE  730

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  VA+IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A     
Sbjct  731  HKVKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTV  790

Query  265  NKSTKDDDSSPLQPEVVP  212
                 D    P +P+VVP
Sbjct  791  EPVVDDGAPPPFEPQVVP  808



>gb|AAL36270.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=809

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVR+W+AKAYE TV+L+EE
Sbjct  671  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEE  730

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  VA+IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A     
Sbjct  731  HKVKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTV  790

Query  265  NKSTKDDDSSPLQPEVVP  212
                 D    P +P+VVP
Sbjct  791  EPVVDDGAPPPFEPQVVP  808



>gb|AAC33234.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=807

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVR+W+AKAYE TV+L+EE
Sbjct  669  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEE  728

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  VA+IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A     
Sbjct  729  HKVKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTV  788

Query  265  NKSTKDDDSSPLQPEVVP  212
                 D    P +P+VVP
Sbjct  789  EPVVDDGAPPPFEPQVVP  806



>dbj|BAE98430.1| AAA-type like ATPase [Arabidopsis thaliana]
Length=326

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVR+W+AKAYE TV+L+EE
Sbjct  201  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEE  260

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVE-DKETEAKDTA  269
            HK  VA+IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E +K++ A  T 
Sbjct  261  HKVKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTV  320

Query  268  E  266
            E
Sbjct  321  E  321



>ref|XP_007133225.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
 gb|ESW05219.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
Length=811

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFPP E++  MSKPYS+KTAAIID+EVREW+ KAYE TVQLIEE
Sbjct  672  YAQVAVYGFSEKVGLLSFPPREDSFEMSKPYSSKTAAIIDSEVREWVNKAYERTVQLIEE  731

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETE-AKDTA  269
            HKE VAQIAELLLEKEVLHQEDL R+LGERPFKS EPTNYDRFK+GF E++E + A+   
Sbjct  732  HKEQVAQIAELLLEKEVLHQEDLHRILGERPFKSIEPTNYDRFKEGFKEEEEEKVAESII  791

Query  268  ENKSTKDDDSSPLQPEVVP  212
             +   +   SSPL+P+VVP
Sbjct  792  VDVPEQGGGSSPLEPQVVP  810



>ref|NP_172231.2| FTSH protease 10 [Arabidopsis thaliana]
 sp|Q8VZI8.1|FTSHA_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 10, mitochondrial; 
Short=AtFTSH10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36045.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AAM70517.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AEE28137.1| FTSH protease 10 [Arabidopsis thaliana]
Length=813

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  677  YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  735  HKEQVAQIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEESEKESQKESVP  794

Query  265  NKSTKDDDSSPLQPEVVP  212
             K  +DD   PL+P+VVP
Sbjct  795  VKPVEDDGIPPLEPQVVP  812



>gb|AAF79577.1|AC022464_35 F22G5.10 [Arabidopsis thaliana]
Length=843

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  707  YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  764

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  765  HKEQVAQIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEESEKESQKESVP  824

Query  265  NKSTKDDDSSPLQPEVVP  212
             K  +DD   PL+P+VVP
Sbjct  825  VKPVEDDGIPPLEPQVVP  842



>ref|XP_009118433.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Brassica rapa]
 emb|CDY06264.1| BnaA09g49390D [Brassica napus]
Length=800

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 112/140 (80%), Gaps = 7/140 (5%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E     SKPYSN+T A+ID EVREW+AKAY+ TV+LIEE
Sbjct  667  YAQVAVYGFSDKIGLLSFPQREE--EFSKPYSNRTGALIDEEVREWVAKAYKRTVELIEE  724

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF   +ET+ K+   
Sbjct  725  HKEQVAQIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGF---EETD-KENVT  780

Query  265  NKSTKDDDSS-PLQPEVVPV  209
             K  +DD +S PL+P+VVP 
Sbjct  781  VKPVEDDGASPPLEPQVVPT  800



>emb|CDP09082.1| unnamed protein product [Coffea canephora]
Length=821

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP   +   M++PY +KTAAIID EVREW+ KAY  TV+LIEE
Sbjct  685  YAQVAVYGFSEKVGLLSFP-QRDEFEMTRPYGSKTAAIIDAEVREWVGKAYNRTVELIEE  743

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DLV+VLG+RPF+S+E TNYDR+K GF E++  + K   +
Sbjct  744  HKERVAKIAELLLEKEVLHQDDLVQVLGKRPFESAEVTNYDRYKQGF-EEEVQKTKQAID  802

Query  265  NKSTKDDDSSPLQPEVVP  212
            +++T DD  SPL+PEVVP
Sbjct  803  DRTTNDDGPSPLEPEVVP  820



>emb|CDY39531.1| BnaC04g15300D [Brassica napus]
Length=822

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 109/139 (78%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    +KPYSNKT AIID EVREW+ KAYE TV+LIE 
Sbjct  685  YAQVAVYGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIET  744

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DL++VLGERPFK +E TNYDRFK GF E+++ EA  T  
Sbjct  745  HKEKVAEIAELLLEKEVLHQDDLLKVLGERPFKPAEVTNYDRFKSGFEENEKEEATPTVA  804

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 +    PL+P+VVP 
Sbjct  805  -PVVDEGAPPPLEPQVVPT  822



>ref|XP_009125053.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Brassica rapa]
Length=814

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    +KPYSNKT AIID EVREW+ KAYE TV+LIE 
Sbjct  677  YAQVAVYGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIET  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DL++VLGERPFK +E TNYDRFK GF E ++ EA  T  
Sbjct  737  HKEKVAEIAELLLEKEVLHQDDLLKVLGERPFKPAEVTNYDRFKSGFEESEKEEATPTVA  796

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 +    PL+P+VVP 
Sbjct  797  -PVVDEGAPPPLEPQVVPT  814



>ref|XP_006409951.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
 gb|ESQ51404.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
Length=813

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    SKPYSNKT AIID EVR+W++KAYE TV+LIEE
Sbjct  676  YAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVSKAYEKTVELIEE  735

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL++VLGERPFKS+E TNYDRFK GF E+ E E   T  
Sbjct  736  HKEQVAQIAELLLEKEVLHQDDLLKVLGERPFKSAEVTNYDRFKSGF-EESEKEETTTTV  794

Query  265  NKSTKDDDSSPLQPEVVP  212
                 +    PL+P+VVP
Sbjct  795  TPVVDEGAPPPLEPQVVP  812



>emb|CDY47876.1| BnaA07g14210D [Brassica napus]
Length=830

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++    +KPYSNKT AIID EVREW+ KAYE TV+LIE 
Sbjct  693  YAQVAVYGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIET  752

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DL++VLGERPFK +E TNYDRFK GF E ++ EA  T  
Sbjct  753  HKEKVAEIAELLLEKEVLHQDDLLKVLGERPFKPAEVTNYDRFKSGFEESEKEEATPTVA  812

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 +    PL+P+VVP 
Sbjct  813  -PVVDEGAPPPLEPQVVPT  830



>ref|XP_006655377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Oryza brachyantha]
Length=798

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  ++   M+KPYSN+TA+IID+EVREW+ KAY+ TV+LI +
Sbjct  662  YAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKNTVELITK  721

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAE+LLEKEVLHQ+DLVRVLGERPFK+ EPTNYD FK GF +D++ + ++  +
Sbjct  722  HKEQVAKIAEMLLEKEVLHQDDLVRVLGERPFKAVEPTNYDLFKQGF-QDEDNKNQEVVK  780

Query  265  NKSTKDDDSSPLQPEVVP  212
            N    DDD +P   EVVP
Sbjct  781  NPQP-DDDGTPSLGEVVP  797



>ref|XP_002889652.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65911.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
Length=813

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E+    SKPYSN+T A+ID EVREW+ KAY+ TV+LIEE
Sbjct  677  YAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEE  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++  
Sbjct  735  HKEQVAQIAELLLEKEVLHQDDLTKVLGERPFKSGERTNYDRFKSGFEETEKESEKESVP  794

Query  265  NKSTKDDDSSPLQPEVVP  212
             K  +D    PL+P+VVP
Sbjct  795  VKPVEDGGVPPLEPQVVP  812



>ref|XP_008799731.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=820

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  ++   M  PYS+KTAAIID EVREW++KAY+ TV+LI+E
Sbjct  683  YAQVAVYGFSDKVGLLSFPQRDDTSAMIMPYSSKTAAIIDAEVREWVSKAYQRTVELIKE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            H +HV QIAELLLEKEVL Q+DLVRVLGERPFK  EPTNYDRFK GF E+ + E ++ ++
Sbjct  743  HTDHVIQIAELLLEKEVLRQDDLVRVLGERPFKLGEPTNYDRFKQGFQEEVDDEGREPSK  802

Query  265  NKSTKDDDSSPLQPEVVPV  209
                +DD SS L  EVVP 
Sbjct  803  VME-EDDRSSSLSGEVVPT  820



>ref|XP_011032280.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
 ref|XP_011042728.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
Length=813

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 111/138 (80%), Gaps = 3/138 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E++  M+KPYSN+T AIID EVREW+ KAY  T+QL+E+
Sbjct  678  YAQVAVYGFSDKVGLLSFPQKEDSFEMTKPYSNETGAIIDGEVREWVGKAYGHTLQLVEK  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQEDL+R+LGERPFKSSE +NYD FK GF E++E + +  A 
Sbjct  738  HKEQVAQIAELLLEKEVLHQEDLIRILGERPFKSSEASNYDIFKQGF-EEEEEKVETPAS  796

Query  265  NKSTKDDDSSPLQPEVVP  212
                 +D SSP+  EVVP
Sbjct  797  TTDGDEDQSSPI--EVVP  812



>ref|XP_004970544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Setaria italica]
Length=810

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   MSKPY  +TA+IID EVREW+AKAYE T+ LI+ 
Sbjct  679  YAQVAVYGFSEKVGLLSFPQREDGFGMSKPYGGETASIIDTEVREWVAKAYEKTLDLIKT  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF-VEDKETEAKDTA  269
            HKE VAQIAELLLEKEVLHQ+DLVRVLGERPFK++EPTNYDRFK GF VE+ +  A+ + 
Sbjct  739  HKEQVAQIAELLLEKEVLHQDDLVRVLGERPFKTAEPTNYDRFKQGFQVEESDKSAEVSD  798

Query  268  ENKST  254
             N S+
Sbjct  799  ANPSS  803



>ref|XP_003567261.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brachypodium distachyon]
Length=635

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 110/138 (80%), Gaps = 9/138 (7%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFS+KVGLLSFP  ++   M+KPYS++TA+IID EVREW+A+AY+ T++LI++
Sbjct  506  YAQVALYGFSEKVGLLSFPQRDDGFEMNKPYSSQTASIIDTEVREWVAEAYKHTIELIKK  565

