BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050F15

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDY70033.1|  BnaCnng66420D                                          139   3e-37   Brassica napus [oilseed rape]
emb|CDX95399.1|  BnaC04g27590D                                          142   6e-37   
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             142   7e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    141   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             141   1e-36   Capsella rubella
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    140   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    141   2e-36   Camelina sativa [gold-of-pleasure]
gb|KDP29212.1|  hypothetical protein JCGZ_16601                         140   2e-36   Jatropha curcas
gb|KJB62323.1|  hypothetical protein B456_009G411600                    140   2e-36   Gossypium raimondii
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      140   2e-36   Brassica rapa
gb|KJB62320.1|  hypothetical protein B456_009G411600                    140   2e-36   Gossypium raimondii
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      140   3e-36   Gossypium arboreum [tree cotton]
emb|CBI30187.3|  unnamed protein product                                134   3e-36   Vitis vinifera
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        139   6e-36   Tarenaya hassleriana [spider flower]
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    139   7e-36   Arabis alpina [alpine rockcress]
ref|XP_009787879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    132   1e-35   Nicotiana sylvestris
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             138   1e-35   
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             137   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_006428523.1|  hypothetical protein CICLE_v10013676mg             130   2e-35   
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              137   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     135   4e-35   Eucalyptus grandis [rose gum]
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    137   4e-35   Cicer arietinum [garbanzo]
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      137   4e-35   Populus euphratica
ref|XP_002519426.1|  o-methyltransferase, putative                      136   7e-35   Ricinus communis
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     136   7e-35   Eucalyptus grandis [rose gum]
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    136   8e-35   Eucalyptus grandis [rose gum]
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      135   1e-34   Vitis vinifera
emb|CAN65776.1|  hypothetical protein VITISV_030414                     134   3e-34   Vitis vinifera
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    134   5e-34   Solanum lycopersicum
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 134   5e-34   Morus notabilis
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    134   6e-34   Solanum tuberosum [potatoes]
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    133   7e-34   Cicer arietinum [garbanzo]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             134   7e-34   Prunus persica
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      132   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    132   2e-33   
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      130   3e-33   
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      132   3e-33   Prunus mume [ume]
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    131   6e-33   Pyrus x bretschneideri [bai li]
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      130   6e-33   Glycine soja [wild soybean]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    131   7e-33   Pyrus x bretschneideri [bai li]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    130   8e-33   Glycine max [soybeans]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        130   9e-33   Nicotiana tomentosiformis
gb|KEH38506.1|  caffeic acid O-methyltransferase                        130   1e-32   Medicago truncatula
ref|XP_007027514.1|  O-methyltransferase family protein                 130   2e-32   
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 129   3e-32   Medicago truncatula
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        129   3e-32   Medicago sativa subsp. x varia
gb|AES72848.2|  caffeic acid O-methyltransferase                        128   5e-32   Medicago truncatula
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      128   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg             124   8e-32   
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 128   9e-32   
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    127   2e-31   Elaeis guineensis
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      127   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             125   5e-31   Phaseolus vulgaris [French bean]
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      124   1e-30   Fragaria vesca subsp. vesca
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       125   1e-30   Cucumis sativus [cucumbers]
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    124   2e-30   
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    123   3e-30   
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      124   3e-30   Brachypodium distachyon [annual false brome]
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      124   3e-30   Cucumis melo [Oriental melon]
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    122   1e-29   Sesamum indicum [beniseed]
gb|EMT14045.1|  Caffeic acid 3-O-methyltransferase                      118   3e-29   
ref|NP_001048569.1|  Os02g0823400                                       119   1e-28   
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    119   2e-28   Setaria italica
gb|ACN25427.1|  unknown                                                 118   3e-28   Zea mays [maize]
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          118   4e-28   Sorghum bicolor [broomcorn]
gb|AAP03057.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    114   6e-28   Limonium latifolium
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             114   1e-27   
gb|AAP03056.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    114   1e-27   Limonium latifolium
ref|NP_001149617.1|  LOC100283243                                       116   1e-27   
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    113   3e-27   Limonium latifolium
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   114   4e-27   Citrus sinensis [apfelsine]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             114   6e-27   
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    114   7e-27   Solanum tuberosum [potatoes]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    114   8e-27   Limonium latifolium
dbj|BAJ96291.1|  predicted protein                                      114   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    113   2e-26   Sesamum indicum [beniseed]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   109   1e-25   Citrus sinensis [apfelsine]
gb|AAP03051.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    107   1e-25   Limonium latifolium
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             110   2e-25   Citrus clementina [clementine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    108   6e-25   Citrus sinensis [apfelsine]
