BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050G13

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP14047.1|  unnamed protein product                                123   2e-30   Coffea canephora [robusta coffee]
ref|XP_009791710.1|  PREDICTED: 60S acidic ribosomal protein P0         123   2e-30   Nicotiana sylvestris
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0         120   2e-29   Solanum lycopersicum
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0         120   3e-29   Nicotiana tomentosiformis
gb|AID52928.1|  60S acidic ribosomal protein P0                         118   2e-28   Carthamus tinctorius
ref|NP_001275012.1|  60S acidic ribosomal protein P0-like               118   2e-28   Solanum tuberosum [potatoes]
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like    117   2e-28   Setaria italica
ref|NP_001239676.1|  uncharacterized protein LOC100777482               117   3e-28   Glycine max [soybeans]
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0         117   3e-28   Sesamum indicum [beniseed]
gb|KJB74260.1|  hypothetical protein B456_011G283700                    116   4e-28   Gossypium raimondii
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0-like    117   4e-28   Cucumis sativus [cucumbers]
gb|KJB74261.1|  hypothetical protein B456_011G283700                    116   7e-28   Gossypium raimondii
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0         116   7e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG25462.1|  60S acidic ribosomal P0                                 116   7e-28   Gossypium arboreum [tree cotton]
gb|ACL52455.1|  unknown                                                 116   7e-28   Zea mays [maize]
ref|NP_001141489.1|  hypothetical protein                               116   7e-28   Zea mays [maize]
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like    116   9e-28   Setaria italica
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0         116   9e-28   Eucalyptus grandis [rose gum]
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like    116   9e-28   Cicer arietinum [garbanzo]
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like    116   9e-28   Cicer arietinum [garbanzo]
gb|EMT02739.1|  60S acidic ribosomal protein P0                         116   1e-27   
ref|XP_004165071.1|  PREDICTED: 60S acidic ribosomal protein P0-like    116   1e-27   
gb|KJB78787.1|  hypothetical protein B456_013G019000                    115   1e-27   Gossypium raimondii
emb|CAN76468.1|  hypothetical protein VITISV_030042                     115   1e-27   Vitis vinifera
gb|KHG08087.1|  60S acidic ribosomal P0                                 115   1e-27   Gossypium arboreum [tree cotton]
gb|ACF83717.1|  unknown                                                 115   1e-27   Zea mays [maize]
ref|NP_001105482.1|  60S acidic ribosomal protein P0                    115   1e-27   Zea mays [maize]
ref|XP_002445000.1|  hypothetical protein SORBIDRAFT_07g002560          115   2e-27   Sorghum bicolor [broomcorn]
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0         115   2e-27   Vitis vinifera
emb|CBI25508.3|  unnamed protein product                                115   2e-27   Vitis vinifera
emb|CBI31491.3|  unnamed protein product                                115   2e-27   Vitis vinifera
ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0         115   2e-27   Vitis vinifera
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g             115   2e-27   Phaseolus vulgaris [French bean]
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g             115   2e-27   Phaseolus vulgaris [French bean]
gb|AGV54296.1|  60S acidic ribosomal protein P0                         115   2e-27   Phaseolus vulgaris [French bean]
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0         115   2e-27   Cucumis melo [Oriental melon]
ref|NP_001238374.1|  60S acidic ribosomal protein P0                    115   3e-27   Glycine max [soybeans]
gb|EYU19990.1|  hypothetical protein MIMGU_mgv1a0100892mg               112   3e-27   Erythranthe guttata [common monkey flower]
gb|EYU43502.1|  hypothetical protein MIMGU_mgv1a010103mg                113   4e-27   Erythranthe guttata [common monkey flower]
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    114   4e-27   
gb|EMS52841.1|  60S acidic ribosomal protein P0                         113   5e-27   Triticum urartu
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like    114   7e-27   Tarenaya hassleriana [spider flower]
gb|KJB76158.1|  hypothetical protein B456_012G076000                    114   7e-27   Gossypium raimondii
gb|KJB76159.1|  hypothetical protein B456_012G076000                    114   7e-27   Gossypium raimondii
emb|CAN80537.1|  hypothetical protein VITISV_003812                     114   8e-27   Vitis vinifera
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg                113   8e-27   Erythranthe guttata [common monkey flower]
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg                113   8e-27   Erythranthe guttata [common monkey flower]
gb|EEC82854.1|  hypothetical protein OsI_27702                          111   8e-27   Oryza sativa Indica Group [Indian rice]
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg                113   9e-27   Erythranthe guttata [common monkey flower]
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230          113   1e-26   Sorghum bicolor [broomcorn]
gb|ABR26209.1|  60S acidic ribosomal protein p0                         111   1e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010234277.1|  PREDICTED: 60S acidic ribosomal protein P0         112   2e-26   Brachypodium distachyon [annual false brome]
gb|EPS69246.1|  p0 ribosomal protein-like protein                       112   2e-26   Genlisea aurea
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like    112   2e-26   Cicer arietinum [garbanzo]
gb|EAZ41410.1|  hypothetical protein OsJ_25932                          110   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659092.1|  PREDICTED: 60S acidic ribosomal protein P0-like    112   3e-26   Oryza brachyantha
gb|ADU04571.1|  60S acidic ribosomal protein PO                         112   3e-26   Phaseolus vulgaris [French bean]
gb|ADE76171.1|  unknown                                                 111   3e-26   Picea sitchensis
ref|NP_001060923.1|  Os08g0130500                                       112   3e-26   
emb|CBX25428.1|  hypothetical_protein                                   112   4e-26   Oryza glaberrima
gb|ABA91328.1|  60S acidic ribosomal protein P0, putative, expressed    112   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82182.1|  hypothetical protein OsI_37384                          112   4e-26   Oryza sativa Indica Group [Indian rice]
gb|ABA95724.1|  60S acidic ribosomal protein P0, putative, expressed    112   4e-26   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0               111   4e-26   Trifolium pratense [peavine clover]
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like    111   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like    111   5e-26   Solanum lycopersicum
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like    111   7e-26   Brachypodium distachyon [annual false brome]
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like    110   9e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like    110   1e-25   Nicotiana sylvestris
gb|AFK46889.1|  unknown                                                 110   1e-25   Medicago truncatula
ref|XP_003616595.1|  60S acidic ribosomal protein p0                    110   1e-25   Medicago truncatula
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3       110   1e-25   Camelina sativa [gold-of-pleasure]
gb|ACJ84880.1|  unknown                                                 110   1e-25   Medicago truncatula
ref|XP_003603496.1|  60S acidic ribosomal protein p0                    110   1e-25   Medicago truncatula
gb|AFK39880.1|  unknown                                                 110   1e-25   Medicago truncatula
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO               110   1e-25   Euphorbia esula [wolf's milk]
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0         109   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2     109   2e-25   
gb|KDP44812.1|  hypothetical protein JCGZ_01312                         109   3e-25   Jatropha curcas
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1     109   3e-25   
gb|KHN36391.1|  60S acidic ribosomal protein P0                         109   3e-25   Glycine soja [wild soybean]
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0         108   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like    108   4e-25   Nicotiana tomentosiformis
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like    108   4e-25   Populus euphratica
gb|AAD56335.1|AC009326_22  putative 60S acidic ribosomal protein,...    107   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADR71235.1|  60S acidic ribosomal protein P0A                        108   6e-25   Hevea brasiliensis [jebe]
gb|ADR71236.1|  60S acidic ribosomal protein P0B                        108   6e-25   Hevea brasiliensis [jebe]
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg             108   6e-25   Capsella rubella
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    108   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002882720.1|  60S acidic ribosomal protein P0                    108   6e-25   
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                     108   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like    108   7e-25   Solanum tuberosum [potatoes]
gb|ABK95701.1|  unknown                                                 108   7e-25   Populus trichocarpa [western balsam poplar]
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                  107   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like    108   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG25720.1|  60S acidic ribosomal P0                                 108   9e-25   Gossypium arboreum [tree cotton]
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                     108   9e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0                108   9e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ92405.1|  predicted protein                                      107   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT17099.1|  60S acidic ribosomal protein P0                         107   1e-24   
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                    107   1e-24   Arabis alpina [alpine rockcress]
ref|XP_002884720.1|  60S acidic ribosomal protein P0                    107   2e-24   Arabidopsis lyrata subsp. lyrata
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                    107   2e-24   Arabis alpina [alpine rockcress]
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                  107   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like    106   3e-24   Pyrus x bretschneideri [bai li]
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                       106   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0         106   3e-24   Malus domestica [apple tree]
dbj|BAJ94456.1|  predicted protein                                      106   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg             106   3e-24   Capsella rubella
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0         106   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_007016138.1|  Ribosomal protein L10 family protein               106   3e-24   
gb|KHN34735.1|  60S acidic ribosomal protein P0                         106   3e-24   Glycine soja [wild soybean]
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    106   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0         106   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    106   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006848156.1|  hypothetical protein AMTR_s00029p00231170          106   3e-24   Amborella trichopoda
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0         106   3e-24   Elaeis guineensis
emb|CDP16385.1|  unnamed protein product                                106   3e-24   Coffea canephora [robusta coffee]
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like    106   4e-24   Glycine max [soybeans]
ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative          106   4e-24   Ricinus communis
gb|AFK38760.1|  unknown                                                 106   4e-24   Lotus japonicus
ref|XP_008779152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    104   4e-24   Phoenix dactylifera
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    105   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg             105   5e-24   Eutrema salsugineum [saltwater cress]
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0         105   5e-24   Phoenix dactylifera
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like    105   7e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006407705.1|  hypothetical protein EUTSA_v10021147mg             105   9e-24   
emb|CDY07906.1|  BnaC03g36170D                                          105   1e-23   Brassica napus [oilseed rape]
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                    105   1e-23   Arabis alpina [alpine rockcress]
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg             105   1e-23   Eutrema salsugineum [saltwater cress]
emb|CDY67524.1|  BnaAnng24540D                                          103   1e-23   Brassica napus [oilseed rape]
emb|CDP06275.1|  unnamed protein product                                103   1e-23   Coffea canephora [robusta coffee]
emb|CDX73962.1|  BnaA03g30850D                                          104   1e-23   
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg             104   2e-23   Prunus persica
emb|CDY24932.1|  BnaC03g22400D                                          104   2e-23   Brassica napus [oilseed rape]
emb|CDY53103.1|  BnaCnng24330D                                          103   3e-23   Brassica napus [oilseed rape]
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2       103   3e-23   Brassica rapa
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    103   3e-23   Brassica rapa
gb|ABK94988.1|  unknown                                                 103   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    103   3e-23   Brassica rapa
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                  103   3e-23   
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like    103   3e-23   Sesamum indicum [beniseed]
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0         103   4e-23   Elaeis guineensis
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg             103   5e-23   Citrus clementina [clementine]
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                   103   5e-23   Citrus sinensis [apfelsine]
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                     103   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0         103   6e-23   Fragaria vesca subsp. vesca
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0         102   6e-23   Populus euphratica
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0         102   6e-23   Malus domestica [apple tree]
emb|CDY60988.1|  BnaA03g56530D                                          102   7e-23   Brassica napus [oilseed rape]
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0         102   7e-23   Fragaria vesca subsp. vesca
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative          102   7e-23   Ricinus communis