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DLVRVLGERPFK+ EP NYDRFK GF+        D   
Sbjct  566  HKEQVAQIAELLLEKEVLHQDDLVRVLGERPFKTVEPINYDRFKHGFI--------DADN  617

Query  265  NKSTKDDDSSPLQPEVVP  212
            NKST+ D SS L  E VP
Sbjct  618  NKSTEVDPSSSLG-EAVP  634



>ref|XP_004507174.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=800

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 106/139 (76%), Gaps = 11/139 (8%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFSDKVGLLSFP  E++  M+KPYS+KT AIID EVREW+ KAYE T+QLIE+
Sbjct  673  YDQVAVYGFSDKVGLLSFPQREDSYGMAKPYSSKTGAIIDTEVREWVNKAYEHTLQLIEK  732

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKEVLHQ+DL +VLGERPFK++E +NYDRFK GF ED +        
Sbjct  733  HKEQVAQIAELLLEKEVLHQDDLRQVLGERPFKNAELSNYDRFKLGFQEDDKEGG-----  787

Query  265  NKSTKDDDSSPLQPEVVPV  209
                    SSPL PEVVP 
Sbjct  788  ------GSSSPLDPEVVPT  800



>emb|CDY09913.1| BnaC08g45380D [Brassica napus]
Length=767

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 7/138 (5%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GLLSFP  E     SKPYSN+T A+ID EVREW+AKAY+ TV+LIEE
Sbjct  634  YAQVAVYGFSDKIGLLSFPQREE--EFSKPYSNRTGALIDEEVREWVAKAYKRTVELIEE  691

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VA+IAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF   +ET+ K+   
Sbjct  692  HKEQVAEIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGF---EETD-KENVT  747

Query  265  NKSTKDDDSS-PLQPEVV  215
             K  +DD +S PL+P+VV
Sbjct  748  VKPVEDDGASPPLEPQVV  765



>ref|XP_006644995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Oryza brachyantha]
Length=807

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFS+KVGLLSFP  E+   MS+PYS++TA+IID EVREW+AKAYE TV+LI++
Sbjct  675  YAQVAIYGFSEKVGLLSFPQREDGFEMSRPYSSQTASIIDTEVREWVAKAYETTVELIKK  734

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+ VAQIAELLLEKEV+HQ+DLVR+LGERPFK+ EPTNYDRFK GF ++  + + + ++
Sbjct  735  HKDQVAQIAELLLEKEVIHQDDLVRILGERPFKTLEPTNYDRFKQGFEDEGSSNSAEVSD  794

Query  265  NKST  254
               T
Sbjct  795  VDGT  798



>ref|XP_008784613.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=817

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK+GL+SFP  ++A  MSKPYS+KT AIID EVREW+ KAY+ TV+LI+E
Sbjct  683  YAQVAVYGFSDKIGLVSFPQRDDAFEMSKPYSSKTGAIIDAEVREWVTKAYQRTVELIKE  742

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+H+ +IAELLLEKEVLHQ+DLV VLGER FKSSEPTNYDRFK GF E+ E E     E
Sbjct  743  HKDHITRIAELLLEKEVLHQDDLVGVLGERTFKSSEPTNYDRFKQGFQEEDEREPSKVVE  802



>ref|NP_001044774.1| Os01g0842600 [Oryza sativa Japonica Group]
 sp|Q8S2A7.1|FTSH3_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=OsFTSH3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB86453.1| putative AAA-metalloprotease FtsH [Oryza sativa Japonica Group]
 dbj|BAF06688.1| Os01g0842600 [Oryza sativa Japonica Group]
 gb|EAZ14117.1| hypothetical protein OsJ_04041 [Oryza sativa Japonica Group]
 dbj|BAG94510.1| unnamed protein product [Oryza sativa Japonica Group]
Length=802

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   MSKPYS++TA+IID EVREW+AKAYE TV+LI++
Sbjct  670  YAQVAVYGFSEKVGLLSFPQREDGFEMSKPYSSQTASIIDTEVREWVAKAYEKTVELIKQ  729

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            HK+ VAQIAELLLEKEVLHQ+DLV+VLGERPFK+ EPTNYDRFK GF
Sbjct  730  HKDQVAQIAELLLEKEVLHQDDLVQVLGERPFKTLEPTNYDRFKQGF  776



>gb|EAY76461.1| hypothetical protein OsI_04395 [Oryza sativa Indica Group]
Length=802

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   MSKPYS++TA+IID EVREW+AKAYE TV+LI++
Sbjct  670  YAQVAVYGFSEKVGLLSFPQREDGFEMSKPYSSQTASIIDTEVREWVAKAYEKTVELIKQ  729

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            HK+ VAQIAELLLEKEVLHQ+DLV+VLGERPFK+ EPTNYDRFK GF
Sbjct  730  HKDQVAQIAELLLEKEVLHQDDLVQVLGERPFKTLEPTNYDRFKQGF  776



>dbj|BAJ98147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91973.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03446.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93081.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=811

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 107/137 (78%), Gaps = 1/137 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYSN+TA+IID EVREW+AKAY+ TV L+ E
Sbjct  673  YAQVAVYGFSDKVGLLSFPQREDGFEMNKPYSNQTASIIDTEVREWVAKAYKRTVDLLTE  732

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             KE VA IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D+E +  +  +
Sbjct  733  KKEQVALIAELLLEKEVLHQDDLTRVLGDRPFKAAELTNYDLFKQGF-QDEEGKTAEPTK  791

Query  265  NKSTKDDDSSPLQPEVV  215
            +    DDD S + P VV
Sbjct  792  DTEVPDDDGSAVLPNVV  808



>ref|XP_006845226.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
 gb|ERN06901.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
Length=825

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%), Gaps = 1/139 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E A  M+KPYSN T  IID EVR+W++ AY+ T++LIEE
Sbjct  688  YAQVAVYGFSDKVGLLSFPQREEAFEMTKPYSNGTGEIIDKEVRDWVSNAYKRTLELIEE  747

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             +E VA++AELLLEKEVLHQ+DL++VLGERP+KSSEPTNYDRF  GF E++E E  D   
Sbjct  748  KREQVAKVAELLLEKEVLHQDDLLKVLGERPYKSSEPTNYDRFTKGFQEEQE-EKSDAPS  806

Query  265  NKSTKDDDSSPLQPEVVPV  209
                 +DD+  L   VVP 
Sbjct  807  EGVVMEDDTPSLDGAVVPT  825



>ref|XP_007132051.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
 gb|ESW04045.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
Length=809

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E++  MSKPYS+KTAA+ID+EVR+W+ KAYE T+ LIEE
Sbjct  671  YAQVAVYGFSEKVGLLSFPSREDSFEMSKPYSSKTAALIDSEVRDWVNKAYERTLHLIEE  730

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQ+A+LLLEKEVLHQEDL  +LGERPFK++EPTNYDRFK+GF E++E  A+ +  
Sbjct  731  HKEQVAQLAQLLLEKEVLHQEDLRGILGERPFKATEPTNYDRFKEGFEEEEEKVAESSIV  790

Query  265  NKSTKDDDSSPLQPEVVP  212
            +   +   SSPL+P+VVP
Sbjct  791  DVPEEGGGSSPLEPQVVP  808



>gb|KJB16965.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=782

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDK GLLSFP    A  M+ PYS+ T AIID+EVREW+ KAY+ TVQLIEE
Sbjct  679  YAQVAVYGFSDKAGLLSFPRTHYAFEMTMPYSSTTGAIIDSEVREWVGKAYDRTVQLIEE  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
            HKEHVAQI ELLLEK++LHQEDLVRVLGERPFKSSEPTNYDRF
Sbjct  739  HKEHVAQITELLLEKDILHQEDLVRVLGERPFKSSEPTNYDRF  781



>gb|EYU38460.1| hypothetical protein MIMGU_mgv1a001496mg [Erythranthe guttata]
Length=808

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 104/139 (75%), Gaps = 15/139 (11%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+   M KPYS+KTAAIID EVREW AKAY+ TV+LIEE
Sbjct  685  YAQVAVYGFSEKVGLLSFPQREDGYEMMKPYSSKTAAIIDTEVREWAAKAYKRTVELIEE  744

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HKE VAQIAELLLEKE LHQEDLV+VLG RPF+SSE TNYDR+K GF ++   EA     
Sbjct  745  HKEQVAQIAELLLEKETLHQEDLVQVLGPRPFQSSEMTNYDRYKKGFQDEAAEEA-----  799

Query  265  NKSTKDDDSSPLQPEVVPV  209
                       + PEVVPV
Sbjct  800  ----------VVLPEVVPV  808



>ref|XP_002458748.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
 gb|EES03868.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
Length=808

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 99/120 (83%), Gaps = 5/120 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    MSKPYS+ TA+IID EVREW+AKAY+ TV LI+ 
Sbjct  680  YAQVAVYGFSEKVGLLSFP--QKGFEMSKPYSSHTASIIDTEVREWVAKAYQRTVDLIKT  737

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF---VEDKETEAKD  275
            HKE VAQIAELLLEKEVLH +DLVRVLGERPFK++EPTNYDRFK GF   V DK +E  D
Sbjct  738  HKEQVAQIAELLLEKEVLHHDDLVRVLGERPFKTAEPTNYDRFKQGFQAEVVDKSSEVAD  797



>gb|EMS50561.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 
urartu]
Length=748

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP   +   M+KPYSN+TA+IID EVREW+AKAY+ TV+L+ E
Sbjct  609  YAQVAVYGFSDKVGLLSFPQRGDGFEMNKPYSNQTASIIDTEVREWVAKAYKRTVELLTE  668

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             KE VA IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D++++  + A+
Sbjct  669  KKEQVALIAELLLEKEVLHQDDLTRVLGDRPFKAAELTNYDLFKQGF-QDEDSKTTEPAK  727

Query  265  NKSTKDDDS-SPLQPEVV  215
            N    DDD  +   P+VV
Sbjct  728  NAEVPDDDGPAAALPDVV  745



>gb|KJB36698.1| hypothetical protein B456_006G171800 [Gossypium raimondii]
Length=617

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 16/139 (12%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLS P   +A  M+KPYS+KT AIID+EVREW+ KAYE T+QLIEE
Sbjct  493  YAQVAVYGFSDKVGLLSVP-QRDAFEMTKPYSSKTGAIIDSEVREWVVKAYEPTMQLIEE  551

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTA-  269
            HKEHVAQ             EDL+R+LG+RPFKSSEPTNY+RFK GF E+ + E KDT  
Sbjct  552  HKEHVAQ-------------EDLIRILGKRPFKSSEPTNYERFKQGFQEENK-EPKDTKD  597

Query  268  ENKSTKDDDSSPLQPEVVP  212
            E ++  DD S+PL+PEVVP
Sbjct  598  EGRTAGDDGSTPLKPEVVP  616



>gb|EMT04659.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=703

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYSN+TA+IID EVREW+AKAY+ TV L+ E
Sbjct  564  YAQVAVYGFSDKVGLLSFPQREDGFEMNKPYSNQTASIIDTEVREWVAKAYKRTVDLLTE  623