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   106   2e-24   Citrus sinensis [apfelsine]
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    107   3e-24   
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             103   1e-23   Citrus clementina [clementine]
gb|EEC74273.1|  hypothetical protein OsI_09508                        93.2    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg           90.1    2e-18   
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410        89.7    4e-18   Amborella trichopoda
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                 82.8    9e-16   Citrus sinensis [apfelsine]
gb|KDO38720.1|  hypothetical protein CISIN_1g0449412mg                75.1    2e-14   Citrus sinensis [apfelsine]
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg           77.0    8e-14   
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)            71.6    1e-11   Clarkia breweri [fairy fans]
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                    71.6    1e-11   synthetic construct
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...  71.6    1e-11   Clarkia breweri [fairy fans]
gb|AGS49208.1|  O-methyltransferase                                   70.9    3e-11   Zea mays [maize]
ref|XP_009385332.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  70.9    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67212.1|  hypothetical protein M569_07558                       70.1    5e-11   Genlisea aurea
gb|AAO12872.1|  putative O-methyltransferase                          66.6    8e-11   Vitis vinifera
ref|XP_006441264.1|  hypothetical protein CICLE_v100208141mg          65.9    1e-10   
gb|EPS69337.1|  hypothetical protein M569_05429                       65.1    2e-10   Genlisea aurea
emb|CAN64514.1|  hypothetical protein VITISV_023818                   65.1    2e-10   Vitis vinifera
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.2    2e-10   Cicer arietinum [garbanzo]
ref|XP_009384362.1|  PREDICTED: flavone O-methyltransferase 1-like    68.2    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...  68.2    2e-10   Clarkia breweri [fairy fans]
gb|AEW26218.1|  caffeic acid-O-methyltransferase                      65.1    2e-10   Medicago falcata [sickle alfalfa]
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.8    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.8    3e-10   
gb|KDO42391.1|  hypothetical protein CISIN_1g048707mg                 64.7    3e-10   Citrus sinensis [apfelsine]
ref|XP_010478733.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  67.8    3e-10   Camelina sativa [gold-of-pleasure]
gb|KDO43800.1|  hypothetical protein CISIN_1g033647mg                 64.7    3e-10   Citrus sinensis [apfelsine]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  67.8    3e-10   Elaeis guineensis
gb|AGS49204.1|  O-methyltransferase                                   67.4    4e-10   Zea mays [maize]
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.4    4e-10   Elaeis guineensis
ref|XP_002963026.1|  hypothetical protein SELMODRAFT_78541            67.4    5e-10   Selaginella moellendorffii
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg           67.0    5e-10   Eutrema salsugineum [saltwater cress]
ref|XP_002869549.1|  hypothetical protein ARALYDRAFT_354029           67.0    5e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like    67.0    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEW26161.1|  caffeic acid-O-methyltransferase                      65.1    6e-10   Medicago sativa subsp. x varia
gb|AEW26176.1|  caffeic acid-O-methyltransferase                      65.1    6e-10   Medicago sativa subsp. x varia
gb|AEW26209.1|  caffeic acid-O-methyltransferase                      65.1    6e-10   Medicago sativa subsp. caerulea
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                    66.6    6e-10   Mesembryanthemum crystallinum
ref|XP_002980303.1|  hypothetical protein SELMODRAFT_112597           67.0    7e-10   
dbj|BAD14923.1|  caffeic acid o-methyl transferase                    65.5    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002963872.1|  caffeic acid O-methyltransferase                 66.2    8e-10   Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                 66.2    8e-10   Selaginella moellendorffii
gb|AFR39689.1|  caffeate O-methyltransferase                          62.8    9e-10   Populus alba [abele]
ref|XP_010934981.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.7    9e-10   
gb|AFR39675.1|  caffeate O-methyltransferase                          62.8    1e-09   Populus trichocarpa [western balsam poplar]
gb|AEW26163.1|  caffeic acid-O-methyltransferase                      64.7    1e-09   Medicago sativa subsp. x varia
gb|AFR39679.1|  caffeate O-methyltransferase                          62.8    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like    66.2    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  66.2    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGS49196.1|  O-methyltransferase                                   66.2    1e-09   Zea mays [maize]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase             65.9    1e-09   Citrus aurantium [bitter orange]
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.9    1e-09   Citrus sinensis [apfelsine]
gb|AGS49217.1|  O-methyltransferase                                   65.9    1e-09   Zea mays [maize]
gb|AGS49206.1|  O-methyltransferase                                   65.9    1e-09   Zea mays [maize]
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.9    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGS49200.1|  O-methyltransferase                                   65.9    2e-09   Zea mays [maize]
gb|AAQ24348.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AAQ24345.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|EAZ41571.1|  hypothetical protein OsJ_26105                        65.5    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AGS49195.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49216.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|EAZ05653.1|  hypothetical protein OsI_27880                        65.5    2e-09   Oryza sativa Indica Group [Indian rice]
gb|AAQ24351.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49205.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AAQ24342.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AAQ24344.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AAQ24361.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AAQ24343.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
ref|NP_001106047.1|  catechol O-methyltransferase                     65.5    2e-09   Zea mays [maize]
gb|AGS49215.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49209.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49207.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49191.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
ref|NP_001061031.1|  Os08g0157500                                     65.5    2e-09   
gb|AGS49213.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49199.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49190.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AAQ24337.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                    65.5    2e-09   Zea nicaraguensis
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...  65.5    2e-09   Zea mays [maize]
gb|AGS49189.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49187.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AAQ24338.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