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1       102   7e-23   Brassica rapa
dbj|BAD09642.1|  60S acidic ribosomal protein P0-like                 97.8    8e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    102   1e-22   Cucumis sativus [cucumbers]
ref|XP_002881693.1|  60S acidic ribosomal protein P0                    102   1e-22   
ref|XP_010095082.1|  60S acidic ribosomal protein P0                    102   1e-22   Morus notabilis
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-like    101   2e-22   Fragaria vesca subsp. vesca
gb|KDP46515.1|  hypothetical protein JCGZ_08487                         100   3e-22   Jatropha curcas
ref|XP_008351783.1|  PREDICTED: uncharacterized protein LOC103415220    103   4e-22   
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0       99.8    8e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1     99.4    1e-21   Camelina sativa [gold-of-pleasure]
gb|EYU22330.1|  hypothetical protein MIMGU_mgv1a019166mg              97.8    1e-21   Erythranthe guttata [common monkey flower]
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...  99.0    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like  98.2    4e-21   Nicotiana tomentosiformis
gb|AGL34820.1|  ribosomal protein 10                                  93.6    4e-21   Cyrtandra schizocalyx
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like  97.8    4e-21   Nicotiana sylvestris
gb|AGL34823.1|  ribosomal protein 10                                  93.6    4e-21   Cyrtandra paludosa var. paludosa
ref|XP_001759851.1|  predicted protein                                97.4    5e-21   
ref|XP_001759592.1|  predicted protein                                97.4    6e-21   
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g           96.7    9e-21   Phaseolus vulgaris [French bean]
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like  96.7    1e-20   Cucumis melo [Oriental melon]
ref|XP_010104660.1|  60S acidic ribosomal protein P0-1                95.1    1e-20   
gb|KHG21849.1|  60S acidic ribosomal P0-2 -like protein               94.7    2e-20   Gossypium arboreum [tree cotton]
gb|KHG01938.1|  60S acidic ribosomal P0-2 -like protein               94.7    3e-20   Gossypium arboreum [tree cotton]
gb|KJB19895.1|  hypothetical protein B456_003G123400                  95.1    4e-20   Gossypium raimondii
gb|AGL34821.1|  ribosomal protein 10                                  90.1    8e-20   Cyrtandra longifolia
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like  94.0    8e-20   Fragaria vesca subsp. vesca
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                 94.0    1e-19   Citrus sinensis [apfelsine]
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg           94.0    1e-19   Citrus clementina [clementine]
ref|XP_001697060.1|  acidic ribosomal protein P0                      93.6    1e-19   Chlamydomonas reinhardtii
ref|XP_002279500.1|  PREDICTED: 60S acidic ribosomal protein P0-2...  93.2    1e-19   Vitis vinifera
emb|CBI15980.3|  unnamed protein product                              92.4    2e-19   Vitis vinifera
gb|AGL34822.1|  ribosomal protein 10                                  89.4    2e-19   Cyrtandra kauaiensis
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                 92.8    3e-19   Citrus sinensis [apfelsine]
emb|CAN65663.1|  hypothetical protein VITISV_014917                   93.2    3e-19   Vitis vinifera
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg           92.0    4e-19   Capsella rubella
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802           91.3    8e-19   Selaginella moellendorffii
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765           91.3    8e-19   Selaginella moellendorffii
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282           91.3    8e-19   Selaginella moellendorffii
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like  91.3    9e-19   Solanum lycopersicum
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877           89.7    3e-18   Selaginella moellendorffii
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354            89.7    3e-18   Selaginella moellendorffii
emb|CBV76074.1|  60S acidic ribosomal protein P0                      89.7    3e-18   Polytomella sp. Pringsheim 198.80
ref|NP_001187030.1|  60S acidic ribosomal protein P0                  89.0    4e-18   Ictalurus punctatus
ref|XP_006640161.1|  PREDICTED: 60S acidic ribosomal protein P0-like  89.0    5e-18   Lepisosteus oculatus
ref|XP_011415179.1|  PREDICTED: 60S acidic ribosomal protein P0-like  89.0    5e-18   Crassostrea gigas
gb|EOA96285.1|  60S acidic ribosomal protein P0                       85.9    7e-18   Anas platyrhynchos [duck]
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328            88.6    8e-18   Volvox carteri f. nagariensis
gb|AAT44430.1|  ribosomal protein large P0-like protein               87.8    1e-17   Sparus aurata [gilthead bream]
gb|ADD21620.1|  ribosomal protein P0                                  87.4    1e-17   Hanleya nagelfar
gb|ACH70801.1|  acidic ribosomal protein P0                           87.0    2e-17   Salmo salar
gb|KFQ02732.1|  60S acidic ribosomal protein P0                       86.3    3e-17   Haliaeetus albicilla
gb|ABU63975.1|  ribosomal protein large P0-like protein               86.7    3e-17   Perca flavescens
ref|NP_001080134.1|  ribosomal protein, large, P0                     86.7    4e-17   Xenopus laevis [clawed frog]
gb|KFO65132.1|  60S acidic ribosomal protein P0                       86.3    4e-17   Corvus brachyrhynchos
ref|XP_008639852.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   
ref|XP_005421617.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   
ref|XP_007434308.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  86.3    4e-17   
ref|XP_008924020.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   
ref|XP_010396743.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   
ref|XP_002199561.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   Taeniopygia guttata
ref|XP_005524479.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005493516.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   Zonotrichia albicollis
ref|XP_010133581.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   Buceros rhinoceros silvestris
ref|XP_005987234.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    4e-17   Latimeria chalumnae
ref|NP_989067.1|  ribosomal protein, large, P0                        86.3    4e-17   Xenopus tropicalis [western clawed frog]
ref|XP_006784596.1|  PREDICTED: 60S acidic ribosomal protein P0-like  86.3    4e-17   Neolamprologus brichardi [lyretail cichlid]
emb|CDQ67134.1|  unnamed protein product                              86.3    4e-17   Oncorhynchus mykiss
gb|ACI68961.1|  60S acidic ribosomal protein P0                       86.3    4e-17   Salmo salar
ref|XP_009915794.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.9    5e-17   Haliaeetus albicilla
gb|KFQ10333.1|  60S acidic ribosomal protein P0                       85.9    5e-17   Leptosomus discolor
ref|XP_005503982.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  86.3    5e-17   Columba livia [carrier pigeon]
ref|XP_005054917.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    5e-17   
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...  85.9    5e-17   Rana sylvatica
ref|XP_010572856.1|  PREDICTED: 60S acidic ribosomal protein P0       86.3    5e-17   Haliaeetus leucocephalus
ref|XP_010740439.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  85.9    5e-17   
gb|KFV51543.1|  60S acidic ribosomal protein P0                       85.5    5e-17   Gavia stellata
ref|XP_009487343.1|  PREDICTED: 60S acidic ribosomal protein P0       85.9    6e-17   Pelecanus crispus
ref|XP_010879645.1|  PREDICTED: 60S acidic ribosomal protein P0       85.9    6e-17   Esox lucius
gb|KFP45896.1|  60S acidic ribosomal protein P0                       85.5    6e-17   Chlamydotis macqueenii
ref|XP_009948467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.9    6e-17   Leptosomus discolor
gb|KFP74395.1|  60S acidic ribosomal protein P0                       85.9    6e-17   Acanthisitta chloris
gb|ACO09070.1|  60S acidic ribosomal protein P0                       85.9    6e-17   Osmerus mordax
ref|XP_009807426.1|  PREDICTED: 60S acidic ribosomal protein P0       85.5    6e-17   Gavia stellata
ref|XP_010226991.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.9    6e-17   Tinamus guttatus
ref|XP_009083235.1|  PREDICTED: 60S acidic ribosomal protein P0       85.9    6e-17   Acanthisitta chloris
emb|CDQ63253.1|  unnamed protein product                              85.9    6e-17   Oncorhynchus mykiss
ref|XP_010127000.1|  PREDICTED: 60S acidic ribosomal protein P0       85.5    6e-17   Chlamydotis macqueenii
ref|XP_008292997.1|  PREDICTED: 60S acidic ribosomal protein P0       85.9    6e-17   Stegastes partitus
gb|KFZ54738.1|  60S acidic ribosomal protein P0                       85.5    6e-17   Podiceps cristatus
ref|XP_008501040.1|  PREDICTED: 60S acidic ribosomal protein P0       85.9    7e-17   Calypte anna
ref|XP_009869989.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.5    7e-17   Apaloderma vittatum
ref|XP_010740438.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  85.9    7e-17   
gb|KFP07838.1|  60S acidic ribosomal protein P0                       85.9    7e-17   Calypte anna
gb|KFV06138.1|  60S acidic ribosomal protein P0                       85.5    7e-17   Tauraco erythrolophus
ref|XP_009907942.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.9    7e-17   Picoides pubescens
ref|XP_009582133.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.5    7e-17   Fulmarus glacialis
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like  85.9    7e-17   Solanum tuberosum [potatoes]
ref|XP_009989862.1|  PREDICTED: 60S acidic ribosomal protein P0       85.5    7e-17   Tauraco erythrolophus
ref|XP_005107960.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  85.5    7e-17   Aplysia californica
gb|KFQ53080.1|  60S acidic ribosomal protein P0                       85.5    8e-17   Nestor notabilis
ref|XP_008318611.1|  PREDICTED: 60S acidic ribosomal protein P0       85.5    8e-17   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003211127.2|  PREDICTED: 60S acidic ribosomal protein P0       85.5    8e-17   
ref|XP_005445335.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.5    8e-17   
ref|XP_010016668.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.5    9e-17   Nestor notabilis
ref|XP_010003135.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.5    9e-17   Chaetura pelagica
ref|XP_010306195.1|  PREDICTED: 60S acidic ribosomal protein P0       85.5    9e-17   Balearica regulorum gibbericeps
ref|XP_009708350.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.5    9e-17   Cariama cristata
ref|XP_010177042.1|  PREDICTED: 60S acidic ribosomal protein P0       85.1    1e-16   Mesitornis unicolor
ref|XP_004591943.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  84.7    1e-16   
gb|EPQ19352.1|  60S acidic ribosomal protein P0                       82.4    1e-16   Myotis brandtii
gb|ADD21618.1|  ribosomal protein P0                                  85.1    1e-16   Micromenia fodiens
dbj|BAH70537.1|  ACYPI000079                                          85.1    1e-16   Acyrthosiphon pisum
emb|CAQ63458.1|  ribosomal protein                                    85.1    1e-16   Mytilus galloprovincialis
ref|NP_001119687.1|  ribosomal protein LP0                            85.1    1e-16   Acyrthosiphon pisum
ref|XP_004591942.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  85.1    1e-16   Ochotona princeps [southern American pika]
dbj|BAH70543.1|  ACYPI000079                                          85.1    1e-16   Acyrthosiphon pisum
ref|XP_007513516.1|  60S acidic ribosomal protein P0                  85.1    1e-16   Bathycoccus prasinos
gb|AAU84931.1|  putative acidic p0 ribosomal protein                  85.1    1e-16   Aphis citricidus
gb|AHB33743.1|  60S acidic ribosomal protein P0                       85.1    1e-16   Cyprinus carpio [carp]
gb|AAI04646.1|  RPLP0 protein                                         83.2    1e-16   Homo sapiens [man]
dbj|BAF98695.1|  ribosomal protein LP0                                85.1    1e-16   Solea senegalensis
dbj|BAA25845.1|  ribosomal protein P0                                 81.6    1e-16   Homo sapiens [man]
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607            84.7    2e-16   Chlorella variabilis
gb|AAF98712.1|AF162483_1  acidic ribosomal phosphoprotein PO          81.6    2e-16   Macaca mulatta [rhesus macaque]
gb|ABM55512.1|  putative ribosomal protein P0                         84.3    2e-16   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|KDD72928.1|  hypothetical protein H632_c2720p0                     84.0    2e-16   Helicosporidium sp. ATCC 50920
ref|XP_003226041.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    2e-16   
ref|XP_010080334.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    2e-16   
ref|XP_010171168.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  84.0    2e-16   
ref|XP_009641177.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    2e-16   
gb|KFP19329.1|  60S acidic ribosomal protein P0                       84.0    2e-16   
ref|XP_006053033.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    3e-16   
ref|XP_005962036.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  83.6    3e-16   
ref|XP_005891538.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  83.6    3e-16   
ref|XP_009685789.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  84.0    3e-16   
gb|EFB17077.1|  hypothetical protein PANDA_020357                     83.6    3e-16   
ref|XP_006129131.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    3e-16   
gb|AAB65436.1|  acidic ribosomal phosphoprotein PO                    83.6    3e-16   
gb|AJQ18907.1|  acidic ribosomal protein P0                           84.0    3e-16   
ref|XP_004888210.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    3e-16   
ref|XP_003478429.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    3e-16   
gb|ACH73063.1|  ribosomal protein LP0-like protein                    82.4    3e-16   
gb|EAW98170.1|  ribosomal protein, large, P0, isoform CRA_a           83.6    3e-16   
ref|XP_003280011.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  83.2    3e-16   
ref|NP_001092068.1|  60S acidic ribosomal protein P0                  83.6    3e-16   
gb|AAI51696.1|  RPLP0 protein                                         84.0    3e-16   
gb|AAH70194.1|  RPLP0 protein                                         83.2    3e-16   
gb|AAI02075.1|  Ribosomal protein, large, P0                          83.6    3e-16   
ref|NP_001182357.1|  acidic ribosomal phosphoprotein PO               83.6    3e-16   
ref|NP_001012700.1|  60S acidic ribosomal protein P0                  83.6    3e-16   
ref|XP_006192756.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  83.2    3e-16   
gb|AIS76467.1|  large ribosomal protein P0                            83.6    3e-16   
ref|XP_010602365.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
gb|ABX75446.1|  ribosomal protein lp0                                 81.3    4e-16   
gb|EHH21238.1|  hypothetical protein EGK_04254                        83.6    4e-16   
ref|XP_009246581.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  83.6    4e-16   
ref|XP_008151673.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  83.6    4e-16   
ref|XP_002425010.1|  ribosomal P0 protein, putative                   83.6    4e-16   
ref|XP_005962035.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  83.6    4e-16   
dbj|BAD96291.1|  ribosomal protein P0 variant                         83.6    4e-16   