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             KE VA IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D+E +  + A+
Sbjct  624  KKEQVALIAELLLEKEVLHQDDLTRVLGDRPFKAAELTNYDLFKQGF-QDEEGKTTEPAK  682

Query  265  NKSTKDDDS-SPLQPEVV  215
                 DDD  +   P+VV
Sbjct  683  PAEVPDDDGPAAALPDVV  700



>ref|XP_008358519.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=800

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQ+AV+GF+DKVGLLSFP  E +  MSKPYS+KT A+ID+EVREW+ KAY  TV+L+EE
Sbjct  677  YAQIAVHGFNDKVGLLSFPQREESFEMSKPYSSKTGALIDSEVREWVGKAYARTVELVEE  736

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTA  269
            HKE VAQIAELLLEKEVLHQ+DL++VLG RP+K +E TNYDRFK+GF    + +  +TA
Sbjct  737  HKEQVAQIAELLLEKEVLHQDDLLKVLGGRPYKPAEATNYDRFKEGFEGKGDEKTVETA  795



>emb|CDM84966.1| unnamed protein product [Triticum aestivum]
Length=760

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFS+KVGLLSFP  ++   M KPYS +TA++ID EVRE +AKAY  T +LI +
Sbjct  631  YQQVAVYGFSEKVGLLSFPQRDDGFWMDKPYSGQTASMIDTEVRELVAKAYNTTTELIRK  690

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+ VAQ+AELLLEKEVLHQ+DL+RVLGERPFK+ EPTNYDRFK GF++ +++++ +   
Sbjct  691  HKDKVAQVAELLLEKEVLHQDDLIRVLGERPFKTDEPTNYDRFKQGFMDSEDSKSGEVDP  750

Query  265  NKS  257
            + S
Sbjct  751  SSS  753



>ref|XP_001785268.1| predicted protein [Physcomitrella patens]
 gb|EDQ49920.1| predicted protein [Physcomitrella patens]
Length=693

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFPP ++   MSKPYSN+T  IID EVR+W+A AY  T+ LI E
Sbjct  542  YAQVAVYGFSDKVGLLSFPPKDDGFEMSKPYSNETGEIIDQEVRDWVASAYARTLALITE  601

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK  V  +A  LLEKEVLHQEDLV +LGERPFK++E +NYD+FK GF   +E +AK  + 
Sbjct  602  HKAGVEALALKLLEKEVLHQEDLVAILGERPFKNAELSNYDKFKLGFAPSREDQAKLGSS  661

Query  265  NKSTKDDDSSPLQPEVVP  212
              S  +D  SP QP   P
Sbjct  662  QPS--EDGISPEQPSSTP  677



>gb|EPS71434.1| hypothetical protein M569_03325, partial [Genlisea aurea]
Length=778

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFSDKVGLLSFP  E+   M+KPYSNKTAAIID EVREWIA+AYE T+ LIEE
Sbjct  670  YAQVAVYGFSDKVGLLSFPQREDGFEMTKPYSNKTAAIIDGEVREWIARAYEKTLSLIEE  729

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
             +E VA++AELLL KE LHQEDLV+ LGERPF+ +E +NYD FK GF
Sbjct  730  RREEVAKVAELLLAKETLHQEDLVQALGERPFRPAETSNYDIFKHGF  776



>gb|EMT07840.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=953

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFS+KVGLLSFP   +   M KPYS +TA++ID EVRE +AKAY  T +LI +
Sbjct  693  YEQVAVYGFSEKVGLLSFPQRYDGFGMDKPYSGQTASMIDTEVRELVAKAYNTTTELIRK  752

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKET  287
            HK+ VAQ+AELLLEKEVLHQ+DLVRVLGERPFK++EPTNYDRFK GF++ +++
Sbjct  753  HKDKVAQVAELLLEKEVLHQDDLVRVLGERPFKTAEPTNYDRFKQGFMDSEDS  805



>gb|EMS48627.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 
urartu]
Length=808

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 103/139 (74%), Gaps = 9/139 (6%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFS+KVGLLSFP   +   M KPYS +TA++ID EVRE +AKAY  T +LI +
Sbjct  679  YEQVAVYGFSEKVGLLSFPQRYDGFGMDKPYSGQTASMIDTEVRELVAKAYNTTTELIRK  738

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            HK+ VAQ+AELLLEKEVLHQ+DLVRVLGERPFK  EPTNYDRFK GF+        D+ +
Sbjct  739  HKDKVAQVAELLLEKEVLHQDDLVRVLGERPFKPDEPTNYDRFKQGFM--------DSED  790

Query  265  NKSTKDDDSSPLQPEVVPV  209
            +KS + D SS +  E VP 
Sbjct  791  SKSAEVDPSSSVG-EAVPT  808



>gb|KEH23850.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=701

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E++L MSKPYSNKT AIIDNEVREW+ KAYE TVQLIE+
Sbjct  593  YAQVAVYGFSEKVGLLSFPQKEDSLEMSKPYSNKTGAIIDNEVREWVDKAYERTVQLIEK  652

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSE  338
             KE VAQ+AELLLEKEVLHQ+DL+ +LG RPFKS+E
Sbjct  653  QKEKVAQLAELLLEKEVLHQDDLLPILGVRPFKSTE  688



>ref|XP_001782950.1| predicted protein [Physcomitrella patens]
 gb|EDQ52248.1| predicted protein [Physcomitrella patens]
Length=872

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFPP ++ L MSKPYSN+T  IID E R+W+A AYE T+ LI  
Sbjct  721  YAQVAVYGFSEKVGLLSFPPKDDGLEMSKPYSNETGEIIDKEARDWVALAYERTLALITR  780

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAK  278
            HKE V  +A  LLEKEVLHQEDLV +LGERPFK +E +NYD+FK GF   ++ + K
Sbjct  781  HKEGVEALALKLLEKEVLHQEDLVAILGERPFKHAELSNYDKFKLGFPSSRDDQVK  836



>ref|NP_001145329.1| uncharacterized protein LOC100278654 [Zea mays]
 gb|ACG46821.1| hypothetical protein [Zea mays]
Length=485

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +    +SKPYSN+TA+IID+EVREW+ KAY+ TV+LI E
Sbjct  338  YAQVAVYGFSEKVGLLSFPQKDGGFELSKPYSNQTASIIDDEVREWVGKAYKKTVELITE  397

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKS-SEPTN  329
            HKE VAQIAELLLEKEVLHQ+DL RVLGERPFK+  +PT 
Sbjct  398  HKEQVAQIAELLLEKEVLHQDDLTRVLGERPFKALDQPTT  437



>ref|XP_006845235.1| hypothetical protein AMTR_s00005p00257870 [Amborella trichopoda]
 gb|ERN06910.1| hypothetical protein AMTR_s00005p00257870 [Amborella trichopoda]
Length=369

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  +     +KPYSN+T  IID EVR+WI KAY+ T++LIEE
Sbjct  256  YAQVAVYGFSEKVGLLSFPQKDEGYERTKPYSNRTEEIIDKEVRDWITKAYDRTLELIEE  315

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
             +  V +IAELLL+KEVLH+ DL+++LGERPF SSEPTNYD F  GF ++++
Sbjct  316  KRGQVVKIAELLLQKEVLHKHDLLKMLGERPFMSSEPTNYDPFTKGFQDEQQ  367



>ref|XP_001759881.1| predicted protein [Physcomitrella patens]
 gb|EDQ75385.1| predicted protein [Physcomitrella patens]
Length=670

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFPP ++ L MSKPYSN+T  IID EVR+W+  AY  T+ LI +
Sbjct  519  YAQVAVYGFSEKVGLLSFPPKDDGLEMSKPYSNETGEIIDQEVRDWMGTAYARTLALITK  578

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAK  278
            HK  V  +A  LLEKEVLHQEDLV +LG RPF  SE +NYD+FK GF   KE +AK
Sbjct  579  HKAGVEALALRLLEKEVLHQEDLVAILGPRPFHHSELSNYDKFKLGFEPSKEDQAK  634



>gb|AES75793.2| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=681

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQV VYGFS+KVGLLSFP  E++   SKPYS++T+AIIDNEVR+W+ KAY+ T++LIEE
Sbjct  550  YAQVTVYGFSEKVGLLSFPSIEDSFETSKPYSSETSAIIDNEVRDWVKKAYKHTIELIEE  609

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGER-PFKSSEPTNYDRFKDGFVEDKETEAKDT  272
            +K  VA++AELLLEKEVLHQ++L++VLG R PFKS+E  NYD+ K G     + EAKD 
Sbjct  610  YKGKVAEVAELLLEKEVLHQDELLKVLGVRLPFKSAEHDNYDQIKLGI----QDEAKDV  664



>ref|XP_003619575.1| Cell division protease ftsH-like protein [Medicago truncatula]
Length=765

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQV VYGFS+KVGLLSFP  E++   SKPYS++T+AIIDNEVR+W+ KAY+ T++LIEE
Sbjct  580  YAQVTVYGFSEKVGLLSFPSIEDSFETSKPYSSETSAIIDNEVRDWVKKAYKHTIELIEE  639

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGER-PFKSSEPTNYDRFKDGFVEDKETEAKDT  272
            +K  VA++AELLLEKEVLHQ++L++VLG R PFKS+E  NYD+ K G     + EAKD 
Sbjct  640  YKGKVAEVAELLLEKEVLHQDELLKVLGVRLPFKSAEHDNYDQIKLGI----QDEAKDV  694



>ref|XP_003624038.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES80256.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=643

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YGFS+KVGLLSFP  E++   SKPYS+KT AIIDNEVREW+ KAY+ T+QLIEE
Sbjct  545  YAQVAIYGFSEKVGLLSFPQREDSSETSKPYSSKTGAIIDNEVREWVNKAYKHTIQLIEE  604

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGER--PFKSSE  338
             K  VA+IAELLLEKEVLHQ+DL++VLG R  PFKS+E
Sbjct  605  RKGKVAEIAELLLEKEVLHQDDLLQVLGPRPSPFKSAE  642



>ref|XP_006845231.1| hypothetical protein AMTR_s00005p00257390 [Amborella trichopoda]
 gb|ERN06906.1| hypothetical protein AMTR_s00005p00257390 [Amborella trichopoda]
Length=504

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -2

Query  598  SDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIA  419
            S+KVGLLSFP  +     ++PYSN+T  IID EVR+W+ KAY+ T++LIEE +E V +IA
Sbjct  400  SEKVGLLSFPQKDEGYERTQPYSNRTEEIIDKEVRDWVTKAYDRTLELIEEKREQVVKIA  459