gb|AGS49185.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  65.5    2e-09   Phoenix dactylifera
gb|AAA80579.1|  3' flavonoid O-methyltransferase                      65.5    2e-09   Chrysosplenium americanum [water-carpet]
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  65.5    2e-09   Oryza brachyantha
ref|NP_174579.1|  O-methyltransferase-like protein                    65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AGS49197.1|  O-methyltransferase                                   65.5    2e-09   Zea mays [maize]
ref|XP_010461123.1|  PREDICTED: quercetin 3-O-methyltransferase 1     65.1    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010089915.1|  Caffeic acid 3-O-methyltransferase               62.8    2e-09   
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...  65.1    2e-09   Medicago sativa [alfalfa]
ref|XP_009386324.1|  PREDICTED: flavone O-methyltransferase 1-lik...  65.1    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  65.1    2e-09   Medicago sativa [alfalfa]
gb|AFR39674.1|  caffeate O-methyltransferase                          61.6    2e-09   Populus trichocarpa [western balsam poplar]
gb|KDP32880.1|  hypothetical protein JCGZ_12172                       62.0    2e-09   Jatropha curcas
gb|AIY22648.1|  caffeic acid 3-O-methyl transferase                   63.5    2e-09   Saccharum arundinaceum
ref|XP_002893750.1|  O-methyltransferase family 2 protein             65.1    2e-09   Arabidopsis lyrata subsp. lyrata
gb|KHN19569.1|  Caffeic acid 3-O-methyltransferase                    63.5    2e-09   Glycine soja [wild soybean]
ref|XP_009386325.1|  PREDICTED: flavone O-methyltransferase 1-lik...  65.1    3e-09   
ref|XP_010696333.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    3e-09   
gb|ADR31599.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  61.6    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010660322.1|  PREDICTED: caffeic acid 3-O-methyltransferase    65.1    3e-09   Vitis vinifera
gb|AGS49211.1|  O-methyltransferase                                   64.7    3e-09   Zea mays [maize]
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.7    3e-09   Tarenaya hassleriana [spider flower]
gb|AAY86361.1|  caffeic acid O-methyltransferase                      64.7    3e-09   Acacia auriculiformis x Acacia mangium
ref|XP_006305218.1|  hypothetical protein CARUB_v10009584mg           64.7    3e-09   Capsella rubella
gb|AGS49194.1|  O-methyltransferase                                   64.7    3e-09   Zea mays [maize]
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...  64.7    3e-09   Prunus dulcis [sweet almond]
gb|ABI54120.1|  caffeic acid O-methyltransferase                      64.7    3e-09   Malus domestica [apple tree]
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3  64.7    3e-09   Populus euphratica
gb|AAQ24355.1|  O-methyltransferase                                   64.7    3e-09   Zea mays [maize]
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase    64.7    3e-09   Prunus mume [ume]
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg           64.7    3e-09   Prunus persica
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg           64.7    3e-09   
gb|AGS49181.1|  O-methyltransferase                                   64.7    4e-09   Zea mays [maize]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase    64.7    4e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.7    4e-09   Malus domestica [apple tree]
gb|AAQ24339.1|  O-methyltransferase                                   64.7    4e-09   Zea mays [maize]
gb|ABS57468.1|  caffeic acid O-methyl transferase                     64.3    4e-09   Leucaena leucocephala [cassie]
ref|XP_009398124.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008343815.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    4e-09   
gb|EMT30204.1|  Caffeic acid 3-O-methyltransferase                    64.3    4e-09   
gb|AGS49202.1|  O-methyltransferase                                   64.3    4e-09   Zea mays [maize]
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006420931.1|  hypothetical protein CICLE_v10005230mg           64.3    4e-09   Citrus clementina [clementine]
emb|CDY19037.1|  BnaC01g20310D                                        64.3    4e-09   Brassica napus [oilseed rape]
ref|XP_006386661.1|  hypothetical protein POPTR_0002s18140g           61.2    4e-09   
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  64.3    4e-09   Cucumis melo [Oriental melon]
gb|AAZ32409.1|  S-methyltransferase                                   64.3    4e-09   Catharanthus roseus [chatas]
gb|AGS49219.1|  O-methyltransferase                                   64.3    4e-09   Zea mays [maize]
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    5e-09   
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    5e-09   Citrus sinensis [apfelsine]
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    5e-09   Cucumis sativus [cucumbers]
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  64.3    5e-09   Populus tremuloides
gb|ADR31597.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  62.0    5e-09   Populus trichocarpa [western balsam poplar]
gb|AGS49198.1|  O-methyltransferase                                   64.3    5e-09   Zea mays [maize]
gb|ADX98508.1|  caffeic acid 3-O-methyltransferase                    63.9    5e-09   Panicum virgatum
gb|EPS64988.1|  hypothetical protein M569_09791                       63.9    5e-09   Genlisea aurea
gb|ABK26959.1|  unknown                                               61.2    5e-09   Picea sitchensis
ref|XP_011070409.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.9    6e-09   Sesamum indicum [beniseed]
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                    63.9    6e-09   Glycine soja [wild soybean]
gb|AGS49210.1|  O-methyltransferase                                   63.9    6e-09   Zea mays [maize]
ref|XP_009387952.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.4    6e-09   
prf||2119166A  caffeic acid O-methyltransferase                       63.9    6e-09
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.9    6e-09   Glycine max [soybeans]
gb|AGS49183.1|  O-methyltransferase                                   63.9    6e-09   Zea mays [maize]
gb|AFK40372.1|  unknown                                               63.9    6e-09   Lotus japonicus
gb|AFK39235.1|  unknown                                               63.9    6e-09   Medicago truncatula
gb|AHM25237.1|  noraucuparin O-methyltransferase                      63.9    7e-09   Sorbus aucuparia [European mountain ash]
gb|AGS49184.1|  O-methyltransferase                                   63.9    7e-09   Zea mays [maize]
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  63.9    7e-09   Glycine max [soybeans]
gb|AFO69477.1|  caffeic acid O-methyltransferase                      63.5    7e-09   Sorghum bicolor [broomcorn]
ref|XP_004972800.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    7e-09   Setaria italica
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                    63.5    8e-09   Miscanthus sinensis
ref|NP_001240003.1|  uncharacterized protein LOC100780100             63.5    8e-09   Glycine max [soybeans]
gb|KFK45045.1|  hypothetical protein AALP_AA1G337000                  63.5    8e-09   Arabis alpina [alpine rockcress]
gb|AFR39697.1|  caffeate O-methyltransferase                          60.1    8e-09   Populus fremontii
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    8e-09   Glycine max [soybeans]