dbj|BAF83798.1|  unnamed protein product                              83.6    4e-16   
ref|XP_003789970.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  83.6    4e-16   
dbj|BAD96188.1|  ribosomal protein P0 variant                         83.6    4e-16   
ref|XP_004017462.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  83.6    4e-16   
ref|XP_010366585.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
emb|CAA33199.1|  unnamed protein product                              83.6    4e-16   
ref|XP_004636304.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
ref|NP_000993.1|  60S acidic ribosomal protein P0                     83.6    4e-16   
ref|XP_002930016.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
ref|XP_005709583.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...  83.6    4e-16   
ref|XP_010967878.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
dbj|BAG65447.1|  unnamed protein product                              83.2    4e-16   
ref|NP_001239066.1|  ribosomal protein, large, P0                     83.6    4e-16   
ref|XP_006019892.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
ref|XP_010996948.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
ref|XP_008838692.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    4e-16   
ref|XP_004429976.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  83.6    4e-16   
ref|XP_006192755.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  83.6    4e-16   
ref|XP_001363537.1|  PREDICTED: 60S acidic ribosomal protein P0       83.2    5e-16   
ref|XP_009886897.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  83.2    5e-16   
gb|ADF97607.1|  large ribosomal protein P0                            83.2    5e-16   
ref|NP_990318.1|  60S acidic ribosomal protein P0                     83.2    5e-16   
ref|XP_006204865.1|  PREDICTED: 60S acidic ribosomal protein P0       83.2    5e-16   
gb|AHK09711.1|  60S acidic ribosomal protein P0                       83.2    5e-16   
ref|XP_005026768.1|  PREDICTED: translational activator GCN1          86.3    6e-16   
ref|XP_006890483.1|  PREDICTED: 60S acidic ribosomal protein P0       83.2    6e-16   
ref|XP_006096615.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  82.8    6e-16   
ref|XP_005863834.1|  PREDICTED: 60S acidic ribosomal protein P0       83.2    6e-16   
ref|XP_005876332.1|  PREDICTED: 60S acidic ribosomal protein P0-like  83.2    6e-16   
ref|XP_006895246.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.4    6e-16   
ref|XP_002505583.1|  predicted protein                                82.8    6e-16   
ref|NP_571655.2|  60S acidic ribosomal protein P0                     82.8    7e-16   
sp|Q9PV90.1|RLA0_DANRE  RecName: Full=60S acidic ribosomal protei...  82.8    7e-16   
gb|AFX73002.1|  deoxyribonuclease                                     82.8    7e-16   
gb|AAH49058.1|  Rplp0 protein                                         82.8    7e-16   
gb|ELT92567.1|  hypothetical protein CAPTEDRAFT_167366                82.4    9e-16   
gb|ABZ04250.1|  ribosomal protein rplp0                               82.4    1e-15   
gb|AFM88893.1|  ribosomal protein, large, P0                          82.4    1e-15   
ref|XP_010290716.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  82.0    1e-15   
gb|ACQ57902.1|  60S acidic ribosomal protein P0                       82.4    1e-15   
gb|AHK09710.1|  60S acidic ribosomal protein P0                       82.0    1e-15   
ref|XP_009178294.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  83.2    1e-15   
gb|AAH01127.1|  Ribosomal protein, large, P0                          82.0    1e-15   
gb|AFM87695.1|  ribosomal protein, large, P0                          81.6    1e-15   
ref|XP_005288756.1|  PREDICTED: 60S acidic ribosomal protein P0       82.0    1e-15   
gb|AHW68491.1|  60S acidic ribosomal protein P0                       82.0    1e-15   
gb|AEA51110.1|  60S acidic ribosomal protein P0                       82.0    1e-15   
ref|XP_005344377.1|  PREDICTED: 60S acidic ribosomal protein P0       82.0    1e-15   
gb|ABB29594.1|  ribosomal protein P0 large subunit                    81.6    1e-15   
ref|XP_008582193.1|  PREDICTED: 60S acidic ribosomal protein P0       82.0    1e-15   
gb|AHW68489.1|  60S acidic ribosomal protein P0                       81.6    2e-15   
gb|AFM87161.1|  ribosomal protein, large, P0                          81.6    2e-15   
ref|XP_005869587.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.0    2e-15   
gb|AFM90832.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AHW68488.1|  60S acidic ribosomal protein P0                       81.6    2e-15   
ref|NP_001279963.1|  ribosomal protein, large, P0                     81.6    2e-15   
gb|AFM89484.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM89459.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM88521.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM87759.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM85937.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM85590.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM87342.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM86948.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM86446.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM85775.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM89518.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM86819.1|  ribosomal protein, large, P0                          81.6    2e-15   
ref|XP_005336874.1|  PREDICTED: 60S acidic ribosomal protein P0       81.6    2e-15   
gb|AFM85706.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM85484.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|EHB17679.1|  60S acidic ribosomal protein P0                       82.4    2e-15   
gb|AFM86580.1|  ribosomal protein, large, P0                          81.6    2e-15   
gb|AAH03833.1|  Ribosomal protein, large, P0                          81.6    2e-15   
gb|AFM89472.1|  ribosomal protein, large, P0                          81.6    2e-15   
ref|XP_008141153.1|  PREDICTED: 60S acidic ribosomal protein P0       81.3    2e-15   
ref|XP_007643381.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  81.6    2e-15   
ref|XP_005798004.1|  PREDICTED: 60S acidic ribosomal protein P0-like  81.6    2e-15   
ref|XP_003973625.1|  PREDICTED: 60S acidic ribosomal protein P0-like  81.6    2e-15   
gb|ABF69531.1|  acidic ribosomal protein P0                           81.6    2e-15   
ref|XP_004664195.1|  PREDICTED: 60S acidic ribosomal protein P0       81.6    2e-15   
ref|XP_001115939.2|  PREDICTED: 60S acidic ribosomal protein P0-like  81.3    2e-15   
ref|XP_004581304.1|  PREDICTED: 60S acidic ribosomal protein P0-like  80.9    2e-15   
ref|XP_004545259.1|  PREDICTED: 60S acidic ribosomal protein P0-like  81.6    2e-15   
ref|XP_005918671.1|  PREDICTED: 60S acidic ribosomal protein P0-like  81.6    2e-15   
ref|XP_003907291.1|  PREDICTED: 60S acidic ribosomal protein P0       81.6    2e-15   
ref|XP_005396575.1|  PREDICTED: 60S acidic ribosomal protein P0       81.6    2e-15   
ref|XP_003763170.1|  PREDICTED: 60S acidic ribosomal protein P0-like  81.6    2e-15   
ref|XP_011146226.1|  PREDICTED: 60S acidic ribosomal protein P0-like  81.6    2e-15   
gb|AEA51182.1|  acidic ribosomal protein P0                           80.9    2e-15   
ref|XP_003441603.1|  PREDICTED: 60S acidic ribosomal protein P0       81.6    2e-15   
ref|XP_006893187.1|  PREDICTED: 60S acidic ribosomal protein P0-like  80.9    2e-15   
gb|ADV40160.1|  60S acidic ribosomal protein P0                       81.3    2e-15   
ref|XP_003495963.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  81.3    2e-15   
gb|EHH66765.1|  hypothetical protein EGM_03817                        81.3    3e-15   
gb|EHH54874.1|  hypothetical protein EGM_03973                        81.3    3e-15   
ref|XP_008407632.1|  PREDICTED: 60S acidic ribosomal protein P0       81.3    3e-15   
ref|XP_007554302.1|  PREDICTED: 60S acidic ribosomal protein P0       80.9    3e-15   
ref|XP_009440587.1|  PREDICTED: 60S acidic ribosomal protein P0-like  80.9    3e-15   
ref|XP_006612127.1|  PREDICTED: 60S acidic ribosomal protein P0-like  80.9    3e-15   
ref|XP_011157010.1|  PREDICTED: 60S acidic ribosomal protein P0       80.9    3e-15   
ref|XP_623106.1|  PREDICTED: 60S acidic ribosomal protein P0 isof...  80.9    3e-15   
ref|XP_004611132.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  80.5    3e-15   
gb|AFM87081.1|  ribosomal protein, large, P0                          80.9    4e-15   
emb|CAG01875.1|  unnamed protein product                              80.9    4e-15   
ref|XP_006902463.1|  PREDICTED: 60S acidic ribosomal protein P0-like  80.5    4e-15   
ref|XP_004611130.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  80.5    4e-15   
gb|EHH30862.1|  hypothetical protein EGK_20661                        78.2    5e-15   
gb|KDR14762.1|  60S acidic ribosomal protein P0                       80.5    5e-15   
gb|AFM86828.1|  ribosomal protein, large, P0                          80.5    5e-15   
ref|XP_003398378.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  80.5    5e-15   
ref|XP_004699568.1|  PREDICTED: 60S acidic ribosomal protein P0-like  80.1    5e-15   
gb|AFM86528.1|  ribosomal protein, large, P0                          80.1    6e-15   
gb|AFM86570.1|  ribosomal protein, large, P0                          80.1    6e-15   
ref|XP_011266937.1|  PREDICTED: 60S acidic ribosomal protein P0       80.1    6e-15   
gb|AFM86008.1|  ribosomal protein, large, P0                          80.1    6e-15   
ref|NP_031501.1|  60S acidic ribosomal protein P0                     80.1    6e-15   
ref|XP_006745368.1|  PREDICTED: 60S acidic ribosomal protein P0       80.1    7e-15   
ref|XP_004691046.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  79.7    7e-15   
gb|AHK09709.1|  60S acidic ribosomal protein P0                       79.7    7e-15   
ref|XP_003488353.1|  PREDICTED: 60S acidic ribosomal protein P0-like  80.1    7e-15   
gb|AAL62465.1|  60S acidic ribosomal protein P0                       80.1    7e-15   
gb|AFM86675.1|  ribosomal protein, large, P0                          80.1    7e-15   
ref|XP_002719840.1|  PREDICTED: 60S acidic ribosomal protein P0       80.1    7e-15   
gb|ADD21619.1|  ribosomal protein P0                                  79.7    7e-15   
ref|XP_008157424.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  80.1    8e-15   
ref|XP_004691044.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  79.7    8e-15   
gb|AAY66850.1|  60S acidic ribosomal protein P0                       79.7    8e-15   
ref|XP_002399611.1|  60S acidic ribosomal protein P0, putative        79.7    8e-15   
dbj|BAA32228.1|  60S acidic ribosomal protein PO                      76.6    8e-15   
gb|ABW16870.1|  ribosomal protein P0                                  79.7    8e-15   
gb|AEL28833.1|  ribosomal protein P0                                  79.7    9e-15   
gb|AGQ49465.1|  acidic ribosomal protein P0                           79.7    9e-15   
ref|XP_008067488.1|  PREDICTED: 60S acidic ribosomal protein P0       79.7    9e-15   
ref|XP_004658356.1|  PREDICTED: 60S acidic ribosomal protein P0-like  79.7    9e-15   
ref|XP_007448240.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  79.3    9e-15   
ref|XP_007255906.1|  PREDICTED: 60S acidic ribosomal protein P0-like  78.2    1e-14   
ref|XP_004281477.1|  PREDICTED: 60S acidic ribosomal protein P0       79.7    1e-14   
ref|XP_004709622.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  79.3    1e-14   
emb|CAX71185.1|  deoxyribonuclease                                    79.3    1e-14   
ref|XP_004315986.1|  PREDICTED: 60S acidic ribosomal protein P0       79.3    1e-14   
emb|CAX76652.1|  deoxyribonuclease                                    79.3    1e-14   
ref|XP_007130059.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  79.3    1e-14   
ref|XP_004709621.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  79.3    1e-14   
ref|XP_007936406.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  79.0    1e-14   
gb|AIW62441.1|  60S acidic ribosomal protein                          79.3    1e-14   
emb|CAX76656.1|  deoxyribonuclease                                    79.0    2e-14   
gb|AHW80376.1|  ribosomol protein P0L10e                              79.0    2e-14   
ref|XP_009285795.1|  PREDICTED: 60S acidic ribosomal protein P0       79.0    2e-14   
ref|XP_005352132.1|  PREDICTED: 60S acidic ribosomal protein P0-like  79.0    2e-14   
ref|XP_007936405.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  79.0    2e-14   
gb|AFK10546.1|  ribosomal protein, large, P0                          78.6    2e-14   
gb|AAP06198.1|  similar to GenBank Accession Number AY072284 60S ...  78.6    2e-14   
gb|EDL10286.1|  mCG121637                                             78.6    2e-14   
ref|XP_001422456.1|  Cytosolic 80S ribosomal protein P0; Cytosoli...  78.6    2e-14   
ref|XP_006865511.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  78.2    2e-14   
ref|XP_002114931.1|  expressed hypothetical protein                   78.6    2e-14   
gb|AER27808.1|  ribosomal protein P0                                  76.3    3e-14   
ref|XP_007635361.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  78.2    3e-14   
emb|CCA67079.1|  probable RPP0-acidic ribosomal protein L10.e         79.0    3e-14   
ref|XP_006865510.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  78.2    3e-14   
gb|KFM83506.1|  60S acidic ribosomal protein P0                       74.7    3e-14   
gb|AFM86966.1|  ribosomal protein, large, P0                          78.2    3e-14   
ref|XP_007642894.1|  PREDICTED: 60S acidic ribosomal protein P0-l...  77.8    3e-14   
ref|XP_009966547.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  77.8    3e-14   
gb|ABW90371.1|  putative ribosomal protein P0                         77.4    3e-14   
ref|XP_011473581.1|  PREDICTED: 60S acidic ribosomal protein P0       77.8    3e-14   
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...  78.2    3e-14   
ref|XP_007170980.1|  PREDICTED: 60S acidic ribosomal protein P0       78.2    3e-14   
ref|XP_003419310.1|  PREDICTED: 60S acidic ribosomal protein P0       78.2    4e-14   
gb|AJQ18906.1|  acidic ribosomal protein P0                           77.8    4e-14   
ref|XP_006092800.1|  PREDICTED: 60S acidic ribosomal protein P0-like  77.8    4e-14   
ref|XP_004379079.1|  PREDICTED: 60S acidic ribosomal protein P0 i...  77.8    4e-14   
gb|AJQ18908.1|  acidic ribosomal protein P0                           77.8    5e-14   
sp|Q8NHW5.1|RLA0L_HUMAN  RecName: Full=60S acidic ribosomal prote...  77.8    5e-14   
ref|XP_011146290.1|  PREDICTED: 60S acidic ribosomal protein P0-like  77.4    5e-14   
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908            77.4    6e-14   
emb|CAZ28666.1|  60S acidic ribosomal protein P0, putative            77.4    7e-14   
emb|CEG01946.1|  Ribosomal protein L10/acidic P0                      77.0    7e-14   
ref|XP_003082807.1|  RLA0_MAIZE 60S acidic ribosomal protein P0 p...  77.4    7e-14   
gb|AEE62116.1|  unknown                                               77.0    7e-14   
gb|EFX74249.1|  hypothetical protein DAPPUDRAFT_307348                77.0    7e-14   
ref|XP_006862524.1|  PREDICTED: 60S acidic ribosomal protein P0-like  77.0    8e-14   
gb|ELR61125.1|  60S acidic ribosomal protein P0                       73.9    8e-14   
gb|KGB41845.1|  60S acidic ribosomal protein P0                       77.4    9e-14   
gb|EHJ75936.1|  ribosomal protein P0                                  77.0    9e-14   
ref|XP_008544624.1|  PREDICTED: 60S acidic ribosomal protein P0       77.0    9e-14   