Query  418  ELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
            ELLLE+EVLH+ DL++VLGERPFKSSEPTNYD F  GF E+++
Sbjct  460  ELLLEREVLHKHDLLKVLGERPFKSSEPTNYDPFTKGFQEEQQ  502



>ref|XP_002981661.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
 gb|EFJ17143.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
Length=737

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+ + +SKPYSN+T  +ID EVREW  +AY+ TV L+EE
Sbjct  596  YAQVAVYGFSEKVGLLSFPQKEDGMELSKPYSNETGELIDREVREWTDRAYKRTVALLEE  655

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            HKE + ++A+ LL +EVLH  DLV VLG RPFK++E    DR +  F
Sbjct  656  HKEGLEKLAQQLLAREVLHYNDLVEVLGPRPFKTAESGQLDRIRQRF  702



>ref|XP_002967857.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
 gb|EFJ31204.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
Length=828

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFP  E+ + +SKPYSN+T  +ID EVREW  +AY+ TV L+EE
Sbjct  687  YAQVAVYGFSEKVGLLSFPQKEDGMELSKPYSNETGELIDREVREWTDRAYKRTVALLEE  746

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            HKE + ++A+ LL +EVLH  DLV VLG RPFK++E    DR +  F
Sbjct  747  HKEGLEKLAQQLLAREVLHYNDLVEVLGPRPFKTAESGQLDRIRQRF  793



>emb|CDY48537.1| BnaC04g43120D [Brassica napus]
Length=108

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 13/107 (12%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVA+YGFSDKVGL+SF  +     + K YS++TA IID EVR   AK    TV+LIE 
Sbjct  3    YEQVAMYGFSDKVGLVSFGED-----ICKRYSDQTA-IIDEEVR---AK----TVELIER  49

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            HKE VAQ+AELLLEKEVLHQ+DL+++LGERPFK  E TNYDRFK GF
Sbjct  50   HKEQVAQVAELLLEKEVLHQDDLLKILGERPFKPVEMTNYDRFKSGF  96



>ref|XP_003631103.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AET05579.1| peptidase family M41 protein [Medicago truncatula]
Length=406

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVAVYGFS+KVGLLSFPP+E++   SKPYS+KT+AIIDNEVR+ + KAY+ T+QLIEE
Sbjct  224  YAQVAVYGFSEKVGLLSFPPSEDSFETSKPYSSKTSAIIDNEVRDRVNKAYKHTIQLIEE  283

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +K  +A+IA+LLLEKEVLHQ+DL++VLG +     E  + +   DG
Sbjct  284  YKGKLAEIAKLLLEKEVLHQDDLLQVLGFKLGLQDEAEDVEIIVDG  329



>gb|KEH16019.1| ATP-dependent zinc metalloprotease FTSH protein, partial [Medicago 
truncatula]
Length=553

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPN-ENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQVAVYGFS++VGLLSFP + E++  MSKPYS++T AIID EVREW+ KA++ T+QLIE
Sbjct  338  YAQVAVYGFSEQVGLLSFPHHKEDSFEMSKPYSSETGAIIDKEVREWVNKAFKHTIQLIE  397

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERP  353
            EHK  VA+IAELLLEKEVL+Q+DL++VL + P
Sbjct  398  EHKGKVAEIAELLLEKEVLYQDDLLQVLEKLP  429



>ref|XP_002980658.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]
 gb|EFJ18309.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]
Length=453

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA YGFSDKVGL+SFP  ++   + KP+SN T+ ++D E R  +  AY  T  LI++
Sbjct  336  YAQVAEYGFSDKVGLVSFP-RKSQTELLKPFSNNTSKLMDEEARAIVNDAYARTRALIDK  394

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKD  275
            H++ VA+IAELLLEKEVL QEDL+ VLGERPF      NYD ++ GF   K+ EA D
Sbjct  395  HRDGVAKIAELLLEKEVLRQEDLLAVLGERPFAQGSRNNYDIYRHGF---KQEEAND  448



>ref|XP_002984562.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]
 gb|EFJ14207.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]
Length=453

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA YGFSDKVGL+SFP  ++   + KP+SN T+ ++D E R  ++ AY  T  LI++
Sbjct  336  YAQVAEYGFSDKVGLVSFP-RKSQTELLKPFSNNTSKLMDEEARAIVSDAYARTRALIDK  394

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKD  275
            H++ VA+IAELLLEKEVL QEDL+ VLGERPF      NYD ++ GF   K  EA D
Sbjct  395  HRDGVAKIAELLLEKEVLRQEDLLAVLGERPFAQGSRNNYDIYRHGF---KPEEAND  448



>gb|KHG19679.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Gossypium 
arboreum]
Length=404

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFSDKVGLLSFP   +A  M+KPYS+KT AIID+EVR+W+ KAYE T+QLIEE
Sbjct  320  YTQVAVYGFSDKVGLLSFP-QRDAFEMTKPYSSKTGAIIDSEVRKWVVKAYERTMQLIEE  378

Query  445  HKEHVAQIAELLLEK  401
            HKEHV Q+AELLLEK
Sbjct  379  HKEHVTQVAELLLEK  393



>ref|XP_005651157.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26613.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
Length=712

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQVA+YG + KVGL+SFP  +     SKPYS++TA +ID EVRE +  AYE T++L+ E
Sbjct  560  YAQVAIYGMNKKVGLVSFPAEDG--QFSKPYSDETAQLIDKEVREMVNDAYERTLELLTE  617

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
             K+ V ++A  LLEKEV++ EDL  +LGERP++S+E  N D+F+DGF +  E
Sbjct  618  KKDLVEKLALTLLEKEVVNSEDLTEILGERPYRSAELRNIDKFRDGFAKKIE  669



>gb|AIE43895.1| WRKY transcription factor 38 [Gossypium hirsutum]
Length=953

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y QVAVYGFSDKVGLLSFP   +A  M+KPYS+KT AIID+EVR+W+ KAYE T+QLIEE
Sbjct  734  YTQVAVYGFSDKVGLLSFP-QRDAFEMTKPYSSKTGAIIDSEVRKWVVKAYERTMQLIEE  792

Query  445  HKEHVAQIAELLLEK  401
            HKEHV Q+AELLLEK
Sbjct  793  HKEHVTQVAELLLEK  807



>ref|XP_002505472.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66730.1| predicted protein [Micromonas sp. RCC299]
Length=680

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y +VAVYG ++KVG+LSFP ++      KPYS  TA +ID EVRE + +AY+ TV L++E
Sbjct  530  YNRVAVYGMNEKVGMLSFPSDDQ--QFQKPYSQDTARMIDEEVRELVDQAYKRTVALVKE  587

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             KE V  +A+ LLE+EVL + DLV++LG+RPFK     N D   +GF   K  E K TAE
Sbjct  588  KKEAVEALAQGLLEREVLQRHDLVKILGDRPFKYEGQQNIDILNEGF---KMPELKTTAE  644

Query  265  NKSTKD  248
            + + +D
Sbjct  645  DDAKED  650



>ref|XP_011400128.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM27161.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 
protothecoides]
Length=1210

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = -2

Query  625   YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
             YAQVAVYG +D VGL+SFP  E A   +KPYS+ TA +ID EVR  +A AY  T+ L+EE
Sbjct  1106  YAQVAVYGMNDAVGLVSFPQEEGAF--NKPYSDDTARLIDGEVRALVAGAYRRTLALLEE  1163

Query  445   HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
              +  V  +A+ LLE+EVL  E+L  +LGERP++S+E  N D+F+DG
Sbjct  1164  KRGAVEAMAQALLEREVLGTEELEALLGERPYRSAELRNIDKFRDG  1209



>ref|XP_005850885.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]
 gb|EFN58783.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]
Length=751

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y+QVA+YG + KVGLLSFPP E  L  +KPYS+ TA IID EVR  +  AY+ TVQL+EE
Sbjct  553  YSQVAIYGMNPKVGLLSFPPEEGQL--NKPYSDDTARIIDGEVRSLVDLAYQRTVQLLEE  610

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK  314
             K  V  +A+ LL+KEVL  E+L  +LG RP++S+E  N D+ K
Sbjct  611  KKHLVEGMAQALLKKEVLGTEELEALLGARPYRSAELRNIDKLK  654



>ref|XP_002741203.1| PREDICTED: AFG3-like protein 2, partial [Saccoglossus kowalevskii]
Length=560

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 77/107 (72%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS +TA +IDNEVR  I  AY+ TV L++
Sbjct  406  YAQVVQFGMSEKVGNVSFDMPQQGEMVMDKPYSEQTAQLIDNEVRSIIRSAYDRTVSLLQ  465

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             H+E++ ++A+ LL KEVL +ED+V +LGERPF  +E + Y++F +G
Sbjct  466  NHRENIEKVAQRLLNKEVLSKEDMVELLGERPF--AEKSTYEQFVEG  510



>ref|XP_003082962.1| FtsH protease, putative (ISS) [Ostreococcus tauri]
 emb|CAL56917.1| Peptidase M41, FtsH extracellular [Ostreococcus tauri]
Length=809

 Score =   107 bits (268),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y  VAVYG ++K+GLLSFP +E +L    PYS  TA +ID EVR  + KAY+ TV L+EE
Sbjct  669  YNTVAVYGMNEKIGLLSFPKDEQSL--KSPYSEDTARMIDEEVRLLVDKAYQRTVALVEE  726

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
             K  V  +A  LL+KEVL + DLV++LGERPF S  P N D   +GF
Sbjct  727  KKHLVEAMARGLLDKEVLQRHDLVQLLGERPFVSENPQNIDILNEGF  773



>ref|XP_007509883.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18998.1| predicted protein [Bathycoccus prasinos]
Length=922

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y   AVYG + K+GLLSFP  +N      PYS  TA +ID EVRE + KAY  TV L+ E
Sbjct  776  YNMTAVYGLNQKIGLLSFPKGDN--DFKSPYSEDTARMIDEEVRELVDKAYLRTVALVRE  833

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKET-EAKDTA  269
             K  V  +A  LL+KEVL + DLV+VLGERPFK     N D    GF ++K   +   ++
Sbjct  834  KKAVVESLARALLDKEVLQRHDLVKVLGERPFKYEGQQNIDILNQGFRDEKLLPKTPSSS  893

Query  268  ENKSTKDDD  242
            E+ +T D+D
Sbjct  894  EDAATNDND  902



>ref|XP_001422694.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01011.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=476

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 84/141 (60%), Gaps = 12/141 (9%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y  VAVYG ++K+GLLSFP +E +L    PYS  TA +ID EVR  +  AY+ T+ L++E
Sbjct  338  YNTVAVYGMNEKIGLLSFPKDEQSL--KSPYSEDTARMIDEEVRLLVDTAYKRTLALVKE  395

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF-------VEDKET  287
             K  V  +A+ LL+KEVL + DLV++LG+RPF S  P N D   +GF           E 
Sbjct  396  KKHLVEAMAQGLLDKEVLQRHDLVKLLGDRPFVSENPQNIDILNEGFKMHYPKTATAPED  455