gb|ADR31603.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  61.6    8e-09   Populus trichocarpa [western balsam poplar]
gb|AID68566.1|  caffeic O-methyltransferase                           63.5    8e-09   Punica granatum [granado]
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    8e-09   Malus domestica [apple tree]
gb|ABI54118.1|  caffeic acid O-methyltransferase                      63.5    8e-09   Malus domestica [apple tree]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g           63.5    9e-09   Phaseolus vulgaris [French bean]
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                 63.5    9e-09   Medicago truncatula
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                    63.5    9e-09   Betula platyphylla [Asian white birch]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase             63.5    9e-09   Betula pendula [white birch]
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    9e-09   Pyrus x bretschneideri [bai li]
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  63.5    9e-09   Sorghum bicolor [broomcorn]
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  63.5    9e-09   Sorghum bicolor [broomcorn]
ref|XP_006442372.1|  hypothetical protein CICLE_v10020761mg           63.5    9e-09   Citrus clementina [clementine]
ref|XP_009384410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    9e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860        63.5    9e-09   Sorghum bicolor [broomcorn]
gb|AAL57301.1|AF387790_1  O-methyltransferase                         63.5    9e-09   Sorghum bicolor [broomcorn]
dbj|BAJ95117.1|  predicted protein                                    63.2    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAO43609.1|  caffeic acid O-methyltransferase                      63.2    1e-08   Sorghum bicolor [broomcorn]
gb|AGS49192.1|  O-methyltransferase                                   63.2    1e-08   Zea mays [maize]
gb|AEV93478.1|  caffeic acid O-methyltransferase                      63.2    1e-08   Caragana korshinskii
gb|ADR31595.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  61.6    1e-08   Populus trichocarpa [western balsam poplar]
gb|ADR31594.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  61.6    1e-08   Populus trichocarpa [western balsam poplar]
gb|ADR31604.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  61.6    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg           63.2    1e-08   Citrus clementina [clementine]
ref|XP_008362842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    1e-08   
gb|ADR31602.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  61.6    1e-08   Populus trichocarpa [western balsam poplar]
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                63.2    1e-08   
gb|AGS49214.1|  O-methyltransferase                                   63.2    1e-08   Zea mays [maize]
gb|ADR31598.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...  61.6    1e-08   Populus trichocarpa [western balsam poplar]
gb|EAY85717.1|  hypothetical protein OsI_07085                        63.2    1e-08   Oryza sativa Indica Group [Indian rice]
gb|AFR39688.1|  caffeate O-methyltransferase                          59.7    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008382714.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.6    1e-08   
gb|AIY22649.1|  caffeic acid 3-O-methyl transferase                   61.2    1e-08   Saccharum arundinaceum
gb|AGS49188.1|  O-methyltransferase                                   62.8    1e-08   Zea mays [maize]
gb|AGS49182.1|  O-methyltransferase                                   62.8    1e-08   Zea mays [maize]
gb|ABI54117.1|  caffeic acid O-methyltransferase                      62.8    1e-08   Malus domestica [apple tree]
gb|EMT16763.1|  Caffeic acid 3-O-methyltransferase                    62.4    2e-08   
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.8    2e-08   
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                     62.8    2e-08   Populus tomentosa [Chinese white poplar]
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  62.8    2e-08   Populus sieboldii x Populus grandidentata
ref|NP_001242325.1|  uncharacterized protein LOC100805999             62.8    2e-08   
ref|XP_002321948.1|  Chain A family protein                           62.8    2e-08   
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                  62.8    2e-08   
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.8    2e-08   
dbj|BAO79382.1|  hypothetical plant O-methyltransferase               62.4    2e-08   
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg           62.4    2e-08   
ref|XP_010520934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.4    2e-08   
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      62.4    2e-08   
gb|EYU31472.1|  hypothetical protein MIMGU_mgv1a019059mg              61.2    2e-08   
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  62.4    2e-08   
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.4    2e-08   
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...  62.0    2e-08   
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                 62.0    2e-08   
gb|AGO50639.1|  caffeic acid O-methyltransferase                      62.0    3e-08   
gb|AFR39673.1|  caffeate O-methyltransferase                          58.5    3e-08   
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  62.0    3e-08   
gb|AFZ78575.1|  caffeic acid O-methyltransferase                      62.0    3e-08   
gb|AFR39681.1|  caffeate O-methyltransferase                          58.5    3e-08   
ref|XP_010448075.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  62.0    3e-08   
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase    62.0    3e-08   
gb|AGS49186.1|  O-methyltransferase                                   62.0    3e-08   
ref|XP_002525818.1|  o-methyltransferase, putative                    62.0    3e-08   
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.6    3e-08   
gb|AGS49203.1|  O-methyltransferase                                   61.6    3e-08   
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  61.6    3e-08   
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  61.6    4e-08   
ref|XP_002317838.1|  Chain A family protein                           61.6    4e-08   
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                    61.6    4e-08   
gb|ACN40509.1|  unknown                                               59.7    4e-08   
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  61.6    4e-08   
gb|AIJ28474.1|  O-methyltransferase                                   61.2    4e-08   
gb|ACT87981.1|  caffeic acid O-methyltransferase                      61.2    4e-08   
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g           61.2    5e-08   
ref|XP_002302676.2|  eugenol O-methyltransferase family protein       61.2    5e-08   
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.2    5e-08   
gb|AAF28353.1|AF220491_1  O-methyltransferase                         61.2    5e-08   
gb|KDP36008.1|  hypothetical protein JCGZ_10407                       61.2    5e-08   
ref|XP_006492698.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.2    5e-08   
ref|XP_002520291.1|  o-methyltransferase, putative                    61.2    5e-08   
gb|KDP32876.1|  hypothetical protein JCGZ_12168                       61.2    5e-08   
ref|XP_009384339.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  61.2    5e-08   