>emb|CDP14047.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFALGVSMVTSLSLAISYPTLAAAPHM INGYKNVL+IAVETDYSFP ADKVKEYL+D
Sbjct  215  IEKFALGVSMVTSLSLAISYPTLAAAPHMFINGYKNVLAIAVETDYSFPQADKVKEYLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA   AAA   A  AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPVAAADSGAAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009791710.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana sylvestris]
Length=321

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSLSLAISYPTLAAAPHM  N YKNVL+IAVETDYSFPLADKVKEYL+D
Sbjct  215  IEKFAMGVSMVTSLSLAISYPTLAAAPHMFTNAYKNVLAIAVETDYSFPLADKVKEYLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA   AAA   A  AAA  EEKK+EP EES+D+MGFSLFD
Sbjct  275  PSKFTAVAAAPVAAAGSGAAPAAAKEEEKKDEPAEESDDDMGFSLFD  321



>ref|XP_004239781.1| PREDICTED: 60S acidic ribosomal protein P0 [Solanum lycopersicum]
Length=321

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSL+LAISYPTLAAAPHM  N YKNVL+IA+ETDYSFPLADKVKEYL D
Sbjct  215  IEKFAMGVSMVTSLALAISYPTLAAAPHMFTNAYKNVLAIAIETDYSFPLADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFA  AA  AAAA   A  AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKFAAVAAAPAAAAGSGAAPAAAKEEEKKEEPAEESDDDMGFSLFD  321



>ref|XP_009608105.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana tomentosiformis]
Length=320

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSLSLAISYPTLAAAPHM  N YKNVL+IAVETDYSFPLADKVKEYL+D
Sbjct  215  IEKFAMGVSMVTSLSLAISYPTLAAAPHMFTNAYKNVLAIAVETDYSFPLADKVKEYLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF  A      AAAGS  A AAA EE+KEEP E S+D+MGFSLFD
Sbjct  275  PSKF-AAVVAAPVAAAGSGAAPAAAKEEEKEEPAEVSDDDMGFSLFD  320



>gb|AID52928.1| 60S acidic ribosomal protein P0 [Carthamus tinctorius]
Length=321

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFALGVSMVTSL+LAI YPT+AAAPHMLIN YKN L+IAVETDYSFPLADKVKEYL+D
Sbjct  214  IEKFALGVSMVTSLALAIHYPTIAAAPHMLINAYKNALAIAVETDYSFPLADKVKEYLED  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|NP_001275012.1| 60S acidic ribosomal protein P0-like [Solanum tuberosum]
 gb|ABB29933.1| P0 ribosomal protein-like [Solanum tuberosum]
 gb|ABB87111.1| P0 ribosomal protein-like [Solanum tuberosum]
Length=320

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSL+LAISYPTLAAAPHM  N YKNVL+IAVETDYSFPLADKVKEYL D
Sbjct  215  IEKFAMGVSMVTSLALAISYPTLAAAPHMFTNAYKNVLAIAVETDYSFPLADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA  AAAA   A  AAA  EEKKEEP E S+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPAAAAGSGAAPAAAKEEEKKEEPAEVSDDDMGFSLFD  320



>ref|XP_004972933.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLA+SYPTLAAAPHM INGYKNVL++AVETDYS+P ADK+KEYLKD
Sbjct  215  VEKFATGVSMVASLSLALSYPTLAAAPHMFINGYKNVLAVAVETDYSYPHADKIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            PSKF   A     AA GS  AAA   EEK  EP EES++EMGFSLFDD
Sbjct  275  PSKF---AVAAPVAAVGSGAAAAPKEEEKAPEPAEESDEEMGFSLFDD  319



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AVETDYSFP ADKVKEYLKD
Sbjct  215  IEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF  A A VAA AA S   AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF--AVAAVAAPAAESGAPAAAKEEEKKEEPAEESDDDMGFSLFD  319



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSLSLAI+YPTLAAAPHM IN YKNVL++AV TDYSFP ADKVKEYL D
Sbjct  215  IEKFAMGVSMVTSLSLAIAYPTLAAAPHMFINAYKNVLAVAVATDYSFPQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAA  AAA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  275  PSKFAVAAAAAAAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  321



>gb|KJB74260.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=273

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKN+L++AV T+YSFP ADKVKEYL D
Sbjct  167  IEKFATGVSMVTALSLAISYPTLAAAPHMFINGYKNILAVAVATEYSFPQADKVKEYLAD  226

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAAPVAAA  G+APAAA A EEKK EPEEES+D+MGFSLFD
Sbjct  227  PSKFAVAAAPVAAAGGGAAPAAAPAEEEKKPEPEEESDDDMGFSLFD  273



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKFALGVSMVTSLSLAISYPTLAAAPHMLIN YKN+L++AV TDYSFP A+KVKEYL D
Sbjct  215  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINAYKNLLAVAVATDYSFPQAEKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A  V++A +GSAP AAAA EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAVAVSSADSGSAPEAAAAVEEKKEEPAEESDDDMGFSLFD  320



>gb|KJB74261.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=321

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKN+L++AV T+YSFP ADKVKEYL D
Sbjct  215  IEKFATGVSMVTALSLAISYPTLAAAPHMFINGYKNILAVAVATEYSFPQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAAPVAAA  G+APAAA A EEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKFAVAAAPVAAAGGGAAPAAAPAEEEKKPEPEEESDDDMGFSLFD  321



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            L KFA GVSMVTSL LAISYPTLAAAPHM INGYKNVL+IA+ETDY FP A+KVKEYLKD
Sbjct  215  LAKFASGVSMVTSLCLAISYPTLAAAPHMFINGYKNVLAIALETDYDFPEAEKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAA    AAAA    AAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKFAVAAPAAGAAAASGGGAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKNVL++AV T+YSFP ADKVKEYL D
Sbjct  215  IEKFASGVSMVTALSLAISYPTLAAAPHMFINGYKNVLAVAVATEYSFPQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAAPVA    G+APAAA A EEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKFAVAAAPVAGGGGGAAPAAAPAEEEKKPEPEEESDDDMGFSLFD  321



>gb|ACL52455.1| unknown [Zea mays]
Length=319

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 3/108 (3%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLA+SYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLKD
Sbjct  215  IEKFATGVSMVASLSLALSYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            PSKF   A    AAAA S+ AAA   EEK  EP EES++EMGFSLFDD
Sbjct  275  PSKF---AVAAPAAAADSSAAAAPKEEEKAPEPAEESDEEMGFSLFDD  319



>ref|NP_001141489.1| hypothetical protein [Zea mays]
 gb|ACF86473.1| unknown [Zea mays]
 gb|AFW61287.1| hypothetical protein ZEAMMB73_391125 [Zea mays]
Length=319

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLA+SYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLKD
Sbjct  215  IEKFATGVSMVASLSLALSYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            PSKF   A     AAA S+ AAA   EEK  EP EES++EMGFSLFDD
Sbjct  275  PSKF---AVAAPVAAADSSAAAAPKEEEKAPEPAEESDEEMGFSLFDD  319



>ref|XP_004958562.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLA+SYPTLAAAPHM INGYKNVL++AVETDYS+P ADK+KEYLKD
Sbjct  215  IEKFATGVSMVASLSLALSYPTLAAAPHMFINGYKNVLAVAVETDYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFALGVSMVT+LSLAISYPTLAAAPHM IN YKNVL++AVET+YS+P AD+VKE+LKD
Sbjct  214  MEKFALGVSMVTALSLAISYPTLAAAPHMFINAYKNVLAVAVETEYSYPHADEVKEFLKD  273

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVA AP  AA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  274  PSKFAVAVAPAGAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  320



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LKD
Sbjct  215  IEKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAA    AA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  275  PSKFAVAAVATPAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  321



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LKD
Sbjct  215  IEKFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAA    AA +G+APAAAA  EEKK+EP EES+D+MGFSLFD
Sbjct  275  PSKFAVAAVAAPAADSGAAPAAAAKEEEKKDEPAEESDDDMGFSLFD  321



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLA+SYPTLAAAPHM +NGYKNVL++AVETDYSFP AD++KEYLKD
Sbjct  216  MEKFACGVSMVASLSLAVSYPTLAAAPHMFLNGYKNVLALAVETDYSFPHADQIKEYLKD  275

Query  342  PSKF  331
            PSKF
Sbjct  276  PSKF  279



>ref|XP_004165071.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
Length=320

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKFALGVSMVTSLSLAISYPTLAAAPHMLIN YKN+L++AV TDYSFP A+KVKEYL D
Sbjct  215  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINAYKNLLAVAVATDYSFPQAEKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A  V+AA +GSAP AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAVAVSAADSGSAPEAAADVEEKKEEPAEESDDDMGFSLFD  320



>gb|KJB78787.1| hypothetical protein B456_013G019000 [Gossypium raimondii]
Length=321

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVLS+AV T+YSFP ADKVKEYL D
Sbjct  215  IEKFATGVSMVTALSLAISYPTLAAAPHMFINAYKNVLSVAVATEYSFPQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVA A VA  A  +  AAAAAAEEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKFAVAVAAVATDAGAAPAAAAAAAEEKKPEPEEESDDDMGFSLFD  321



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLAISYPTLAAAPHM IN YKNVL++AV T+YSFP ADKVKEYLKD
Sbjct  198  IEKFAAGVSMVTSLSLAISYPTLAAAPHMFINAYKNVLAVAVATEYSFPQADKVKEYLKD  257

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A     A+   A  AA+  EEKKEEP+EES+D+MGFSLFD
Sbjct  258  PSKF-AVATAPVTASDAGAAPAASKEEEKKEEPQEESDDDMGFSLFD  303



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVLS+AV T+YSFP ADKVKEYL D
Sbjct  215  IEKFATGVSMVTALSLAISYPTLAAAPHMFINAYKNVLSVAVATEYSFPQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVA A VA  A  +   A AAAEEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKFAVAVAAVATDAGAAQATATAAAEEKKPEPEEESDDDMGFSLFD  321



>gb|ACF83717.1| unknown [Zea mays]
 gb|AFW74477.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLAISYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLKD
Sbjct  215  IEKFATGVSMVASLSLAISYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|NP_001105482.1| 60S acidic ribosomal protein P0 [Zea mays]
 sp|O24573.3|RLA0_MAIZE RecName: Full=60S acidic ribosomal protein P0 [Zea mays]
 emb|CAA69256.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLAISYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLKD
Sbjct  215  IEKFATGVSMVASLSLAISYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_002445000.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
 gb|EES14495.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
Length=319

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLAISYPTLAA PHM INGYKNVL++AVETDYS+P ADK+KEYLKD
Sbjct  215  IEKFATGVSMVASLSLAISYPTLAAVPHMFINGYKNVLAVAVETDYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVLS+AV TDYSFP ADKVKE+LKD
Sbjct  215  MEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A    AAA     AA    EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAVAPVAAADAGGSAAPPKEEEKKEEPAEESDDDMGFSLFD  320



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLAISYPTLAAAPHM IN YKNVL++AV T+YSFP ADKVKEYLKD
Sbjct  187  IEKFAAGVSMVTSLSLAISYPTLAAAPHMFINAYKNVLAVAVATEYSFPQADKVKEYLKD  246

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A     A+   A  AA+  EEKKEEP+EES+D+MGFSLFD
Sbjct  247  PSKF-AVATAPVTASDAGAAPAASKEEEKKEEPQEESDDDMGFSLFD  292



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVLS+AV TDYSFP ADKVKE+LKD
Sbjct  187  MEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKD  246

Query  342  PSKF  331
            PSKF
Sbjct  247  PSKF  250



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLAISYPTLAAAPHM IN YKNVL++AV T+YSFP ADKVKEYLKD
Sbjct  215  IEKFAAGVSMVTSLSLAISYPTLAAAPHMFINAYKNVLAVAVATEYSFPQADKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A     A+   A  AA+  EEKKEEP+EES+D+MGFSLFD
Sbjct  275  PSKF-AVATAPVTASDAGAAPAASKEEEKKEEPQEESDDDMGFSLFD  320



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF  GVS+VTSLSLAIS+PTLAAAPHM +N YKNVLS+AVETDYS+P ADKVKEYLKD
Sbjct  215  IEKFVSGVSIVTSLSLAISFPTLAAAPHMFVNAYKNVLSVAVETDYSYPEADKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAA    AAA+G+  AAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKFAVAATVAPAAASGAPAAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKFA GVSMVTSLSLAISYPTLAAAPHM +N YKN+LS+A+ TDYSFP ADKVKEYLKD
Sbjct  215  LEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA  A AAA  APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAVAAPAAASGAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKFA GVSMVTSLSLAISYPTLAAAPHM +N YKN+LS+A+ TDYSFP ADKVKEYLKD
Sbjct  215  LEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA  A AAA  APAAAA  EEK EEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAVAAPAAASGAPAAAAKEEEKMEEPAEESDDDMGFSLFD  320



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKFALGVSMVTSLSLAISYPTLAAAPHMLIN YKN+L++AV TDYSFP A+KVKEYL D
Sbjct  215  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINAYKNLLAVAVATDYSFPEAEKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A  V+AA +GSAP AAAA EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAVAVSAADSGSAPEAAAAVEEKKEEPAEESDDDMGFSLFD  320



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            + KFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AVETDYSFP ADKVKEYLKD
Sbjct  215  IGKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA  A AAA  APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAVAAPAAASGAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>gb|EYU19990.1| hypothetical protein MIMGU_mgv1a0100892mg, partial [Erythranthe 
guttata]
Length=213

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            + KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL D
Sbjct  106  IGKFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLAD  165

Query  342  PSKF  331
            PSKF
Sbjct  166  PSKF  169



>gb|EYU43502.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=242

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL DPS
Sbjct  137  KFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPS  196

Query  336  KF  331
            KF
Sbjct  197  KF  198



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMV SLSLAI+YPTLAAAPHM IN YKN+LS+AVETDYSFP ADKVKEYL D
Sbjct  215  VEKFAMGVSMVASLSLAITYPTLAAAPHMFINAYKNLLSVAVETDYSFPQADKVKEYLAD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|EMS52841.1| 60S acidic ribosomal protein P0 [Triticum urartu]
Length=263