Query  286  EAKDTAENKSTKDDDSSPLQP  224
            E  DT E    +DD+ SP  P
Sbjct  456  EPADTDE---PEDDEPSPAFP  473



>gb|ETO21279.1| hypothetical protein RFI_15925, partial [Reticulomyxa filosa]
Length=217

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 7/130 (5%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNEN-ALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            Y Q+ +YG +DKVG LSFPP +N  +   +PYS KTA +ID E  + + KAYE T +L+ 
Sbjct  51   YNQIVIYGMNDKVGHLSFPPEQNDGVQTYRPYSEKTAELIDVEASKLVRKAYEETTKLLT  110

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTA  269
            E K+ VA++A  LLE E L  +DLV +LGERPF+S      D ++D     KE   K  +
Sbjct  111  EKKDLVAKLAAKLLEAETLGHDDLVAILGERPFQS------DSYRDFLANTKEFAKKYGS  164

Query  268  ENKSTKDDDS  239
            E +  + D S
Sbjct  165  EEELAEKDKS  174



>ref|XP_001689949.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP09687.1| membrane AAA-metalloprotease, partial [Chlamydomonas reinhardtii]
Length=752

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y+QVAVYG ++KVGL+SF  + +A    KPYS+ TA +ID EVR +I +AY  T+ L+E+
Sbjct  649  YSQVAVYGMNEKVGLVSFRMDRDAF--DKPYSDTTAQLIDEEVRSFIDEAYRRTLGLVEQ  706

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            H+  +  + + LL KEVL+ +D+ R+LG+RPF S+E  N DRF+ G
Sbjct  707  HRGLIEAMTQELLHKEVLNLDDVERLLGKRPFVSAELRNIDRFRHG  752



>emb|CDS28120.1| afg3 protein 2 [Hymenolepis microstoma]
Length=761

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+   GFS KVG LSF  P +    M+KPYS +TA +ID EVR+ +AKAY+ T++L+E
Sbjct  630  YAQIVQLGFSPKVGNLSFDLPQQGEPMMTKPYSEQTAQLIDEEVRQLVAKAYDRTIKLVE  689

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPF  350
            +HKEHV  +A  LL+KE L +EDLV +LG RPF
Sbjct  690  QHKEHVEALALRLLDKEQLQKEDLVEILGPRPF  722



>gb|ETO15947.1| hypothetical protein RFI_21410 [Reticulomyxa filosa]
Length=869

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNEN-ALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            Y+Q+ +YG +D +G LSFPP +N  +   +PYS KTA IID E  + + KAY+ T QL+ 
Sbjct  720  YSQIVIYGMNDTIGHLSFPPEQNDGIQTYRPYSEKTAEIIDREAAQLVTKAYQETYQLLT  779

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
            + K+ VA++A  LLE E L  +DLV VLGERPFK+      D +KD  V  KE
Sbjct  780  QKKDLVAKLASKLLEIETLGHDDLVTVLGERPFKN------DSYKDYLVNTKE  826



>gb|EUB61794.1| AFG3-like protein 2 [Echinococcus granulosus]
 emb|CDS18384.1| afg3 protein 2 [Echinococcus granulosus]
Length=762

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 76/115 (66%), Gaps = 3/115 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV   GFS KVG LSF  P +    M+KPYS  TA IID EVR+ +A+AY+ T++L+E
Sbjct  632  YAQVVQLGFSPKVGNLSFDLPQQGEPVMTKPYSEHTAQIIDEEVRDLVARAYDRTLKLVE  691

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETE  284
            EHK H+  +A  LLEKE L +EDLV +LG RPF+  E + Y+        D++T+
Sbjct  692  EHKGHIEALALRLLEKEQLQKEDLVEILGPRPFQ--EKSTYEELVGSGPLDEDTD  744



>ref|XP_011407709.1| PREDICTED: AFG3-like protein 2 [Amphimedon queenslandica]
Length=534

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            Y+Q+A YG +D+VG +SF  P E      KPYS  TA +ID++ R+ I++AY+ T+QL+E
Sbjct  396  YSQIAKYGMNDEVGQVSFDLPGEGDQMFEKPYSEATAQLIDDQARDLISRAYQSTIQLLE  455

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E +E V ++AE LL++EVL +ED++ +LG RPF   E + Y+ F +G
Sbjct  456  EKRESVVKVAERLLQQEVLQREDMIELLGPRPF--PEKSTYEEFVEG  500



>ref|XP_010774059.1| PREDICTED: AFG3-like protein 2 [Notothenia coriiceps]
Length=176

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 86/139 (62%), Gaps = 8/139 (6%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G SD+VG +SF  P +  + + KPYS  TA +ID+EVRE I +AY+ T++L+ 
Sbjct  34   YAQVVQFGMSDRVGQVSFDLPRQGEMVLEKPYSEATAELIDSEVRELIERAYQRTLELVT  93

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKET--E  284
            E KE V  + + LL++E+L + D++ +LG RPF+  E   Y+ F +G   F ED      
Sbjct  94   EKKELVELVGQRLLQREILDKADMLELLGPRPFE--EKCTYEEFVEGTGSFEEDTSLPEG  151

Query  283  AKDTAENKSTKDDDSSPLQ  227
             KD  + +  +++ +SP Q
Sbjct  152  LKDWNQERVVEEETTSPPQ  170



>ref|XP_010747102.1| PREDICTED: AFG3-like protein 1 isoform X1 [Larimichthys crocea]
Length=765

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 8/139 (6%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA +ID EVRE + +AY+ T+QLIE
Sbjct  623  YAQVVQFGMSEKVGQVSFDLPRQGEMVMEKPYSEATAELIDKEVRELVERAYQRTLQLIE  682

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKET--E  284
            + KE V  + + LLEKEVL + D++ +LG RPF+  E + Y+ F +G   F ED      
Sbjct  683  DKKELVEMVGQRLLEKEVLDKADMLELLGPRPFE--EKSTYEEFVEGTGSFEEDTSLPEG  740

Query  283  AKDTAENKSTKDDDSSPLQ  227
             +D  + +  + ++SSP Q
Sbjct  741  LRDWNQERGGEAEESSPAQ  759



>ref|XP_010747103.1| PREDICTED: AFG3-like protein 1 isoform X2 [Larimichthys crocea]
Length=764

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 8/139 (6%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA +ID EVRE + +AY+ T+QLIE
Sbjct  622  YAQVVQFGMSEKVGQVSFDLPRQGEMVMEKPYSEATAELIDKEVRELVERAYQRTLQLIE  681

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKET--E  284
            + KE V  + + LLEKEVL + D++ +LG RPF+  E + Y+ F +G   F ED      
Sbjct  682  DKKELVEMVGQRLLEKEVLDKADMLELLGPRPFE--EKSTYEEFVEGTGSFEEDTSLPEG  739

Query  283  AKDTAENKSTKDDDSSPLQ  227
             +D  + +  + ++SSP Q
Sbjct  740  LRDWNQERGGEAEESSPAQ  758



>emb|CDJ01436.1| afg3 protein 2 [Echinococcus multilocularis]
 emb|CDS38718.1| afg3 protein 2 [Echinococcus multilocularis]
Length=762

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 3/115 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV   GFS KVG LSF  P +    M+KPYS  TA IID EVR+ +A+AY+ T++L+E
Sbjct  632  YAQVVQLGFSPKVGNLSFDLPQQGEPVMTKPYSEHTAQIIDEEVRDLVARAYDRTLKLVE  691

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETE  284
            EHK H+  +A  LLE+E L +EDLV +LG RPF+  E + Y+        D++T+
Sbjct  692  EHKGHIEALALRLLEREQLQKEDLVEILGPRPFQ--EKSTYEELVGSGPLDEDTD  744



>ref|XP_002956710.1| hypothetical protein VOLCADRAFT_107358 [Volvox carteri f. nagariensis]
 gb|EFJ42312.1| hypothetical protein VOLCADRAFT_107358 [Volvox carteri f. nagariensis]
Length=300

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 72/103 (70%), Gaps = 2/103 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y+QVAVYG ++KVGL+SF  +  A    KPYS++TA +ID EVR ++  AY+ TV L+E+
Sbjct  3    YSQVAVYGMNEKVGLVSFRMDREAF--DKPYSDETARLIDEEVRSFVDMAYKRTVALVEK  60

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
            H+ ++  +   LL KEVL  +D+ R+LG+RPF S E  N DR+
Sbjct  61   HRTYIEAMTAELLHKEVLSLDDVERLLGKRPFMSQELRNIDRY  103



>ref|XP_002410299.1| ATPase, putative [Ixodes scapularis]
 gb|EEC12875.1| ATPase, putative [Ixodes scapularis]
Length=368

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 84/131 (64%), Gaps = 6/131 (5%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G ++KVG LSF  P    + + KPYS +TA +ID+EVR+ + +AY+ T+ L+ 
Sbjct  221  YAQVVQFGMNEKVGNLSFDMPQPGDMVLDKPYSEETAQMIDSEVRKMVQQAYDHTMTLLT  280

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKETEAK  278
            EHK  V +IA+ LLEKE+L +ED++ +LG+RPF   E + Y+ F +G   F ED      
Sbjct  281  EHKADVEKIAKRLLEKEILSREDMIELLGKRPF--PEKSTYEEFVEGTGSFEEDTTLPKG  338

Query  277  DTAENKSTKDD  245
              + NK  +D+
Sbjct  339  LESWNKGPEDE  349



>dbj|GAM28243.1| hypothetical protein SAMD00019534_114190 [Acytostelium subglobosum 
LB1]
Length=838

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y+QV +YG +DKVG LS+P  +++  ++KPYS +TA I+D EVR  + +AY+ T ++++E
Sbjct  707  YSQVGIYGMNDKVGPLSYPRKDSS-DLTKPYSEETAEIMDQEVRILLQRAYDKTTEVLKE  765

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEP  335
            HKE +  +A LLL KEV+H ED+ ++LG RPF   EP
Sbjct  766  HKEGLEAVAALLLSKEVIHAEDIEKILGPRPFGIPEP  802



>ref|XP_003383809.1| PREDICTED: AFG3-like protein 2 [Amphimedon queenslandica]
Length=739

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            Y+Q+A YG +D+VG +SF  P E      KPYS  TA +ID++ R+ I++AY+ T+QL+E
Sbjct  602  YSQIAKYGMNDEVGQVSFDLPGEGDQMFEKPYSEATAQLIDDQARDLISRAYQSTIQLLE  661

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E +E V ++AE LL++EVL +ED++ +LG RPF   E + Y+ F +G
Sbjct  662  EKRESVVKVAERLLQQEVLQREDMIELLGPRPF--PEKSTYEEFVEG  706



>ref|XP_003059742.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55694.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=651