ref|XP_006415131.1|  hypothetical protein EUTSA_v10008040mg           60.8    6e-08   
gb|ABG27066.1|  caffeic acid O-methyltransferase                      60.8    6e-08   
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...  60.8    6e-08   
gb|ABK24940.1|  unknown                                               57.8    7e-08   
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...  60.8    7e-08   
gb|ADB82906.1|  caffeic O-methyltransferase1                          60.8    7e-08   
gb|ACY66932.1|  caffeic O-methyltransferase 1                         60.8    7e-08   
gb|KDP32878.1|  hypothetical protein JCGZ_12170                       60.8    7e-08   
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase            60.8    7e-08   
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase    60.8    7e-08   
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  60.8    7e-08   
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g           60.8    7e-08   
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  60.8    7e-08   
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...  60.8    7e-08   
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...  60.8    7e-08   
gb|ABI54119.1|  caffeic acid O-methyltransferase                      60.8    7e-08   
ref|XP_010267679.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.8    7e-08   
ref|XP_010433307.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  60.8    8e-08   
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase               60.8    8e-08   
ref|XP_004494877.1|  PREDICTED: anthranilate N-methyltransferase-...  60.8    8e-08   
ref|XP_011038013.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.8    8e-08   
gb|KDP30064.1|  hypothetical protein JCGZ_18389                       60.5    8e-08   
ref|XP_002869540.1|  hypothetical protein ARALYDRAFT_913747           60.5    8e-08   
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.5    8e-08   
gb|AFK42771.1|  unknown                                               60.5    8e-08   
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                   60.8    8e-08   
emb|CDP18417.1|  unnamed protein product                              60.5    8e-08   
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase       60.5    8e-08   
emb|CBI23095.3|  unnamed protein product                              59.3    8e-08   
emb|CDY19039.1|  BnaC01g20290D                                        60.5    9e-08   
gb|EMT13959.1|  Caffeic acid 3-O-methyltransferase                    60.5    9e-08   
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg           60.5    9e-08   
gb|ABZ89571.1|  O-methyltransferase 7                                 57.0    9e-08   
gb|AES69074.2|  caffeic acid O-methyltransferase                      60.5    9e-08   
ref|XP_009388361.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.5    9e-08   
ref|XP_003598823.1|  Isoliquiritigenin 2'-O-methyltransferase         60.5    1e-07   
gb|AAR09601.1|  flavonoid 3'-O-methyltransferase                      60.5    1e-07   
ref|XP_011025357.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.1    1e-07   
ref|XP_009418618.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  60.1    1e-07   
emb|CDX84055.1|  BnaC08g07320D                                        60.1    1e-07   
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1      60.5    1e-07   
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase    60.1    1e-07   
ref|XP_002864307.1|  O-methyltransferase 1                            60.1    1e-07   
ref|XP_010438549.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  60.1    1e-07   
gb|KJB73217.1|  hypothetical protein B456_011G223000                  60.1    1e-07   
gb|KJB73218.1|  hypothetical protein B456_011G223000                  60.1    1e-07   
ref|XP_010448093.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  60.1    1e-07   
gb|KDO42947.1|  hypothetical protein CISIN_1g030025mg                 58.2    1e-07   
ref|XP_002302677.1|  eugenol O-methyltransferase family protein       60.1    1e-07   
gb|KJB73216.1|  hypothetical protein B456_011G223000                  60.1    1e-07   
gb|KJB23958.1|  hypothetical protein B456_004G125600                  59.7    1e-07   
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase    60.1    1e-07   
gb|ABK23414.1|  unknown                                               60.1    1e-07   
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase    60.1    1e-07   
gb|ABR18103.1|  unknown                                               60.1    1e-07   
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                    59.7    1e-07   
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
ref|XP_006492699.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
emb|CDY29856.1|  BnaA03g48770D                                        59.7    1e-07   
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             59.7    1e-07   
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase               59.7    2e-07   
gb|EYU24254.1|  hypothetical protein MIMGU_mgv1a021371mg              57.0    2e-07   
gb|KJB23954.1|  hypothetical protein B456_004G125600                  59.7    2e-07   
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                    59.7    2e-07   
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...  59.7    2e-07   
ref|XP_002465645.1|  hypothetical protein SORBIDRAFT_01g042900        59.7    2e-07   
gb|KDP35860.1|  hypothetical protein JCGZ_10599                       59.7    2e-07   
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  59.7    2e-07   
prf||1906376A  O-methyltransferase                                    59.7    2e-07
gb|AAF60951.1|  O-methyltransferase                                   59.3    2e-07   
gb|KDP32877.1|  hypothetical protein JCGZ_12169                       59.3    2e-07   
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...  59.3    2e-07   
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                    59.3    2e-07   
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...  59.3    2e-07   
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...  59.3    2e-07   
gb|KGN56012.1|  O-methyltransferase-like protein                      56.6    2e-07   
ref|NP_001066372.1|  Os12g0202800                                     56.6    2e-07   
gb|ADA61114.1|  caffeic acid o-methyltransferase                      59.3    2e-07   
ref|XP_002966220.1|  hypothetical protein SELMODRAFT_85878            59.3    2e-07   
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase             59.3    2e-07   
ref|XP_010538869.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  59.3    2e-07   
dbj|BAO79385.1|  hypothetical plant O-methyltransferase               59.3    2e-07   
gb|KJB52492.1|  hypothetical protein B456_008G264900                  59.3    2e-07   
ref|XP_002443937.1|  hypothetical protein SORBIDRAFT_07g004690        59.3    2e-07   
ref|NP_001268100.1|  caffeic acid O-methyltransferase                 59.3    2e-07   
ref|XP_009384398.1|  PREDICTED: flavone O-methyltransferase 1-like    59.3    2e-07   
ref|XP_006434352.1|  hypothetical protein CICLE_v10001555mg           59.3    2e-07   
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.3    2e-07   
gb|ADN27527.1|  caffeic acid O-methyltransferase                      59.3    2e-07   
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g           58.9    3e-07   
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase    58.9    3e-07   