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV SLSLA+SYPTLAAAPHM +NGYKNVL++AVET+YSFP AD++KEYLKD
Sbjct  157  MEKFACGVSMVASLSLAVSYPTLAAAPHMFLNGYKNVLALAVETEYSFPHADQIKEYLKD  216

Query  342  PSKF  331
            PSKF
Sbjct  217  PSKF  220



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLA+SYPTLAAAPHM IN YKNVL++AV T+Y+FP A+KVKEYLKD
Sbjct  215  MEKFAAGVSMVTALSLAVSYPTLAAAPHMFINAYKNVLAVAVATEYTFPQAEKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAA       G+APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKFAVAAASAGGETGGAAPAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>gb|KJB76158.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=315

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKNVL++AV T+YSFP ADKVKEYL D
Sbjct  210  IEKFATGVSMVTALSLAISYPTLAAAPHMFINGYKNVLAVAVATEYSFPQADKVKEYLAD  269

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA   AA  G+APAAAA  EEKK EPEEES+D+MGFSLFD
Sbjct  270  PSKF-AVAAAPVAAGGGAAPAAAAPVEEKKPEPEEESDDDMGFSLFD  315



>gb|KJB76159.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=320

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM INGYKNVL++AV T+YSFP ADKVKEYL D
Sbjct  215  IEKFATGVSMVTALSLAISYPTLAAAPHMFINGYKNVLAVAVATEYSFPQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA   AA  G+APAAAA  EEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPVAAGGGAAPAAAAPVEEKKPEPEEESDDDMGFSLFD  320



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLAISYPTLAAAPHM +N YKNVLS+AV T+YSFP ADKVKE+LKD
Sbjct  215  MEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSVAVATEYSFPQADKVKEFLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A    AAA     AA    EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAVAPVAAADAGGSAAPPKEEEKKEEPAEESDDDMGFSLFD  320



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL DPS
Sbjct  217  KFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL DPS
Sbjct  216  KFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPS  275

Query  336  KF  331
            KF
Sbjct  276  KF  277



>gb|EEC82854.1| hypothetical protein OsI_27702 [Oryza sativa Indica Group]
Length=216

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  112  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  171

Query  342  PSKF  331
            PSKF
Sbjct  172  PSKF  175



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL DPS
Sbjct  217  KFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_002440235.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
 gb|EES18665.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
Length=319

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 3/108 (3%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF+ GVSMV SLSL +SYPTLAAAPHM INGYKNVL++AVETDYS+P AD++KEYLKD
Sbjct  215  VEKFSAGVSMVASLSLVVSYPTLAAAPHMFINGYKNVLAVAVETDYSYPHADEIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            PSKFAVAA   AA +  SA         + +E  +    EMGFSLFDD
Sbjct  275  PSKFAVAAPVAAADSGASAAPKEEEKAPESDEESDG---EMGFSLFDD  319



>gb|ABR26209.1| 60S acidic ribosomal protein p0 [Oryza sativa Indica Group]
Length=238

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  134  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  193

Query  342  PSKF  331
            PSKF
Sbjct  194  PSKF  197



>ref|XP_010234277.1| PREDICTED: 60S acidic ribosomal protein P0 [Brachypodium distachyon]
Length=321

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA GVSMV SLSLAISYPT+AAAPHM IN YKNVL+IAVETDYS+P  DK+KEYLKD
Sbjct  215  MDKFASGVSMVASLSLAISYPTIAAAPHMFINAYKNVLAIAVETDYSYPHGDKIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            PSKFAVAA   AAA+ G+A AA    E+K E  EE    EMGFSLFDD
Sbjct  275  PSKFAVAAPAAAAASGGAAAAAPKEEEKKDEPEEESDG-EMGFSLFDD  321



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVT+LSL ISYPTLAAAPHM IN YKNVLS+A+ETDYSFP ADKVKEYL D
Sbjct  222  IEKFASGISMVTALSLGISYPTLAAAPHMFINAYKNVLSLALETDYSFPQADKVKEYLAD  281

Query  342  PSKF  331
            PSKF
Sbjct  282  PSKF  285



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSMVTSLSLAISYPTLAAAPHML+N YKNVL++AV T+YS P ADKVKEYLKD
Sbjct  215  IEKFAIGVSMVTSLSLAISYPTLAAAPHMLVNAYKNVLAVAVATEYSSPEADKVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|EAZ41410.1| hypothetical protein OsJ_25932 [Oryza sativa Japonica Group]
Length=235

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  131  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  190

Query  342  PSKF  331
            PSKF
Sbjct  191  PSKF  194



>ref|XP_006659092.1| PREDICTED: 60S acidic ribosomal protein P0-like [Oryza brachyantha]
Length=319

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  215  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|ADU04571.1| 60S acidic ribosomal protein PO [Phaseolus vulgaris]
 gb|AGV54610.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKFA GVSMVT LSLAISYPTLAAAPHM +N YKN+LS+A+ TDYSFP ADKVKEYLKD
Sbjct  215  LEKFAAGVSMVTFLSLAISYPTLAAAPHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|ADE76171.1| unknown [Picea sitchensis]
Length=266

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+S VT+LSLAISYPT+AA PH +INGYKNVL+IA+E DYSFPLA+KVKEYLKD
Sbjct  160  IEKFAAGISTVTALSLAISYPTIAAVPHAIINGYKNVLAIAIELDYSFPLAEKVKEYLKD  219

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAAPVA+A   +  AAA   EEKK EPEEESE++MGFSLFD
Sbjct  220  PSKFAVAAAPVASATEAAPAAAAPKEEEKKPEPEEESEEDMGFSLFD  266



>ref|NP_001060923.1| Os08g0130500 [Oryza sativa Japonica Group]
 sp|P41095.3|RLA0_ORYSJ RecName: Full=60S acidic ribosomal protein P0 [Oryza sativa Japonica 
Group]
 pdb|3J61|QQ Chain q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA04668.1| acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAF22837.1| Os08g0130500 [Oryza sativa Japonica Group]
 dbj|BAG89244.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  215  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>emb|CBX25428.1| hypothetical_protein [Oryza glaberrima]
Length=322

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  217  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  276

Query  342  PSKF  331
            PSKF
Sbjct  277  PSKF  280



>gb|ABA91328.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAY79838.1| hypothetical protein OsI_34997 [Oryza sativa Indica Group]
 gb|EAZ41411.1| hypothetical protein OsJ_25933 [Oryza sativa Japonica Group]
Length=320

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  215  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|EAY82182.1| hypothetical protein OsI_37384 [Oryza sativa Indica Group]
 emb|CBX24392.1| hypothetical_protein [Oryza glaberrima]
Length=320

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  215  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|ABA95724.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19563.1| hypothetical protein OsJ_35136 [Oryza sativa Japonica Group]
Length=320

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKD
Sbjct  215  MEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVLSIAV T+YSFP ADKVKE+LKDPS
Sbjct  217  KFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLSIAVVTEYSFPEADKVKEFLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+L+LA+SYPTLAAAPHM IN YKNVLS+A+ T+YSFP A+KVKE+LKD
Sbjct  214  MEKFAAGVSMVTALALAVSYPTLAAAPHMFINAYKNVLSVALATEYSFPQAEKVKEFLKD  273

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAAPVA  A G+APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  274  PSKFAVAAAPVAGNAGGAAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GV+M+T+LSLAISYPTLAAAPHM++NGYKNVL +AVET+Y++P A +VKEYLKD
Sbjct  215  VEKFAAGVTMITTLSLAISYPTLAAAPHMIVNGYKNVLGVAVETEYTYPQAQQVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +E+FA GVSMV SLSLA+SYPT+AAAPHM +NGYKNVL++A+ETDYS+P AD++KEYLKD
Sbjct  218  MERFASGVSMVASLSLAVSYPTMAAAPHMFLNGYKNVLAVALETDYSYPHADQIKEYLKD  277

Query  342  PSKF  331
            PSKF
Sbjct  278  PSKF  281



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLA+SYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+K+KEYLKD
Sbjct  215  IEKFAAGVSMVTSLSLAVSYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF  A A        +A  AAA AEEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF--AVAATPVTEEAAAAPAAAPAEEKKEEPAEESDDDMGFSLFD  319



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLA+SYPTLAAAP+M + GY+NVL++AVETDYS+P AD+VKEYLKD
Sbjct  215  MEKFATGVSMVTTLSLAVSYPTLAAAPYMFVKGYENVLAVAVETDYSYPQADQVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LKDPS
Sbjct  217  KFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPS  276

Query  336  KFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            KFAVAA    A  +G+ PA AAAA     EPEEES+D++GF LF D
Sbjct  277  KFAVAAVAAPADVSGATPAPAAAAAAAAAEPEEESDDDIGFGLFGD  322



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL++AV T+YSFP ADKVKE+LKDPS
Sbjct  217  KFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPS  276

Query  336  KFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            KFAVAA    A  +G+ PA AAAA     EPEEES+D++GF LF D
Sbjct  277  KFAVAAVAAPADVSGATPAPAAAAAAAAAEPEEESDDDIGFGLFGD  322



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKNVL+IAV TDY+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNVLAIAVATDYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPS
Sbjct  217  KFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPS
Sbjct  217  KFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVTSLSLAISYPTLAAAPHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPS
Sbjct  217  KFAIGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            + KFA+GVSM+TSL+L++SYPTLAAAPHM IN YKNVL+IAV TDYSFP ADKVKEYL D
Sbjct  212  MAKFAIGVSMITSLALSVSYPTLAAAPHMFINAYKNVLAIAVSTDYSFPQADKVKEYLAD  271

Query  342  PSKF  331
            PSKF
Sbjct  272  PSKF  275



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKNVL+IAV TDY+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNVLAIAVATDYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSLSLA+SYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+KVKEYLKD
Sbjct  215  IEKFAAGISMVTSLSLAVSYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF  A A    AA  +A   A  AEEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF--AVAAPVVAAEAAAAPTAEPAEEKKEEPAEESDDDMGFSLFD  319



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVL++A+ T+YSFP ADKVKEYL D
Sbjct  216  VEKFAAGVSMVTALSLAISYPTLAAAPHMFINAYKNVLALAIATEYSFPQADKVKEYLAD  275

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA   AA AG+APAA AA EEKK EPEEES+D+MGFSLFD
Sbjct  276  PSKF-AVAAAPVAADAGAAPAAPAAVEEKKPEPEEESDDDMGFSLFD  321



>gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSL+LA+SYPTLAAAP+M IN YKNVL+++V TDY+FP A+KVKEYL+D
Sbjct  215  VEKFATGVSMVTSLALAVSYPTLAAAPYMFINAYKNVLAVSVATDYTFPQAEKVKEYLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAAAPVAAA AG+APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKFAVAAAPVAAATAGAAPAAAAKEEEKKEEPAEESDDDMGFSLFD  321



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVL++A+ T+YSFP ADKVKEYL D
Sbjct  215  VEKFAAGVSMVTALSLAISYPTLAAAPHMFINAYKNVLALAIATEYSFPQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA   AA AG+APAA AA EEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPVAADAGAAPAAPAAVEEKKPEPEEESDDDMGFSLFD  320



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GV MV+SLSLAISYP++AAAPHM +N YKN+L++AV T+YSFP ADKVKEYLKDPS
Sbjct  217  KFAEGVCMVSSLSLAISYPSIAAAPHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPS  276

Query  336  KFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            KFAVA     A  +G+APAAA+  EEKKEE  +ES+D+MGFSLFD
Sbjct  277  KFAVAVVAAPATKSGAAPAAASKVEEKKEEAADESDDDMGFSLFD  321



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+KVKEYLKD
Sbjct  215  MEKFAAGVSMVTALSLAISYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSK    AA ++A   G+APAAA+  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKL-AVAAAMSAGDGGAAPAAASKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLA+SYPTLAAAP+M + GYKNVL++ VET+YS+P AD+VKEYLKD
Sbjct  215  MEKFATGVSMVTTLSLAVSYPTLAAAPYMFVKGYKNVLAVTVETEYSYPQADQVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G++M+TSLSLAISYPTLAAAPHM IN YKN+L++AV T+YS+P A++VKE+LKD
Sbjct  215  VEKFATGIAMITSLSLAISYPTLAAAPHMFINAYKNILAVAVATEYSYPQAEEVKEFLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAA P AAAAA     AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKFAVAAVPAAAAAAPGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  321



>gb|AAD56335.1|AC009326_22 putative 60S acidic ribosomal protein, 5' partial [Arabidopsis 
thaliana]
Length=230

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLKD
Sbjct  124  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLKD  183

Query  342  PSKF  331
            PSKF
Sbjct  184  PSKF  187



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL+IAV T+YSFP A+ V+EYLKD
Sbjct  215  VEKFATGVSMVTSLALAISYPTLAAAPHMFVNAYKNVLAIAVATEYSFPRAETVREYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL+IAV T+YSFP A+ V+EYLKD
Sbjct  215  VEKFATGVSMVTSLALAISYPTLAAAPHMFVNAYKNVLAIAVATEYSFPRAETVREYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV TDY+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATDYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GV+M+T+LSLAISYPTLAAAPHM++NGYKNVL +A+ET+Y++P A +VKEYLKD
Sbjct  215  VEKFAAGVAMMTTLSLAISYPTLAAAPHMIVNGYKNVLCVALETEYTYPQAQQVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 1/108 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G++M+TSLSLAISYPTLAAAPHMLIN YKN+LS+AV T+YS+P A++VKE+LKD
Sbjct  215  VEKFATGITMITSLSLAISYPTLAAAPHMLINAYKNILSVAVATEYSYPQAEEVKEFLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesE-DEMGFSLFD  202
            PSKFAVAAAP AAAAA    A AAA EE+K+E   E   D+MGFSLFD
Sbjct  275  PSKFAVAAAPAAAAAAAPGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  322