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y +VAVYG ++KVG+LSFP ++      KPYS  TA +ID EVR  +A AY+ T+ LI +
Sbjct  542  YNRVAVYGMNEKVGMLSFPSDDQ--QFQKPYSQDTAKLIDEEVRLLVANAYQRTLDLITK  599

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
             +  V  +A+ LLEKEVL + DLV VLG RPF      N D   +GF
Sbjct  600  ERSKVEALAQALLEKEVLQRHDLVTVLGARPFAYDGQQNIDILNEGF  646



>gb|AAH91419.1| Afg3l2 protein [Rattus norvegicus]
Length=179

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  +G ++KVG +SF  P +  + + KPYS  TA +ID+EVR  I++AY+ TV L+ 
Sbjct  34   YAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARMIDDEVRILISEAYKRTVALLT  93

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E K  V ++A LLLEKEVL + D+V +LG RPF  +E + Y+ F +G
Sbjct  94   EKKADVEKVALLLLEKEVLDKNDMVELLGPRPF--TEKSTYEEFVEG  138



>gb|AAH22577.1| Afg3l2 protein, partial [Mus musculus]
Length=188

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 72/107 (67%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  +G ++KVG +SF  P +  + + KPYS  TA +ID+EVR  I+ AY  TV L+ 
Sbjct  43   YAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARMIDDEVRILISDAYRRTVALLT  102

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E K  V ++A LLLEKEVL + D+V++LG RPF  +E + Y+ F +G
Sbjct  103  EKKADVEKVALLLLEKEVLDKNDMVQLLGPRPF--TEKSTYEEFVEG  147



>gb|EGI59447.1| AFG3-like protein 2 [Acromyrmex echinatior]
Length=670

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  YG ++K+G +SF  PN   L   KPYS  TA +IDNEVR+ I KA++ T+ L+ 
Sbjct  513  YAQITQYGMNEKIGNVSFEMPNTGELVFDKPYSEYTAQLIDNEVRDLIEKAHKRTLALLN  572

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            EHKE V ++AE LL++E+L ++D++ +LG RPF+  E + Y+ F +G
Sbjct  573  EHKEDVIKVAERLLKQEILSRDDMIELLGPRPFR--EKSTYEEFVEG  617



>ref|XP_011064066.1| PREDICTED: AFG3-like protein 2 isoform X1 [Acromyrmex echinatior]
Length=810

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  YG ++K+G +SF  PN   L   KPYS  TA +IDNEVR+ I KA++ T+ L+ 
Sbjct  653  YAQITQYGMNEKIGNVSFEMPNTGELVFDKPYSEYTAQLIDNEVRDLIEKAHKRTLALLN  712

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            EHKE V ++AE LL++E+L ++D++ +LG RPF+  E + Y+ F +G
Sbjct  713  EHKEDVIKVAERLLKQEILSRDDMIELLGPRPFR--EKSTYEEFVEG  757



>ref|XP_011064067.1| PREDICTED: AFG3-like protein 2 isoform X2 [Acromyrmex echinatior]
Length=787

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  YG ++K+G +SF  PN   L   KPYS  TA +IDNEVR+ I KA++ T+ L+ 
Sbjct  630  YAQITQYGMNEKIGNVSFEMPNTGELVFDKPYSEYTAQLIDNEVRDLIEKAHKRTLALLN  689

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            EHKE V ++AE LL++E+L ++D++ +LG RPF+  E + Y+ F +G
Sbjct  690  EHKEDVIKVAERLLKQEILSRDDMIELLGPRPFR--EKSTYEEFVEG  734



>ref|XP_005706412.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME29892.1| AAA-type ATPase [Galdieria sulphuraria]
Length=848

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y +++V+G +D VG +SF  + N     KPYS++TAA ID EVRE ++ AY+ T  L+ E
Sbjct  736  YQEISVWGMNDNVGHVSFQKSPNETRFYKPYSDRTAASIDREVRELLSNAYQRTYALLLE  795

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFK  347
             KE + Q+AELLLE+E +  EDLVR+LG+RPFK
Sbjct  796  KKESIQQVAELLLEREQIGYEDLVRILGKRPFK  828



>ref|XP_008309809.1| PREDICTED: AFG3-like protein 1 [Cynoglossus semilaevis]
Length=747

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA +ID+EVRE + +AYE T+QLI+
Sbjct  608  YAQVVQFGMSEKVGQVSFDMPRQGEMIMEKPYSEATAELIDSEVRELVDRAYERTMQLIQ  667

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            + K+ V  + + LLE EVLH+ D++ +LG RPF+  E + Y+ F +G
Sbjct  668  DKKDLVEMVGKRLLEMEVLHKSDMIELLGPRPFE--EKSTYEEFVEG  712



>ref|XP_783782.2| PREDICTED: AFG3-like protein 2 [Strongylocentrotus purpuratus]
Length=792

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 77/107 (72%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G SDKVG +SF  P +  + + KPYS +TA +ID EVR  I  AY+ T+ L++
Sbjct  651  YAQVVQFGMSDKVGNVSFDMPQQGEMVLEKPYSEQTAQMIDEEVRSMIKSAYDSTLDLLK  710

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            ++K++V  +A+ LLE+EVL+++D+V +LG+RPF  +E T Y+ F +G
Sbjct  711  KNKDNVEMVAQRLLEREVLNKDDMVELLGKRPF--AERTTYEDFVEG  755



>ref|XP_008191461.1| PREDICTED: AFG3-like protein 2 [Tribolium castaneum]
 gb|EEZ99702.1| hypothetical protein TcasGA2_TC002463 [Tribolium castaneum]
Length=781

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  YG ++KVG +SF  P E  + + KPYS  TA +ID EVR  I +AY+ T  L+ 
Sbjct  645  YAQVVHYGMNEKVGNVSFDMPREGEMMLEKPYSESTAQMIDVEVRNLIDQAYKRTTALLT  704

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            EHKE+VA++AE LL++E++ +ED++ +LG+RPF   E + Y+ F +G
Sbjct  705  EHKENVARVAERLLKQEIISREDMIELLGKRPF--PEKSTYEEFVEG  749



>gb|EXX70583.1| m-AAA protease subunit YTA12 [Rhizophagus irregularis DAOM 197198w]
Length=813

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  YG +  VG LSF  PN+N     KPYS +TA +ID EVR+ +A AYE TV+L+ 
Sbjct  690  YAQVTTYGMNPNVGPLSFNSPNDNEPQFQKPYSEETAKMIDEEVRKLVASAYERTVKLLT  749

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
            + K  V ++A+LLL KEVL+++D++ +LG+RPF   E  NY+ +
Sbjct  750  DKKNDVEKVAQLLLSKEVLNRDDMISLLGKRPF--VEKNNYEEY  791



>ref|WP_018336842.1| peptidase M41 [Butyricimonas synergistica]
Length=657

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF--PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLI  452
            YA V++YG SDK+G+LS+     ++    +KPYS KTA +ID EV++ ++ AYE   QL+
Sbjct  552  YAMVSIYGMSDKIGMLSYYDSSGQSDYSFTKPYSEKTAEVIDQEVKDMVSAAYERAKQLL  611

Query  451  EEHKEHVAQIAELLLEKEVLHQEDLVRVLGERPF  350
             EHK+   Q+AELL+E+EV+  +DL R+LGERP+
Sbjct  612  SEHKDQHRQVAELLIEREVIFSDDLERILGERPW  645



>emb|CDQ93828.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=222

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 71/107 (66%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  +G +DKVG +SF  P +  + + KPYS  TA +ID EVR  I +AYE T  L+ 
Sbjct  77   YAQIVQFGMNDKVGQVSFDLPRQGEMTLEKPYSEATARLIDTEVRNLIREAYERTHTLLA  136

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E K  V ++A+ LLEKEVL ++D+V +LG RPF  +E + Y+ F +G
Sbjct  137  EKKGDVEKVAQRLLEKEVLDKKDMVELLGLRPF--AEKSTYEEFVEG  181



>ref|XP_638674.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EAL65313.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]
Length=764

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            Y+QV++YG ++K+G LS+   ++   ++KPYS +TA ++D EVR+ +  AY+ T Q+++E
Sbjct  651  YSQVSIYGMNEKIGPLSYQKGQDGSDLTKPYSEETAEVMDEEVRKLLKSAYDRTTQVLQE  710

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPF--KSSEPTNYD  323
            H+E +  +A LLLEKEV+H E++  VLG RPF  K+ EP N +
Sbjct  711  HREGLISVANLLLEKEVIHFEEVEAVLGPRPFNNKTEEPKNIN  753



>ref|XP_003967322.1| PREDICTED: AFG3-like protein 2-like [Takifugu rubripes]
Length=699

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 83/141 (59%), Gaps = 6/141 (4%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA +ID EVRE + +AY  T+QLIE
Sbjct  546  YAQVVQFGMSEKVGQVSFDLPRQGEMVMEKPYSETTAELIDEEVRELVDRAYGKTMQLIE  605

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKETEAK  278
            E ++ V ++   LLEKEVL + D+V +LG RPF+  E + Y+ F +G   F ED      
Sbjct  606  EKRDLVEKVGTRLLEKEVLDKMDMVELLGPRPFE--EKSTYEEFVEGTGSFEEDTSLPEG  663

Query  277  DTAENKSTKDDDSSPLQPEVV  215
                N+  K D  S    E+V
Sbjct  664  LQHWNQERKGDTDSAQMSELV  684



>ref|XP_011160232.1| PREDICTED: AFG3-like protein 2 isoform X2 [Solenopsis invicta]
Length=790

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  YG ++KVG +SF  P    +   KPYS  TA +IDNEVRE I +A++ T+ L+ 
Sbjct  633  YAQITQYGMNEKVGNVSFEMPGSGEMVFDKPYSEHTAQLIDNEVRELIERAHKRTLALLN  692

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            EHKE V ++AE LL++E+L ++D++ +LG RPF+  E + Y+ F +G
Sbjct  693  EHKEDVIKVAERLLKQEILSRDDMIELLGPRPFR--EKSTYEEFVEG  737



>ref|XP_011160223.1| PREDICTED: AFG3-like protein 2 isoform X1 [Solenopsis invicta]
Length=818

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  YG ++KVG +SF  P    +   KPYS  TA +IDNEVRE I +A++ T+ L+ 
Sbjct  661  YAQITQYGMNEKVGNVSFEMPGSGEMVFDKPYSEHTAQLIDNEVRELIERAHKRTLALLN  720

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            EHKE V ++AE LL++E+L ++D++ +LG RPF+  E + Y+ F +G
Sbjct  721  EHKEDVIKVAERLLKQEILSRDDMIELLGPRPFR--EKSTYEEFVEG  765



>gb|ESA05195.1| hypothetical protein GLOINDRAFT_66340 [Rhizophagus irregularis 
DAOM 181602]
Length=647