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                   58.9    3e-07   
ref|XP_011460531.1|  PREDICTED: (S)-scoulerine 9-O-methyltransfer...  58.9    3e-07   
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                    58.9    3e-07   
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.9    3e-07   
dbj|BAC78827.1|  caffeic acid O-methyltransferase                     58.9    3e-07   
ref|XP_004979788.1|  PREDICTED: probable inactive methyltransfera...  58.9    3e-07   
ref|XP_006413045.1|  hypothetical protein EUTSA_v10025522mg           58.9    3e-07   
gb|AFD53036.1|  caffeic acid-O-methyltransferase                      58.9    3e-07   
gb|AHY28756.1|  caffeate O-methyltransferase                          56.6    3e-07   
ref|XP_009351911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.8    3e-07   
ref|XP_009420747.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.9    3e-07   
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase    58.9    3e-07   
ref|XP_009386810.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.8    3e-07   
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase    58.5    3e-07   
ref|XP_006413027.1|  hypothetical protein EUTSA_v10025520mg           58.5    4e-07   
ref|XP_011470872.1|  PREDICTED: caffeic acid 3-O-methyltransferase    58.5    4e-07   
emb|CDP20700.1|  unnamed protein product                              58.5    4e-07   
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                    58.5    4e-07   
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase              58.5    4e-07   
emb|CDY18302.1|  BnaC09g30520D                                        57.0    4e-07   
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...  58.5    4e-07   
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                    58.5    4e-07   
ref|XP_009107965.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  58.2    5e-07   
emb|CDP15755.1|  unnamed protein product                              57.4    5e-07   
gb|AAV36305.1|  caffeate O-methyltransferase                          56.2    5e-07   
ref|XP_010261275.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-scouleri...  58.2    5e-07   
ref|XP_009137685.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  58.2    5e-07   
gb|AHY28751.1|  caffeate O-methyltransferase                          56.2    5e-07   
ref|XP_006431875.1|  hypothetical protein CICLE_v10003323mg           58.2    5e-07   
emb|CDX92835.1|  BnaC07g40930D                                        58.2    5e-07   
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                    58.2    5e-07   
gb|AAV36309.1|  caffeate O-methyltransferase                          55.8    5e-07   
ref|XP_010057313.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  55.1    6e-07   
dbj|BAJ34520.1|  unnamed protein product                              58.2    6e-07   
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  58.2    6e-07   
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               58.2    6e-07   
ref|XP_006471122.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  56.6    6e-07   
gb|AAT08695.1|  O-methyltransferase                                   56.2    6e-07   
gb|ABP93669.1|  O-methyltransferase 3                                 57.8    6e-07   
ref|XP_002300513.1|  eugenol O-methyltransferase family protein       57.8    6e-07   
emb|CDY52172.1|  BnaC01g22350D                                        58.2    7e-07   
ref|XP_009387230.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  54.7    7e-07   
ref|XP_002520292.1|  o-methyltransferase, putative                    57.8    7e-07   
gb|AFM73597.1|  caffeate O-methyltransferase                          57.4    7e-07   
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...  57.8    7e-07   
ref|XP_006445847.1|  hypothetical protein CICLE_v10018226mg           57.8    7e-07   
ref|XP_004979830.1|  PREDICTED: probable inactive methyltransfera...  57.8    7e-07   
gb|KCW74614.1|  hypothetical protein EUGRSUZ_E033411                  54.7    7e-07   
gb|AFK37032.1|  unknown                                               54.7    7e-07   
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg           57.8    7e-07   
ref|XP_009146853.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.8    8e-07   
emb|CDY18306.1|  BnaC09g30560D                                        57.8    8e-07   
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                57.8    8e-07   
gb|EMT25448.1|  Caffeic acid 3-O-methyltransferase                    57.8    8e-07   
gb|AIN36846.1|  myricetin 3'-O-methyltransferase 4                    57.8    8e-07   
ref|XP_009146845.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.4    8e-07   
gb|AEO21927.1|  bergaptol-O-methyltransferase                         57.4    8e-07   
ref|XP_007212477.1|  hypothetical protein PRUPE_ppa015120mg           57.4    8e-07   
gb|KEH38013.1|  caffeic acid O-methyltransferase                      57.4    8e-07   
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  57.4    8e-07   
emb|CDY44972.1|  BnaA08g06720D                                        57.4    9e-07   
sp|Q84N28.1|FOMT1_WHEAT  RecName: Full=Flavone O-methyltransferas...  57.4    9e-07   
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg           57.4    9e-07   
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...  57.4    9e-07   
gb|KEH30981.1|  isoflavone-7-O-methyltransferase                      57.4    9e-07   
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250        57.4    9e-07   
gb|KFK29300.1|  hypothetical protein AALP_AA7G115400                  57.4    9e-07   
gb|ABK25932.1|  unknown                                               57.4    9e-07   
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                  57.4    1e-06   
ref|XP_009384757.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  57.4    1e-06   
gb|ADO16247.1|  caffeic acid O-methyltransferase                      57.4    1e-06   
gb|AAN03726.1|  caffeic acid O-methyltransferase                      57.0    1e-06   
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase    57.4    1e-06   
ref|XP_002515087.1|  o-methyltransferase, putative                    57.0    1e-06   
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg           57.0    1e-06   
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase         57.0    1e-06   
gb|ABI54121.1|  caffeic acid O-methyltransferase                      55.8    1e-06   
ref|XP_004172727.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  53.9    1e-06   
ref|XP_008382917.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.8    1e-06   
gb|KGN56009.1|  hypothetical protein Csa_3G046220                     54.3    1e-06   
gb|AAA34088.1|  O-methyltransferase                                   54.3    1e-06   
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  57.0    1e-06   
gb|AFK44249.1|  unknown                                               57.0    1e-06   
sp|P45986.1|IMT1_MESCR  RecName: Full=Inositol 4-methyltransferase    57.0    1e-06   
gb|ABY74431.1|  inositol methyl transferase                           57.0    1e-06   
gb|KJB73213.1|  hypothetical protein B456_011G222800                  57.0    1e-06   
gb|KGN56011.1|  O-methyltransferase-like protein                      53.9    2e-06   
gb|AJK93387.1|  caffeic acid O-methyltransferase                      56.6    2e-06   
ref|XP_002864309.1|  O-methyltransferase 1                            56.6    2e-06   