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLKD
Sbjct  181  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLKD  240

Query  342  PSKF  331
            PSKF
Sbjct  241  PSKF  244



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVS+VTSLSLAISYPTL AAPHM IN YKNVL++A+ T+YSFP A+KVKEYLKD
Sbjct  215  IEKFAAGVSLVTSLSLAISYPTLVAAPHMFINAYKNVLAVAIATEYSFPHAEKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA    A   +A +++A AEEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPVVAEVAAAASSSAPAEEKKEEPAEESDDDMGFSLFD  320



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVT+LSLAISYPTLAA PHM INGYKNVL++AV T+YSF  ADKVKEYL D
Sbjct  215  IEKFASGVSMVTALSLAISYPTLAAVPHMFINGYKNVLAVAVATEYSFRQADKVKEYLAD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A    AAA G+APAAA  AEEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKF-AVATAPVAAAGGAAPAAAVPAEEKKPEPEEESDDDMGFSLFD  320



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYLKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>dbj|BAJ92405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA GVSMV SLSLAISYPT+AAAPHM +N YKNVL++A+ETDYS+  ADK+KEYLKD
Sbjct  215  MDKFASGVSMVASLSLAISYPTMAAAPHMFLNAYKNVLAVALETDYSYDHADKIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            PSKFAVAA   AA+   +A A     ++++ E E +   EMGFSLFDD
Sbjct  275  PSKFAVAAPAAAASGGAAAAAPKEEEKKEEPEEESDG--EMGFSLFDD  320



>gb|EMT17099.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=320

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA GVSMV SLSLAISYPT+AAAPHM +N YKNVL++A+ETDYS+  ADK+KEYLKD
Sbjct  215  MDKFASGVSMVASLSLAISYPTMAAAPHMFLNAYKNVLAVALETDYSYDHADKIKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFDD  199
            PSKFAVAA   AA+   +A A     ++ + E E +   EMGFSLFDD
Sbjct  275  PSKFAVAAPAAAASGGAAAAAPKEEEKKDEPEEESDG--EMGFSLFDD  320



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+G+SMVTSL+LAISYPTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFAVGISMVTSLALAISYPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LAISYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAISYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GVSM+T+LSLAISYPTLAAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LKD
Sbjct  215  VEKFAVGVSMITALSLAISYPTLAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G++M+TSLSLAISYPTLAAAPHM IN YKN+LS+AV T+YS+P A++VKE+LKD
Sbjct  215  VEKFATGITMITSLSLAISYPTLAAAPHMFINAYKNILSVAVATEYSYPQAEEVKEFLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesE-DEMGFSLFD  202
            PSKFAVAAAP AAAAA    A AAA EE+K+E   E   D+MGFSLFD
Sbjct  275  PSKFAVAAAPAAAAAAAPGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  322



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LKD
Sbjct  215  MEKFASGVSMVTSLALAISYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATNYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LKD
Sbjct  215  MEKFASGVSMVTSLALAISYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>dbj|BAJ94456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA GVSMV SLSLAISYPT+AAAPHM +N YKNVL++A+ETDYS+  ADK+KEYLKD
Sbjct  215  MDKFASGVSMVASLSLAISYPTMAAAPHMFLNAYKNVLAVALETDYSYDHADKIKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSM T+L+LA+SYP LAAAPHM +N YKNVL++AV TDYSFP A+KVKEYLKD
Sbjct  215  VEKFAAGVSMATALALAVSYPMLAAAPHMFVNAYKNVLAVAVATDYSFPQAEKVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSM  SLSLAISYPTLAAAPHM +N YKN L++AV +DYSFP A+KVKEYLKD
Sbjct  215  VEKFANGVSMAASLSLAISYPTLAAAPHMFVNAYKNALAVAVASDYSFPQAEKVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GV MV+SLSLAISYP++AAAPHM +N YKN+L++AV T+YSFP ADKVKEYLKDPS
Sbjct  217  KFAEGVCMVSSLSLAISYPSIAAAPHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPS  276

Query  336  KFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            KF   A   A A    A  AAA+  E+K+E  +ES+D+MGFSLFD
Sbjct  277  KF-AVAVVAAPATKSGAAPAAASKVEEKKEEADESDDDMGFSLFD  320



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSL+LAISYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LKD
Sbjct  215  MEKFASGVSMVTSLALAISYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_006848156.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF +GVSMVT+LSL+ISYPTLAAAPHM INGYKN L+IAV TDY+F  A++VKEYLKD
Sbjct  215  IEKFDIGVSMVTALSLSISYPTLAAAPHMFINGYKNALAIAVATDYTFAQAEQVKEYLKD  274

Query  342  PSKF  331
            P+KF
Sbjct  275  PTKF  278



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLA+SYPTL AAPHM IN YKNVL++A+ T+Y+F  A+KVKEYLKD
Sbjct  215  VEKFAAGVSMVTSLSLALSYPTLVAAPHMFINAYKNVLAVAIATEYTFEQAEKVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKFAVAA   AAAAA +APAAAA  EEKKEEP EES+++MGFSLFD
Sbjct  275  PSKFAVAAPVEAAAAAAAAPAAAAKEEEKKEEPAEESDEDMGFSLFD  321



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KF +G+SM TSLSL ISYP L+AAPHMLINGYKN L+IAVET+YSFP AD+VKEYLKDPS
Sbjct  217  KFLVGLSMATSLSLEISYPALSAAPHMLINGYKNALAIAVETEYSFPQADEVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GV MV+SLSLAISYP++AAAPHM +N YKN+L++AV T+YSFP ADKVKEYLKDPS
Sbjct  217  KFAEGVCMVSSLSLAISYPSIAAAPHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPS  276

Query  336  KFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            KF   A   A A    A  AAA+  E+K+E  +ES+D+MGFSLFD
Sbjct  277  KF-AVAVVAAPATKSGAAPAAASKVEEKKEEADESDDDMGFSLFD  320



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            + KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEYL+D
Sbjct  215  IGKFAIGVSMVTSLALAISYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEYLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   A  VA  AA  APAAAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAVAVAPVAAAGAPAAAAKEEEKKEEPAEESDDDMGFSLFD  320



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA+GVSMVT+LSLAIS+PTLAAAPHM +N YKN+L++A+ T+YSFP AD+VKEYLKDPS
Sbjct  216  KFAIGVSMVTALSLAISFPTLAAAPHMFVNAYKNILAVALATEYSFPQADEVKEYLKDPS  275

Query  336  KF  331
            KF
Sbjct  276  KF  277



>ref|XP_008779152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Phoenix dactylifera]
Length=221

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +E+FA GVS+VTSLSLA+SYPT+AAAPHM IN YKNVL++A+ T+Y+FP A+KVKE+LKD
Sbjct  116  VERFAAGVSIVTSLSLALSYPTIAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEFLKD  175

Query  342  PSKF  331
            PSKF
Sbjct  176  PSKF  179



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVVTEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVS++T+LSLAISYPTLAAAPHM +N YKNVL+IA+ T+YSFP AD VKE+LKD
Sbjct  215  VEKFAAGVSLITALSLAISYPTLAAAPHMFLNAYKNVLAIALATEYSFPQADNVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSLSLA+SYPTLAAAPHM IN YKNVL++A+ T+Y+FP A+KVKE+L+D
Sbjct  215  IEKFAAGLSMVTSLSLALSYPTLAAAPHMFINAYKNVLAVAIATEYTFPQAEKVKEFLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AAPVAAA A S PAAAA  EEKK EPEEES+D+MGFSLFD
Sbjct  275  PSKF-AVAAPVAAAEAASTPAAAAKEEEKKAEPEEESDDDMGFSLFD  320



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF  GVSMVT+LSLA+SYPTLAAAPHM +N YKNVL++AV T+YS+P A++VKEYLKD
Sbjct  215  MEKFVSGVSMVTALSLAVSYPTLAAAPHMFVNAYKNVLAVAVATEYSYPQAEQVKEYLKD  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA   AAA      AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPLAAAPSGGAPAAAPVEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_006407705.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49158.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=298

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPT+AAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKD
Sbjct  190  VEKFAAGISMVTSLALAVSYPTIAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKD  249

Query  342  PSKF  331
            PSKF
Sbjct  250  PSKF  253



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I V T+Y+FP A+KVKEYLKD
Sbjct  214  VQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAICVATEYTFPQAEKVKEYLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+G+SMVTSL+LAISYPTLA+APHM IN YKN L+I+V T+Y+FP A++VKE+LKD
Sbjct  214  VEKFAVGISMVTSLALAISYPTLASAPHMFINAYKNALAISVATEYTFPQAEQVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA G+SMVTSL+LA+SYPT+AAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKD
Sbjct  214  VEKFAAGISMVTSLALAVSYPTIAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>emb|CDY67524.1| BnaAnng24540D [Brassica napus]
 emb|CDY67517.1| BnaAnng24470D [Brassica napus]
Length=222

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKD
Sbjct  113  VQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKD  172

Query  342  PSKF  331
            PSKF
Sbjct  173  PSKF  176



>emb|CDP06275.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF+LG+SM TSL+L ISYP+L+AAPH+LINGYKN L IAVET+YSF  ADKV EYLKD
Sbjct  160  VEKFSLGLSMATSLALGISYPSLSAAPHILINGYKNALVIAVETEYSFSQADKVNEYLKD  219

Query  342  PSKF  331
            PS+F
Sbjct  220  PSEF  223



>emb|CDX73962.1| BnaA03g30850D [Brassica napus]
Length=323

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I + T+Y+FP A+KVKEYLKD
Sbjct  214  VQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAICIATEYTFPQAEKVKEYLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFALGVSMVTSL+LAI+YPTLAAAPHM +N YKNVL++++ T+Y+FP A+KVKEYLKDPS
Sbjct  217  KFALGVSMVTSLALAIAYPTLAAAPHMFLNAYKNVLAVSLATEYTFPQAEKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVS+VT+LSLAISYPT+AAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LKD
Sbjct  215  VEKFAAGVSLVTALSLAISYPTIAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKD
Sbjct  214  VQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKD
Sbjct  214  VQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA G+SMVTSL+LAIS+PTLAAAPHM IN YKN L+I+V T+Y+FP A+KVKE+LKD
Sbjct  214  VQKFAAGISMVTSLALAISFPTLAAAPHMFINAYKNALAISVATEYTFPQAEKVKEFLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA GVSM+ SLSLA SYPTLAAAPHM IN YKNVL++AV T+YSFP A+KVKE+L+D
Sbjct  215  IDKFAAGVSMIASLSLATSYPTLAAAPHMFINAYKNVLAVAVATEYSFPQAEKVKEFLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA    AAA     AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPVTAAASGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA G+SMVTSL+LAIS+PT+AAAPHM IN YKN L+I + T+Y+FP A+KVKEYLKD
Sbjct  214  VQKFAAGISMVTSLALAISFPTIAAAPHMFINAYKNALAICIATEYTFPQAEKVKEYLKD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA GVSM+ SLSLA SYPTLAAAPHM IN YKNVL++AV T+YSFP A+KVKE+L+D
Sbjct  215  IDKFAAGVSMIASLSLATSYPTLAAAPHMFINAYKNVLAVAVATEYSFPQAEKVKEFLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA    AAA     AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPVTAAASGGAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYL  349
            +EKFA+GVSMV SLSLAI+YPTLAAAPHM IN YKN+LS+AVETDYSFP ADKVKEYL
Sbjct  215  VEKFAMGVSMVASLSLAITYPTLAAAPHMFINAYKNLLSVAVETDYSFPQADKVKEYL  272



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSMVTSLSLA+SYPT+AAAPHM IN YKNVL++A+ T+Y+FP A K+KE+L+D
Sbjct  215  IEKFAAGVSMVTSLSLALSYPTVAAAPHMFINAYKNVLAVAIATEYTFPQAKKLKEFLED  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA  VSMVT+L+LAISYPTLAAAPHM +N YKNV+++A+ T+YSFP ADKVKEYL D
Sbjct  215  VEKFASSVSMVTALALAISYPTLAAAPHMFVNAYKNVVAVALATEYSFPQADKVKEYLAD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA  VSMVT+L+LAISYPTLAAAPHM +N YKNV+++A+ T+YSFP ADKVKEYL D
Sbjct  215  VEKFASSVSMVTALALAISYPTLAAAPHMFVNAYKNVVAVALATEYSFPQADKVKEYLAD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSM+T+LSLAISYPT+AAAPHM +N YKNVL++A+ T+YSFP A+ VKE+LKD
Sbjct  215  VEKFAAGVSMITALSLAISYPTVAAAPHMFLNAYKNVLAVALATEYSFPQAENVKEFLKD  274

Query  342  PSKF  331
            P+KF
Sbjct  275  PTKF  278



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVS VT+L+LAISYPT+AAAPHM +N YKNVL+IAV T+YSFP ADKVKEYL+DPS
Sbjct  216  KFASGVSNVTALALAISYPTIAAAPHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPS  275

Query  336  KFavaaapvaaaaagsapaaaaaaeekkeepeeesE-DEMGFSLFD  202
            KFAV+ A  AAAA G+A  AAAA EE K+E   E   D+MGFSLFD
Sbjct  276  KFAVSVAAPAAAAGGAAAPAAAAKEEAKKEEPAEESDDDMGFSLFD  321