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  YG +  VG LSF  PN+N     KPYS +TA +ID EVR+ +A AYE TV+L+ 
Sbjct  524  YAQVTTYGMNPNVGPLSFNSPNDNEPQFQKPYSEETAKMIDEEVRKLVASAYERTVKLLT  583

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
            + K  V ++A+LLL KEVL+++D++ +LG+RPF   E  NY+ +
Sbjct  584  DKKNDVEKVAQLLLSKEVLNRDDMISLLGKRPF--VEKNNYEEY  625



>ref|XP_005816528.1| PREDICTED: AFG3-like protein 1-like [Xiphophorus maculatus]
Length=666

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 85/139 (61%), Gaps = 8/139 (6%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G SDKVG +SF  P +  + + KPYS  TA +ID EVR  + +AYE T+QLI 
Sbjct  524  YAQVVQFGMSDKVGQVSFDLPRQGEMVLEKPYSEATAELIDEEVRGLVDRAYERTLQLIT  583

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKET--E  284
            + KE V ++ + LLEKEVL + D+V +LG RPF+  E + Y+ F +G   F ED      
Sbjct  584  DKKEQVDKVGKRLLEKEVLDKADMVELLGPRPFQ--EKSTYEEFVEGTGSFEEDTSLPDG  641

Query  283  AKDTAENKSTKDDDSSPLQ  227
             +D  + +  + +++ P Q
Sbjct  642  LRDWNQQRGGEAEETDPTQ  660



>dbj|GAN02747.1| ATP-dependent metallopeptidase Hfl [Mucor ambiguus]
Length=725

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQV  YG +DKVG LSF   ++     KP+S +T  +IDNE R+ +  AY+ T QL+ E
Sbjct  598  YAQVTAYGMNDKVGPLSFSDPQSEQQFQKPFSEQTGTLIDNEARKIVVDAYQYTRQLLTE  657

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             K  + ++A+LLLEKEVL++ED+ ++LG+RPF  +E T YD +
Sbjct  658  KKAEIEKVAQLLLEKEVLNREDMEKLLGKRPF--TEFTVYDEY  698



>gb|KDR07700.1| AFG3-like protein 2 [Zootermopsis nevadensis]
Length=808

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 86/142 (61%), Gaps = 16/142 (11%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  YG +DKVG +SF  P    + + KPYS +TA IID+EVRE I +A+  T  L+ 
Sbjct  656  YAQIVHYGMNDKVGNISFDMPQPGEMVLEKPYSERTAQIIDSEVRELIQRAHVHTTSLLT  715

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKE----  290
            EHKE V ++AE LL +E+L ++D++ +LG RPF   E + Y+ F +G   F ED      
Sbjct  716  EHKEDVRKVAERLLSQEILSRDDMIELLGPRPF--PEKSTYEEFVEGTGSFEEDTSLPEG  773

Query  289  ----TEAKDTAENKSTKDDDSS  236
                 + +D  +  STKDD ++
Sbjct  774  LKEWNQPRD--QEGSTKDDGNA  793



>ref|XP_008408894.1| PREDICTED: AFG3-like protein 1 isoform X1 [Poecilia reticulata]
Length=761

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 84/139 (60%), Gaps = 8/139 (6%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G SDKVG +SF  P +  + + KPYS  TA +ID EVR  + +AYE T+QLI 
Sbjct  619  YAQVVQFGMSDKVGQVSFDLPRQGEMVLEKPYSEATAELIDEEVRGLVDRAYERTLQLIT  678

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKETE--  284
              ++ V ++ + LLEKEVL + D+V +LG RPF+  E + Y+ F +G   F ED      
Sbjct  679  NKRDQVDKVGKRLLEKEVLDKADMVELLGPRPFQ--EKSTYEEFVEGTGSFEEDTSLPDG  736

Query  283  AKDTAENKSTKDDDSSPLQ  227
             +D  + +  + +++ P Q
Sbjct  737  LRDWNQQRGGEAEETDPTQ  755



>ref|WP_041883641.1| peptidase M41 [Pedobacter sp. NL19]
 gb|KIO76076.1| peptidase M41 [Pedobacter sp. NL19]
Length=697

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 77/132 (58%), Gaps = 2/132 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YA V +YG +  +G +SF   +N    +KPYS KT+ +ID EVR  I + YE T+QL+ E
Sbjct  560  YAMVTIYGMNTTIGNVSFHDPQNEYNFNKPYSEKTSELIDIEVRTLINQVYERTMQLLIE  619

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             +E + ++AE LLEKE+L Q DL  +LG+RPF +   T YD F +G  + K        E
Sbjct  620  KREGLEKLAEKLLEKEILFQADLEEILGKRPFDNR--TTYDEFVNGTGDQKPAAEGLLHE  677

Query  265  NKSTKDDDSSPL  230
                  D SSPL
Sbjct  678  GVGETTDPSSPL  689



>gb|EMP33437.1| AFG3-like protein 2 [Chelonia mydas]
Length=181

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  +G ++KVG +SF  P +  + + KPYS  TA +ID EVR  I  AYE TV L+ 
Sbjct  34   YAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDEEVRNLINSAYERTVTLLM  93

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E K  V ++A  LLEKEVL + D+V +LG RPF  +E + Y+ F +G
Sbjct  94   EKKADVEKVALRLLEKEVLDKSDMVELLGPRPF--AEKSTYEEFVEG  138



>gb|EIE80123.1| hypothetical protein RO3G_04828 [Rhizopus delemar RA 99-880]
Length=645

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF--PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLI  452
            YAQ+  YG ++K+G LSF  P NEN+    KP+S +T  +IDNE R  +++AY+ T+QL+
Sbjct  518  YAQITAYGMNEKIGPLSFSDPQNENSF--QKPFSEQTGTMIDNEARALVSEAYDRTLQLL  575

Query  451  EEHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDT  272
             E K  + ++A+LLL KEVL +ED+  +LG+RPF  +E T YD     +V  K ++    
Sbjct  576  TEKKNDIEKVAQLLLSKEVLTREDMENLLGKRPF--NEVTVYDE----YVRRKPSDTSAP  629

Query  271  AENKSTKDDDS  239
             +     DDDS
Sbjct  630  PDFSKPSDDDS  640



>ref|XP_005770144.1| ATP-dependent metalloprotease FtsH, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD17715.1| ATP-dependent metalloprotease FtsH, partial [Emiliania huxleyi 
CCMP1516]
Length=568

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = -2

Query  616  VAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKE  437
            V VYG S +VG LSF   E +  + +PYS KTA +ID EV + I  +YE  V L+ EH++
Sbjct  429  VTVYGLSSRVGPLSFGQQEESNTLYRPYSEKTARVIDEEVSKIIDASYERAVSLLTEHRD  488

Query  436  HVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             +  +AE LLEKEV+  +DL+RVLGERPF  S   +YD F
Sbjct  489  KLTALAESLLEKEVIGSDDLIRVLGERPFSKS--VDYDEF  526



>ref|XP_004362632.1| peptidase M41 [Dictyostelium fasciculatum]
 gb|EGG24781.1| peptidase M41 [Dictyostelium fasciculatum]
Length=1234

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = -2

Query  625   YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
             Y+Q+ +YG +DKVG +S+P  +N+   +KPYS +TA ++D EVR  +  AYE TVQ++E+
Sbjct  1095  YSQIGIYGMNDKVGCVSYPRKDNS-DFTKPYSEQTAEMMDEEVRILLNSAYEKTVQVLEQ  1153

Query  445   HKEHVAQIAELLLEKEVLHQEDLVRVLGERPF  350
             H++ + ++A LLLEKEV+H +D+  +LG RPF
Sbjct  1154  HRDGLEKVATLLLEKEVIHSDDIKTLLGPRPF  1185



>ref|XP_006612551.1| PREDICTED: AFG3-like protein 2-like [Apis dorsata]
Length=802

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  YG ++KVG +SF  P +  +   KPYS  TA +IDNEVRE I +A+  T  L+ 
Sbjct  648  YAQVIQYGMNEKVGNVSFQMPQQGEMTFDKPYSEHTAQLIDNEVRELIEQAHTHTRNLLT  707

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +HKE V+++AE LL++E+L +ED++ +LG RPF   E + Y++F +G
Sbjct  708  QHKEDVSKVAERLLKQEILSREDMIELLGPRPF--PEKSTYEQFVEG  752



>gb|ELT94890.1| hypothetical protein CAPTEDRAFT_177529 [Capitella teleta]
Length=782

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 87/142 (61%), Gaps = 19/142 (13%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQVAV G +D+VG +SF  P +  + M+KPYS +TA +ID EVR+ I  A+  T +L++
Sbjct  642  YAQVAVLGMNDRVGNVSFDMPQQGEMVMTKPYSEQTAQMIDEEVRKLIKSAHTFTTELLK  701

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVED------  296
            +H+  V ++A+LLL++E + +ED++ +LG RPF  +E T Y+ F +G   F ED      
Sbjct  702  KHRPEVEKVAQLLLKEEKIDKEDMLALLGARPF--AEKTTYEEFVEGTGSFEEDTTLPKG  759

Query  295  -------KETEAKDTAENKSTK  251
                   KE EA    ENK  K
Sbjct  760  LENWNKSKEEEATTEGENKEEK  781



>gb|EPB90189.1| AFG3 family protein [Mucor circinelloides f. circinelloides 1006PhL]
Length=739

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 80/130 (62%), Gaps = 6/130 (5%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQV  YG ++KVG LSF   ++     KP+S +T  +IDNE R+ +  AY+ T  L+ E
Sbjct  612  YAQVTAYGMNEKVGPLSFSDPQSEQQFQKPFSEQTGTLIDNEARKIVVDAYQHTRNLLTE  671

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             K  + ++A+LLLEKEVL++ED+ R+LG+RPF  +E T YD     +V     +A+ T  
Sbjct  672  KKGDIEKVAQLLLEKEVLNREDMERLLGKRPF--TEFTVYDE----YVRRPNNQAEGTPP  725

Query  265  NKSTKDDDSS  236
            +   +D D S
Sbjct  726  DFPQQDGDGS  735



>emb|CEI94349.1| Putative AFG3 family protein [Rhizopus microsporus]
Length=817

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQ+  YG ++KVG LSF  ++N   + KPYS +TA +IDNE R  + +AYE T++L+ E
Sbjct  699  YAQITQYGMNEKVGALSFT-DQNEQQLQKPYSEQTATLIDNEARRMVNEAYERTLKLLSE  757

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             K+ + ++A LLL+KEVL +ED+ ++LG+RPF   E T YD +
Sbjct  758  KKQDIEKVARLLLDKEVLTREDMEKLLGKRPF--DEHTVYDEY  798


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = -2

Query  565  NENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKEVLHQ  386
            ++N   + KPYS +TA +IDNE R  + +AYE T+ L+ E K+ + ++A LLL+KEVL +
Sbjct  443  HQNEQQLQKPYSEQTATLIDNEARRIVNEAYERTLNLLNEKKQDIEKVARLLLDKEVLTR  502