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKL+ CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  134  LTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  193

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  194  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  230



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKL+ CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  263  LTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  322

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE Y++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  323  GKHRTEEEYKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  265  LTTWTDEECKQIMKNCYNALPAGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  325  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  361



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  259  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  318

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  319  GKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  355



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  263  LTTWTDEECKEIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  322

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  323  GKHRTEEEFKELGLSAGFPTFRPFYIDYFYTILEFQK  359



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  260  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  319

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  320  GKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  356



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  289  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  348

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  349  GKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  385



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP Q+DD+ RTR LL  DIF+M +YRAK
Sbjct  261  LTTWTDEECKQIMENCYKALPVGGKLIACEPVLPKQSDDSHRTRALLEGDIFVMTIYRAK  320

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH T E ++ LG SVGF  F+A+Y+D+F  VLEFHK
Sbjct  321  GKHRTAEEFKLLGQSVGFSHFQAFYIDYFYTVLEFHK  357



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECKAIM NCY AL  GGKLI CEPVLP ++DD+ RTR LL  DIF+M +YRAK
Sbjct  251  LTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAK  310

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH T++ ++QLGLS GF  F+A+Y+D+F  VLEF K
Sbjct  311  GKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  347



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKL+ CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  263  LTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPQETDDSHRTRALLEGDIFVMTIYRTK  322

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  323  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECKAIM NCY AL  GGKLI CEPVLP ++DD+ RTR LL  DIF+M +YRAK
Sbjct  265  LTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAK  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH T++ ++QLGLS GF  F+A+Y+D+F  VLEF K
Sbjct  325  GKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECKAIM NCY AL  GGKLI CEPVLP ++DD+ RTR LL  DIF+M +YRAK
Sbjct  265  LTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAK  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH T++ ++QLGLS GF  F+A+Y+D+F  VLEF K
Sbjct  325  GKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>emb|CBI30187.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGK+I CEPVLP ++D++ RTR LL  DIF+M +YRAK
Sbjct  53   LTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAK  112