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSM+ SLSLA SYPTLAAAPHM IN YKN+L++AV T+YS+P A+KVKE+L+D
Sbjct  215  VEKFAAGVSMIASLSLATSYPTLAAAPHMFINAYKNILAVAVATEYSYPQAEKVKEFLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   AA    AAA  +  AAA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVAAAPVTAAASGSAPAAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVSMVTSL+LA+SYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LKDPS
Sbjct  217  KFASGVSMVTSLALAVSYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVS+VT+ SLAISYPT+AAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LKD
Sbjct  215  VEKFAAGVSLVTAFSLAISYPTIAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVS VT+L+LAISYPT+AAAPHM +N YKNVL+IAV T+YSFP ADKVKEYL+DPS
Sbjct  216  KFASGVSNVTALALAISYPTIAAAPHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPS  275

Query  336  KF  331
            KF
Sbjct  276  KF  277



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVSMV SLSL++S+PT+AAAPHM +NGYKNVLS+A+ ++YSFP A+KVKEYLKDPS
Sbjct  217  KFASGVSMVASLSLSLSFPTIAAAPHMFVNGYKNVLSVAMVSEYSFPQAEKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVS+VT+ SLAISYPT+AAAPHM IN YKNVL++A+ T+YSFP A+ VKE+LKD
Sbjct  215  VEKFAAGVSLVTAFSLAISYPTIAAAPHMFINAYKNVLAVALATEYSFPQAENVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>dbj|BAD09642.1| 60S acidic ribosomal protein P0-like [Oryza sativa Japonica Group]
Length=96

 Score = 97.8 bits (242),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -3

Query  495  MVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  331
            MV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  1    MVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  55



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004152959.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004168551.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKF  GVSMV SLSLA+S+PTLAAAPHMLIN YKN L+IAV T+YSF  AD++KE+LKD
Sbjct  215  LEKFLAGVSMVASLSLAVSFPTLAAAPHMLINAYKNALAIAVATEYSFSEADEIKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSM+T++SLAISYPT+AAAPHM +N YKNVL++A+ T+YSFP A+ VKE+LKD
Sbjct  215  VEKFAAGVSMITAISLAISYPTVAAAPHMFLNAYKNVLAVALATEYSFPQAENVKEFLKD  274

Query  342  PSKF  331
            P+KF
Sbjct  275  PTKF  278



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVS+VTSL+LAISYPTLAAAPH   N YKNVL++AV T+Y+FP A+KVKE+L+D
Sbjct  215  VEKFAAGVSLVTSLALAISYPTLAAAPHFFTNAYKNVLAVAVATEYTFPQAEKVKEFLED  274

Query  342  PSKFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            PSKF   +A   A A  +A   AA  EEKKEEP EES+D+MGFSLFD
Sbjct  275  PSKF-AVSAAPVADAGAAAAPVAAKEEEKKEEPAEESDDDMGFSLFD  320



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVS VT+L++A+SYPT+AAAPHM +N YKNVL+IAV T+YSFP ADKVKEYL+DPS
Sbjct  216  KFASGVSNVTALAMAVSYPTIAAAPHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPS  275

Query  336  KF  331
            KF
Sbjct  276  KF  277



>gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +E+F  GVSMVTSLSL+IS+PTLAAAPHM +N YKNVLS++V T+Y+FP A++VKE+L+D
Sbjct  215  VERFVNGVSMVTSLSLSISFPTLAAAPHMFLNAYKNVLSVSVATEYTFPQAEQVKEFLED  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_008351783.1| PREDICTED: uncharacterized protein LOC103415220 [Malus domestica]
Length=762

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVSMVTSL+LA+SYPTLAAAPHM +N YKNVL++++ T+YSFP A+KVKE+LKDPS
Sbjct  658  KFASGVSMVTSLALAVSYPTLAAAPHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPS  717

Query  336  KF  331
            KF
Sbjct  718  KF  719



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GV+ VT+L+LAISYPT+AAAPHM IN YKNVL+++V TDY+FP A+++KEYLKDPS
Sbjct  221  KFAAGVANVTALALAISYPTIAAAPHMFINAYKNVLAVSVATDYTFPEAEEIKEYLKDPS  280

Query  336  KF  331
            KF
Sbjct  281  KF  282



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSM T+LSLAISYPTLAAA HM +N YKN L++A+ T+YSFP A+ VKE+LKD
Sbjct  215  VEKFAAGVSMTTALSLAISYPTLAAATHMFLNAYKNALAVALATEYSFPQAENVKEFLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|EYU22330.1| hypothetical protein MIMGU_mgv1a019166mg, partial [Erythranthe 
guttata]
Length=230

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYL  349
            KFA+GVSMV SLSLAISYPTLAAA HM INGYKNVL+ AVET YSFPLADKVKEYL
Sbjct  111  KFAMGVSMVNSLSLAISYPTLAAALHMFINGYKNVLAAAVETGYSFPLADKVKEYL  166



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA GVSM+T+LSLA SYPTLAAAPHM +N YKN L +A+ T+YSFP A+ VKE++KD
Sbjct  215  VEKFAAGVSMITALSLAASYPTLAAAPHMFLNAYKNALVVALATEYSFPQAENVKEFVKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            + KFA G+S V  LS+ +SYPTLAA PHM INGYKNVLS A+ T+YSFP A+KVKEYLKD
Sbjct  215  IAKFAAGLSNVVGLSMLLSYPTLAAIPHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|AGL34820.1| ribosomal protein 10, partial [Cyrtandra schizocalyx]
Length=100

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLAD  367
            +EKFA+GVSMVTSLSL+ISYPTLAAAPHM +N YKNVL+IAVETDYSFP AD
Sbjct  49   IEKFAIGVSMVTSLSLSISYPTLAAAPHMFVNAYKNVLAIAVETDYSFPQAD  100



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            + KFA G+S V  LS+ +SYPTLAA PHM INGYKNVLS A+ T+YSFP A+KVKEYLKD
Sbjct  215  IAKFAAGLSNVVGLSMLLSYPTLAAIPHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKD  274

Query  342  PSKF  331
            PSKF
Sbjct  275  PSKF  278



>gb|AGL34823.1| ribosomal protein 10, partial [Cyrtandra paludosa var. paludosa]
 gb|AGL34824.1| ribosomal protein 10, partial [Cyrtandra cordifolia]
 gb|AGL34825.1| ribosomal protein 10, partial [Cyrtandra platyphylla var. parviflora]
Length=100

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLAD  367
            +EKFA+GVSMVTSLSL+ISYPTLAAAPHM +N YKNVL+IAVETDYSFP AD
Sbjct  49   IEKFAIGVSMVTSLSLSISYPTLAAAPHMFVNAYKNVLAIAVETDYSFPQAD  100



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVS V ++SLA++YPTLAA PH  +N YKN+L+IAVET+YSFPLA+K KEYLKDPS
Sbjct  217  KFAAGVSTVAAVSLALNYPTLAAVPHSFVNAYKNLLAIAVETEYSFPLAEKTKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVS V ++SLA++YPTLAA PH  +N YKN+L+IAVET+YSFPLA+K KEYLKDPS
Sbjct  217  KFAAGVSTVAAVSLALNYPTLAAVPHSFVNSYKNLLAIAVETEYSFPLAEKTKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = -3

Query  513  FALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSK  334
            FA GVSMV+SLSLAISYPT+AAA HM  N YKNVL++AV T+YSFP AD+VKE+LKDPSK
Sbjct  218  FANGVSMVSSLSLAISYPTIAAALHMFANSYKNVLAVAVVTEYSFPEADEVKEFLKDPSK  277

Query  333  FavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            F    A    AA  +  A AAA EE+K+E  EES+D+MGFSLFD
Sbjct  278  F----AVAVVAATATDSAPAAAKEEEKKEEPEESDDDMGFSLFD  317



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LEKF  GVSMV SLSLA+S+PTLAAAPHMLIN YKN L+IAV T+YSF  AD++KE+LKD
Sbjct  215  LEKFLAGVSMVASLSLAVSFPTLAAAPHMLINAYKNALAIAVATEYSFSEADEIKEFLKD  274

Query  342  P  340
            P
Sbjct  275  P  275



>ref|XP_010104660.1| 60S acidic ribosomal protein P0-1 [Morus notabilis]
 gb|EXC01466.1| 60S acidic ribosomal protein P0-1 [Morus notabilis]
Length=224

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKFA+GV+ +TS SL +SYPT+AAAPHMLIN YKN+  + V T+YSFP  + VKEYLKD
Sbjct  116  VEKFAVGVATLTSASLDLSYPTIAAAPHMLINAYKNIQDVGVATEYSFPQVESVKEYLKD  175

Query  342  PSKF  331
            PSKF
Sbjct  176  PSKF  179



>gb|KHG21849.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=237

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP A+K+KEYLKD
Sbjct  131  MEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQAEKIKEYLKD  190

Query  342  PSKF  331
            P+KF
Sbjct  191  PTKF  194



>gb|KHG01938.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=253

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP A+K+KEYLKD
Sbjct  147  MEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQAEKIKEYLKD  206

Query  342  PSKF  331
            P+KF
Sbjct  207  PTKF  210



>gb|KJB19895.1| hypothetical protein B456_003G123400 [Gossypium raimondii]
Length=321

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            +EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP A+K+KEYLKD
Sbjct  215  MEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQAEKIKEYLKD  274

Query  342  PSKF  331
            P+KF
Sbjct  275  PTKF  278



>gb|AGL34821.1| ribosomal protein 10, partial [Cyrtandra longifolia]
Length=100

 Score = 90.1 bits (222),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLAD  367
            +EKFA+GVSMVTSLSL+ISYPTLAAAPHM +N YKNVL+IAV TDYSFP AD
Sbjct  49   IEKFAIGVSMVTSLSLSISYPTLAAAPHMFVNAYKNVLAIAVLTDYSFPQAD  100



>ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA   S V +L+LAISYPT+ AAPHM +N YKNVL++AV T++SFP ADKVKEYLKDPS
Sbjct  216  KFASSASNVAALALAISYPTVVAAPHMFLNAYKNVLAVAVATEFSFPQADKVKEYLKDPS  275

Query  336  KF  331
            KF
Sbjct  276  KF  277



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KF   VS V SL+L+I YPT+AAAPH  INGYKNVLS AV T+YSF  ADKVKEYLKDPS
Sbjct  217  KFLEAVSRVASLALSIRYPTIAAAPHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KF   VS V SL+L+I YPT+AAAPH  INGYKNVLS AV T+YSF  ADKVKEYLKDPS
Sbjct  217  KFLEAVSRVASLALSIRYPTIAAAPHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_001697060.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
 gb|EDP00752.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
Length=320

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  504  GVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  331
            G+  V +LSL   YPTLAAAPH++I+GYKNVL+IAVETDY+FPLA KVK+YL DPSKF
Sbjct  226  GIREVAALSLGAQYPTLAAAPHVIIDGYKNVLAIAVETDYTFPLAQKVKDYLADPSKF  283



>ref|XP_002279500.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Vitis vinifera]
Length=286

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            EKF+ GVSM  SLSLAISYPTLAAA HM IN   NVL++AV  +YSFP A +VKEYLKDP
Sbjct  181  EKFSAGVSMKASLSLAISYPTLAAALHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDP  240

Query  339  SKF  331
            SKF
Sbjct  241  SKF  243



>emb|CBI15980.3| unnamed protein product [Vitis vinifera]
Length=245

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            EKF+ GVSM  SLSLAISYPTLAAA HM IN   NVL++AV  +YSFP A +VKEYLKDP
Sbjct  140  EKFSAGVSMKASLSLAISYPTLAAALHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDP  199

Query  339  SKF  331
            SKF
Sbjct  200  SKF  202



>gb|AGL34822.1| ribosomal protein 10, partial [Cyrtandra kauaiensis]
Length=100

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLAD  367
            +EKFA+GVSMVTSLSL+ISYPTL AAPHM +N YKNVL+IAVET YSFP AD
Sbjct  49   IEKFAIGVSMVTSLSLSISYPTLXAAPHMFVNAYKNVLAIAVETGYSFPQAD  100



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYL  349
            +EKFA  VSMVT+L+LAISYPTLAAAPHM +N YKNV+++A+ T+YSFP ADKVKEYL
Sbjct  215  VEKFASSVSMVTALALAISYPTLAAAPHMFVNAYKNVVAVALATEYSFPQADKVKEYL  272



>emb|CAN65663.1| hypothetical protein VITISV_014917 [Vitis vinifera]
Length=379

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            EKF+ GVSM  SLSLAISYPTLAAA HM IN   NVL++AV  +YSFP A +VKEYLKDP
Sbjct  216  EKFSAGVSMKASLSLAISYPTLAAALHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDP  275

Query  339  SKF  331
            SKF
Sbjct  276  SKF  278



>ref|XP_006296009.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
 gb|EOA28907.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
Length=319

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            ++KFA GVSM+T+LSLA SYPTLAAAPHM +N YKNV+++A  T+YSFP ++ VKE LKD
Sbjct  215  VDKFAAGVSMITALSLAASYPTLAAAPHMFLNAYKNVVAVAFATEYSFPRSENVKECLKD  274

Query  342  PSKF  331
            P+ +
Sbjct  275  PTSW  278



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +FA GVS V +LSLAI YPTLAAA H  +N YKNVL++A+ TDYS+P A+ VKEYLKDPS
Sbjct  217  RFAAGVSAVAALSLAIGYPTLAAATHCFLNSYKNVLAVALATDYSYPHAETVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +FA GVS V +LSLAI YPTLAAA H  +N YKNVL++A+ TDYS+P A+ VKEYLKDPS
Sbjct  217  RFAAGVSAVAALSLAIGYPTLAAASHYFLNSYKNVLAVALATDYSYPQAETVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +FA GVS V +LSLAI YPTLAAA H  +N YKNVL++A+ TDYS+P A+  KEYLKDPS
Sbjct  217  RFATGVSAVAALSLAIGYPTLAAATHYFLNSYKNVLAVALATDYSYPHAETAKEYLKDPS  276