Query  385  EDLVRVLGERPFKSSEPTNYDRF  317
            ED+ ++LG+RPF   E T YD +
Sbjct  503  EDMEKLLGKRPF--DEHTVYDEY  523



>ref|XP_001956786.1| GF24400 [Drosophila ananassae]
 gb|EDV39592.1| GF24400 [Drosophila ananassae]
Length=824

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 85/148 (57%), Gaps = 11/148 (7%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENA-LXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            Y+QV  +G +DKVG +SF   +      SKPYS  TA +ID EVR  I  A+E T +L+ 
Sbjct  674  YSQVVRFGMNDKVGQVSFDVGQAGDPVFSKPYSEDTAQLIDGEVRTIIKCAHEATTELLS  733

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKETEAK  278
            +HKE V ++AE LL+ EVL ++D++ +LG RPFK  E + Y+ F +G   F ED      
Sbjct  734  KHKEDVRRVAERLLQNEVLSRDDMIELLGPRPFK--EKSTYEEFVEGTGSFEEDTSLPEG  791

Query  277  DTAENKSTK-----DDDSSPLQPEVVPV  209
              + NK  +     D DS+P  P   PV
Sbjct  792  LKSWNKEKERPQPLDTDSTPSSPPTKPV  819



>ref|XP_003979383.1| PREDICTED: AFG3-like protein 2-like [Takifugu rubripes]
Length=332

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  +G + KVG +SF  P +  + + KPYS  TA +ID EVR  I++AY+ T+QL++
Sbjct  186  YAQIVQFGMNPKVGQVSFDLPRQGEMVLEKPYSEATARLIDTEVRALISEAYQRTLQLLK  245

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E K  V ++A  LLEKEVL + D+V +LG+RPF  +E + Y+ F +G
Sbjct  246  EKKAEVEKVALRLLEKEVLDKNDMVELLGKRPF--AEKSTYEEFVEG  290



>emb|CEJ01398.1| Putative Cell division protease ftsH [Rhizopus microsporus]
Length=751

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YAQ+  YG ++KVG LSF  ++N   + KPYS +TA +IDNE R  + +AYE T++L+ E
Sbjct  629  YAQITQYGMNEKVGALSFT-DQNEQQLQKPYSEQTATLIDNEARRMVNEAYERTLKLLSE  687

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             K+ + ++A LLL+KEVL +ED+ ++LG+RPF   E T YD +
Sbjct  688  KKQDIEKVARLLLDKEVLTREDMEKLLGKRPF--DEHTVYDEY  728



>ref|XP_003693602.1| PREDICTED: AFG3-like protein 2-like [Apis florea]
Length=802

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  YG ++KVG +SF  P +  +   KPYS  TA +IDNEVRE I +A+  T  L+ 
Sbjct  648  YAQVIQYGMNEKVGNVSFQMPQQGEMTFDKPYSEHTAQLIDNEVRELIEQAHTHTRNLLM  707

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +HKE V+++AE LL++E+L +ED++ +LG RPF   E + Y++F +G
Sbjct  708  QHKEDVSKVAERLLKQEILSREDMIELLGPRPF--PEKSTYEQFVEG  752



>ref|XP_624548.2| PREDICTED: AFG3-like protein 2-like [Apis mellifera]
Length=803

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  YG ++KVG +SF  P +  +   KPYS  TA +IDNEVRE I +A+  T  L+ 
Sbjct  649  YAQVIQYGMNEKVGNVSFQMPQQGEMTFDKPYSEHTAQLIDNEVRELIEQAHTHTRNLLM  708

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +HKE V+++AE LL++E+L +ED++ +LG RPF   E + Y++F +G
Sbjct  709  QHKEDVSKVAERLLKQEILSREDMIELLGPRPF--PEKSTYEQFVEG  753



>ref|XP_004566226.1| PREDICTED: AFG3-like protein 1-like [Maylandia zebra]
Length=762

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA IID EVRE I +AYE T+QLI+
Sbjct  620  YAQVVQFGMSEKVGQVSFDLPRQGEVVMEKPYSEATAEIIDEEVRELINRAYERTLQLIQ  679

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            + K+ V  + + LLE+EVL++ D++ +LG RPF+  E + Y+ F +G
Sbjct  680  DKKDLVELVGKRLLEREVLNKADMLELLGPRPFE--EKSTYEEFVEG  724



>ref|XP_005946781.1| PREDICTED: AFG3-like protein 1-like [Haplochromis burtoni]
Length=761

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA IID EVRE I +AYE T+QLI+
Sbjct  619  YAQVVQFGMSEKVGQVSFDLPRQGEVVMEKPYSEATAEIIDEEVRELINRAYERTLQLIQ  678

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            + K+ V  + + LLE+EVL++ D++ +LG RPF+  E + Y+ F +G
Sbjct  679  DKKDLVELVGKRLLEREVLNKADMLELLGPRPFE--EKSTYEEFVEG  723



>ref|XP_005748823.1| PREDICTED: AFG3-like protein 1-like [Pundamilia nyererei]
Length=767

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA IID EVRE I +AYE T+QLI+
Sbjct  625  YAQVVQFGMSEKVGQVSFDLPRQGEVVMEKPYSEATAEIIDEEVRELINRAYERTLQLIQ  684

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            + K+ V  + + LLE+EVL++ D++ +LG RPF+  E + Y+ F +G
Sbjct  685  DKKDLVELVGKRLLEREVLNKADMLELLGPRPFE--EKSTYEEFVEG  729



>ref|WP_037533932.1| peptidase M41 [Sphingobacterium thalpophilum]
Length=695

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YA +A+YG +DKVG +SF  +  A    KPYS+KTA +ID EVR  I   Y  T QL+ E
Sbjct  555  YAMIAIYGMNDKVGNVSFRDSSEA-SFQKPYSDKTAELIDAEVRNLINDVYARTKQLLLE  613

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             +E + +IAE LLEKE+L Q DL  +LG+RPF++   T YD F +G
Sbjct  614  KREGLIKIAEKLLEKEILFQSDLEEILGKRPFETK--TTYDEFVNG  657



>ref|XP_001744500.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90449.1| predicted protein [Monosiga brevicollis MX1]
Length=637

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 89/139 (64%), Gaps = 12/139 (9%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            Y+Q+AVYG + KVG LSF  P++N     KPYS  TA +ID E R  +  A+  T++L+ 
Sbjct  488  YSQIAVYGMNTKVGNLSFKMPDDNEPAFDKPYSEATAQMIDEEARNLVQTAFTRTLELLT  547

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF-KDGFVEDKETEA---  281
            E ++ V ++A+LLL++EVL ++D+V +LG RPFK  E  +YD+F +D   +D+E +    
Sbjct  548  EKRDAVEKVAQLLLDREVLSRQDMVDLLGTRPFK--EKHDYDQFMEDAGSDDQEVQLPPG  605

Query  280  -----KDTAENKSTKDDDS  239
                 +++A+ +  +D DS
Sbjct  606  LRNLERESAQKRHDRDADS  624



>ref|WP_041502017.1| MULTISPECIES: cell division protein FtsH [unclassified Porphyromonadaceae]
 gb|KIO44165.1| cell division protein FtsH [Porphyromonadaceae bacterium OUH 
308042]
 gb|KIO47177.1| cell division protein FtsH [Porphyromonadaceae bacterium OUH 
334697]
Length=663

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF--PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLI  452
            YA V++YG SDK+G LSF     ++    +KPYS KTA +ID EV+E ++ AYE   QL+
Sbjct  552  YAMVSIYGMSDKIGTLSFYDSTGQSDFSFTKPYSEKTAELIDAEVKEMVSAAYERAKQLL  611

Query  451  EEHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSE  338
            ++H+E   Q+AELL+E+EV+  +DL  +LG+RP+   E
Sbjct  612  KQHQEQHKQVAELLIEREVIFSDDLENILGKRPWSDEE  649



>emb|CAF92797.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=743

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA +ID EVRE + +AY  T+QL+E
Sbjct  618  YAQVVQFGMSEKVGQVSFDLPRQGEMVMEKPYSEATAELIDKEVRELVERAYGRTMQLVE  677

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            E +  V ++ + LLEKEVL + D+V +LG RPF+  E + Y+ F +G
Sbjct  678  EKRSLVEKVGKRLLEKEVLDKMDMVELLGPRPFQ--EKSTYEEFVEG  722



>ref|XP_006805466.1| PREDICTED: AFG3-like protein 1-like, partial [Neolamprologus 
brichardi]
Length=716

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFP-PNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQV  +G S+KVG +SF  P +  + M KPYS  TA IID EVRE + +AYE T+QLI+
Sbjct  607  YAQVVQFGMSEKVGQVSFDLPRQGEVVMEKPYSEATAEIIDEEVRELVNRAYERTLQLIQ  666

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            + K+ V  + + LLE+EVL++ D++ +LG RPF+  E + Y+ F +G
Sbjct  667  DKKDLVELVGKRLLEREVLNKADMLELLGPRPFE--EKSTYEEFVEG  711



>ref|XP_003737319.1| PREDICTED: LOW QUALITY PROTEIN: AFG3-like protein 2-like [Metaseiulus 
occidentalis]
Length=647

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSF-PPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIE  449
            YAQ+  +G +DK+G LSF  P    + M KPYS +TA +ID+EVR  + +AY+ T++L+ 
Sbjct  497  YAQIVQFGMNDKIGNLSFEMPQPGDMVMEKPYSEETAQMIDSEVRSLVDRAYDTTMKLLT  556

Query  448  EHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +H+  V ++A  LL KE+L++ED++ +LG+RPF   E + Y+ F  G
Sbjct  557  DHRSDVEKVAVRLLSKEILNREDMIELLGKRPF--PEKSTYEEFVQG  601



>ref|WP_037443193.1| peptidase M41 [Sphingobacterium antarcticum]
 gb|KEQ28898.1| peptidase M41 [Sphingobacterium antarcticus 4BY]
Length=696

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = -2

Query  625  YAQVAVYGFSDKVGLLSFPPNENALXMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEE  446
            YA V +YG +  +G +SF   +N    +KPYS KT+ +ID EVR+ ++  YE T+QL+ +
Sbjct  560  YAMVTIYGMNSTIGNVSFHDPQNEYNFNKPYSEKTSELIDIEVRKLVSGVYERTMQLLTD  619

Query  445  HKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
             +E + ++AE LLEKE+L Q DL  +LG+RPF++   T YD F +G  + K        E
Sbjct  620  QREGLEKLAEKLLEKEILFQTDLEEILGKRPFENR--TTYDEFVNGTGDQKPAAEGLLHE  677

Query  265  NKSTKDDDSSPLQP  224
                    S+P+ P
Sbjct  678  GVGETTAPSAPVAP  691



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380