Query  336  KFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  202
            KFAVAAAP A+     A       EEKK EPEEES+D+MG SLFD
Sbjct  277  KFAVAAAPAASETPADAAGGGKVEEEKKVEPEEESDDDMGLSLFD  321



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +FA G++ V  LS+ ++YPTLAA PH+ IN YKNVLS A+ T+YSFP A+KVKEYLKDPS
Sbjct  217  RFAAGLTNVVGLSMTLNYPTLAAIPHIFINSYKNVLSFAIATEYSFPQAEKVKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVS V ++SLA+ YPTLAAA H  +N YKNVL+IA+ TDYS+P A+  KEYLKDPS
Sbjct  217  KFAEGVSAVAAISLALGYPTLAAAAHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KFA GVS V ++SLA+ YPTLAAA H  +N YKNVL+IA+ TDYS+P A+  KEYLKDPS
Sbjct  217  KFAEGVSAVAAISLALGYPTLAAAAHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPS  276

Query  336  KF  331
            KF
Sbjct  277  KF  278



>emb|CBV76074.1| 60S acidic ribosomal protein P0 [Polytomella sp. Pringsheim 198.80]
Length=314

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  522  LEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  343
            LE     +  V + SL   Y TLAA PH++INGYKNVL++A+ETDYSFPLA+KVKEYL D
Sbjct  214  LESVVAAIRNVAAFSLGAHYATLAAVPHVVINGYKNVLAVAIETDYSFPLAEKVKEYLAD  273

Query  342  PSKF  331
            PSKF
Sbjct  274  PSKF  277



>ref|NP_001187030.1| 60S acidic ribosomal protein P0 [Ictalurus punctatus]
 sp|Q90YX1.1|RLA0_ICTPU RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Ictalurus punctatus]
 gb|AAK95123.1|AF401551_1 ribosomal protein P0 [Ictalurus punctatus]
Length=317

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  + S+ L I YPTLA+ PH +INGYK VL +AVETDYSFP+ADKVK +L DP
Sbjct  213  KRFLEGVRNIASVCLQIGYPTLASIPHSIINGYKRVLRVAVETDYSFPMADKVKAFLADP  272

Query  339  SKF  331
            S+F
Sbjct  273  SRF  275



>ref|XP_006640161.1| PREDICTED: 60S acidic ribosomal protein P0-like [Lepisosteus 
oculatus]
Length=316

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDYSFPLADKVKE+L DP
Sbjct  213  QRFLEGVRNVASVCLQIGYPTVASIPHSIINGYKRVLAVAVETDYSFPLADKVKEFLADP  272

Query  339  S  337
            S
Sbjct  273  S  273



>ref|XP_011415179.1| PREDICTED: 60S acidic ribosomal protein P0-like [Crassostrea 
gigas]
 gb|EKC26031.1| 60S acidic ribosomal protein P0 [Crassostrea gigas]
Length=314

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            KF +GV  + ++SL I YPT A+APH + NG+K +L+IAVETDY+FP A+K KEYLKDPS
Sbjct  214  KFLMGVRNIAAISLTIGYPTAASAPHSIANGFKRLLAIAVETDYTFPAAEKTKEYLKDPS  273

Query  336  KF  331
            KF
Sbjct  274  KF  275



>gb|EOA96285.1| 60S acidic ribosomal protein P0, partial [Anas platyrhynchos]
Length=124

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  58   KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  117

Query  339  SKF  331
            S F
Sbjct  118  SAF  120



>ref|XP_002958097.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
 gb|EFJ40828.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
Length=321

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  501  VSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  331
            +  V++LSL   YPTL AAPH++I+GYKNVL+IA+ETDY+FPLA KVK+YL DPSKF
Sbjct  227  IREVSALSLGARYPTLVAAPHVIIDGYKNVLAIALETDYTFPLAQKVKDYLADPSKF  283



>gb|AAT44430.1| ribosomal protein large P0-like protein, partial [Sparus aurata]
Length=314

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASVPHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273

Query  336  KF  331
             F
Sbjct  274  AF  275



>gb|ADD21620.1| ribosomal protein P0, partial [Hanleya nagelfar]
Length=274

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            E+F LGV  + S+SLAI YPT+A+APH +ING+K +L+IAVETD  F  A+  KEYLKDP
Sbjct  196  ERFMLGVRNIASISLAIGYPTVASAPHSIINGFKRLLAIAVETDIDFEEANMAKEYLKDP  255

Query  339  SKF  331
            SKF
Sbjct  256  SKF  258



>gb|ACH70801.1| acidic ribosomal protein P0 [Salmo salar]
 gb|ACI69835.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN10322.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN12682.1| 60S acidic ribosomal protein P0 [Salmo salar]
Length=315

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK+YL DP
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASIPHTIINGYKRVLAVAVETDYSFPLADKVKDYLADP  272



>gb|KFQ02732.1| 60S acidic ribosomal protein P0, partial [Haliaeetus albicilla]
Length=262

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  191  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  250

Query  339  SKF  331
            S F
Sbjct  251  SAF  253



>gb|ABU63975.1| ribosomal protein large P0-like protein [Perca flavescens]
Length=314

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASVPHTIINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|NP_001080134.1| ribosomal protein, large, P0 [Xenopus laevis]
 gb|AAH42268.1| Arbp-prov protein [Xenopus laevis]
Length=315

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  V S+ L I YPT+A+ PH +INGYK VL+IAVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>gb|KFO65132.1| 60S acidic ribosomal protein P0, partial [Corvus brachyrhynchos]
Length=279

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_008639852.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Corvus brachyrhynchos]
Length=280

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_005421617.1| PREDICTED: 60S acidic ribosomal protein P0 [Geospiza fortis]
Length=312

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  208  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  267

Query  339  SKF  331
            S F
Sbjct  268  SAF  270



>ref|XP_007434308.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X1 [Python 
bivittatus]
 ref|XP_007434309.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X2 [Python 
bivittatus]
 ref|XP_007434310.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X3 [Python 
bivittatus]
Length=315

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDYSFPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLAVAVETDYSFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_008924020.1| PREDICTED: 60S acidic ribosomal protein P0 [Manacus vitellinus]
 gb|KFW82516.1| 60S acidic ribosomal protein P0 [Manacus vitellinus]
Length=318

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_010396743.1| PREDICTED: 60S acidic ribosomal protein P0 [Corvus cornix cornix]
Length=290

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_002199561.1| PREDICTED: 60S acidic ribosomal protein P0 [Taeniopygia guttata]
Length=318

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_005524479.1| PREDICTED: 60S acidic ribosomal protein P0 [Pseudopodoces humilis]
Length=318

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_005493516.1| PREDICTED: 60S acidic ribosomal protein P0 [Zonotrichia albicollis]
 ref|XP_009090551.1| PREDICTED: 60S acidic ribosomal protein P0 [Serinus canaria]
Length=318

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_010133581.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Buceros 
rhinoceros silvestris]
Length=300

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  195  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  254

Query  339  SKF  331
            S F
Sbjct  255  SAF  257



>ref|XP_005987234.1| PREDICTED: 60S acidic ribosomal protein P0 [Latimeria chalumnae]
Length=314

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  + S+ L I YPT+A+ PH +INGYK VL++ VETDYSFPLADKVK +L DP
Sbjct  213  KRFLEGVRNIASVCLQIGYPTVASVPHSVINGYKRVLAVCVETDYSFPLADKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SSF  275



>ref|NP_989067.1| ribosomal protein, large, P0 [Xenopus (Silurana) tropicalis]
 gb|AAH61299.1| acidic ribosomal phosphoprotein P0 [Xenopus (Silurana) tropicalis]
Length=314

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  V S+ L I YPT+A+ PH +INGYK VL+IAVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>ref|XP_006784596.1| PREDICTED: 60S acidic ribosomal protein P0-like [Neolamprologus 
brichardi]
Length=315

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASVPHTVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>emb|CDQ67134.1| unnamed protein product [Oncorhynchus mykiss]
Length=315

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASVPHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>gb|ACI68961.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACI70184.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN09916.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN12263.1| 60S acidic ribosomal protein P0 [Salmo salar]
Length=315

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASVPHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>ref|XP_009915794.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0, partial [Haliaeetus albicilla]
Length=272

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  203  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  262

Query  339  SKF  331
            S F
Sbjct  263  SAF  265



>gb|KFQ10333.1| 60S acidic ribosomal protein P0, partial [Leptosomus discolor]
Length=279

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_005503982.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0 [Columba livia]
Length=316

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  211  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  270

Query  339  SKF  331
            S F
Sbjct  271  SAF  273



>ref|XP_005054917.1| PREDICTED: 60S acidic ribosomal protein P0 [Ficedula albicollis]
Length=324

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>sp|Q9DG68.1|RLA0_RANSY RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Rana sylvatica]
 gb|AAG09233.1| brain acidic ribosomal phosphoprotein P0 [Rana sylvatica]
Length=315

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPT+A+ PH ++NGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNIASVCLQIGYPTVASVPHSVVNGYKRVLALAVETDYSFPLADKVKAFLADPS  273

Query  336  KF  331
             F
Sbjct  274  AF  275



>ref|XP_010572856.1| PREDICTED: 60S acidic ribosomal protein P0 [Haliaeetus leucocephalus]
Length=318

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_010740439.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X2 [Larimichthys 
crocea]
Length=275

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  175  RFLEGVRNIASVCLEIGYPTLASVPHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  234



>gb|KFV51543.1| 60S acidic ribosomal protein P0, partial [Gavia stellata]
Length=258

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  183  KRFLEGVRNVASVCLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  242

Query  339  SKF  331
            S F
Sbjct  243  SAF  245



>ref|XP_009487343.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Pelecanus 
crispus]
 gb|KFQ54485.1| 60S acidic ribosomal protein P0, partial [Pelecanus crispus]
Length=291

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  189  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  248

Query  339  SKF  331
            S F
Sbjct  249  SAF  251



>ref|XP_010879645.1| PREDICTED: 60S acidic ribosomal protein P0 [Esox lucius]
Length=315

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASIPHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>gb|KFP45896.1| 60S acidic ribosomal protein P0, partial [Chlamydotis macqueenii]
Length=268

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  202  KRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  261

Query  339  SKF  331
            S F
Sbjct  262  SAF  264



>ref|XP_009948467.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0 [Leptosomus discolor]
Length=318

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>gb|KFP74395.1| 60S acidic ribosomal protein P0, partial [Acanthisitta chloris]
Length=301

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  189  KRFLEGVRNVASICLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  248

Query  339  SKF  331
            S F
Sbjct  249  SAF  251



>gb|ACO09070.1| 60S acidic ribosomal protein P0 [Osmerus mordax]
Length=314

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASIPHSIINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|XP_009807426.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Gavia stellata]
Length=257

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  184  KRFLEGVRNVASVCLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  243

Query  339  SKF  331
            S F
Sbjct  244  SAF  246



>ref|XP_010226991.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0 [Tinamus guttatus]
Length=314

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  210  KRFLEGVRNVASVCLQIGYPTIASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  269

Query  339  SKF  331
            S F
Sbjct  270  SAF  272



>ref|XP_009083235.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Acanthisitta 
chloris]
Length=305

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  201  KRFLEGVRNVASICLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  260

Query  339  SKF  331
            S F
Sbjct  261  SAF  263



>emb|CDQ63253.1| unnamed protein product [Oncorhynchus mykiss]
Length=315

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASIPHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>ref|XP_010127000.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Chlamydotis 
macqueenii]
Length=266

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  202  KRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  261

Query  339  SKF  331
            S F
Sbjct  262  SAF  264



>ref|XP_008292997.1| PREDICTED: 60S acidic ribosomal protein P0 [Stegastes partitus]
Length=315

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASVPHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>gb|KFZ54738.1| 60S acidic ribosomal protein P0, partial [Podiceps cristatus]
Length=261

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  195  KRFLEGVRNVASVCLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  254

Query  339  SKF  331
            S F
Sbjct  255  SAF  257



>ref|XP_008501040.1| PREDICTED: 60S acidic ribosomal protein P0 [Calypte anna]
Length=318

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_009869989.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0, partial [Apaloderma vittatum]
Length=259

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  197  KRFLEGVRNVASVCLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  256

Query  339  SKF  331
            S F
Sbjct  257  SAF  259



>ref|XP_010740438.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X1 [Larimichthys 
crocea]
Length=314

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +F  GV  + S+ L I YPTLA+ PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  214  RFLEGVRNIASVCLEIGYPTLASVPHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>gb|KFP07838.1| 60S acidic ribosomal protein P0 [Calypte anna]
Length=320

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH +INGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  215  KRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADP  274

Query  339  SKF  331
            S F
Sbjct  275  SAF  277



>gb|KFV06138.1| 60S acidic ribosomal protein P0, partial [Tauraco erythrolophus]
Length=294

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  189  KRFLEGVRNVASVCLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  248

Query  339  SKF  331
            S F
Sbjct  249  SAF  251



>ref|XP_009907942.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0 [Picoides pubescens]
Length=317

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  213  KRFLEGVRNVASICLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  272

Query  339  SKF  331
            S F
Sbjct  273  SAF  275



>ref|XP_009582133.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0, partial [Fulmarus glacialis]
Length=257

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  519  EKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  340
            ++F  GV  V S+ L I YPT+A+ PH ++NGYK VL++AVETDY+FPLA+KVK +L DP
Sbjct  193  KRFLEGVRNVASVCLQIGYPTIASVPHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADP  252

Query  339  SKF  331
            S F
Sbjct  253  SAF  255



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  516  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  337
            +FA G++ V  LS+ + YPTLAA PHM IN YKNVLS A+ T+YSFP A+KVKEYLK+PS
Sbjct  217  RFAAGLTNVVGLSMILDYPTLAAIPHMFINSYKNVLSFAIATEYSFPQAEKVKEYLKNPS  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800