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQLGLS GF   +A+Y+D F  VLEF K
Sbjct  113  GKHRTEEEFRQLGLSAGFPHLRAFYIDHFYTVLEFQK  149



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YR+K
Sbjct  258  LTTWTDEECKQIMRNCYNALPPGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRSK  317

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLGL+ GF  F+ +Y+D+F  VLEF K
Sbjct  318  GKHRTEEEFKQLGLASGFSLFRPFYIDYFYTVLEFQK  354



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YR K
Sbjct  264  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  323

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF TF+ +Y+D+F  + EF K
Sbjct  324  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTIFEFQK  360



>ref|XP_009787879.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Nicotiana 
sylvestris]
Length=121

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM +CY AL + GKLI CEPVLP  TDD++RTR LL  DIF+M +YRAK
Sbjct  24   LTTWTDDECKQIMKSCYNALPKKGKLIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAK  83

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TE+ YRQLG S GF   + +Y+D F  VLEFHK
Sbjct  84   GKHRTEDEYRQLGRSAGFADCRGFYIDHFFTVLEFHK  120



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D ECK IM NCY AL  GGKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK
Sbjct  268  LTTWTDNECKLIMENCYKALPVGGKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRAK  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLG SVGF  F+A+Y+D+F  VLEF K
Sbjct  328  GKHRTEEEFKQLGQSVGFSYFRAFYVDYFYTVLEFQK  364



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TDD+ RTR LL  +IF+M +YR K
Sbjct  267  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGNIFVMTIYRTK  326

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LGLS GF +F+ +Y+D+F  +LEF K
Sbjct  327  GKHRTEEEFKELGLSAGFPSFRPFYIDYFYTILEFQK  363



>ref|XP_006428523.1| hypothetical protein CICLE_v10013676mg [Citrus clementina]
 gb|ESR41763.1| hypothetical protein CICLE_v10013676mg [Citrus clementina]
Length=102

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GGKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  6    LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  65

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TE+ ++QLGLS GF   +A+Y+D+F  +LEF K
Sbjct  66   GKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFQK  102



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGKLI CEPVLP +TD++ RTR LL  DIF+M +YR K
Sbjct  263  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDESHRTRALLEGDIFVMTIYRTK  322

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE + +LGLS GF TF+ +Y+D+F  +LEF K
Sbjct  323  GKHRTEEEFIELGLSAGFPTFRPFYIDYFYTILEFQK  359



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK I+ NC+ AL  GGKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK
Sbjct  189  LTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAK  248

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TE+ ++QLGLS GF  F+A+Y+D F AVLEF K
Sbjct  249  GKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  285



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  541  AWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRK  362
            AW+DEECK  + NCY AL   GKLIVCEPVLP  TD++QRTR LLG DIFIM MYR K K
Sbjct  267  AWTDEECKKTLQNCYKALPVDGKLIVCEPVLPELTDESQRTRALLGGDIFIMTMYRTKGK  326

Query  361  HWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            H TEE ++QLG S GF  F+A+Y+D +LAVLEF K
Sbjct  327  HRTEEQFKQLGASTGFFRFRAFYIDPYLAVLEFQK  361



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D ECK IM NCY AL  GGKL+ CEPVLP  +DD+ RTR LL  DIF+M +YR K
Sbjct  268  LTTWTDNECKLIMENCYKALPMGGKLVACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTK  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLG SVGF  F+A+Y+D+F  VLEF K
Sbjct  328  GKHRTEEEFKQLGQSVGFSHFRAFYVDYFYTVLEFQK  364



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GGKLI CEPVLP QTDD+ RTR LL  DIF+M +YRAK
Sbjct  261  LTTWTDDECKVIMENCYKALPVGGKLIACEPVLPNQTDDSHRTRALLEGDIFVMTIYRAK  320

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +++LG SVGF  F+  Y D F  VLEF K
Sbjct  321  GKHRTEEEFKKLGHSVGFSHFRPLYFDHFHTVLEFQK  357



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK I+ NC+ AL  GGKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK
Sbjct  249  LTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAK  308

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TE+ ++QLGLS GF  F+A+Y+D F AVLEF K
Sbjct  309  GKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  345



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK I+ NC+ AL  GGKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK
Sbjct  264  LTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAK  323

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TE+ ++QLGLS GF  F+A+Y+D F AVLEF K
Sbjct  324  GKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  360



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGK+I CEPVLP ++D++ RTR LL  DIF+M +YRAK
Sbjct  262  LTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAK  321

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQLGLS GF   +A+Y+D F  VLEF K
Sbjct  322  GKHRTEEEFRQLGLSAGFPHLRAFYIDHFYTVLEFQK  358



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NCY AL  GGK+I CEPVLP ++D++ RTR LL  DIF+M +YRAK
Sbjct  262  LTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAK  321

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQLGLS GF    A+Y+D F  VLEF K
Sbjct  322  GKHRTEEEFRQLGLSAGFPHLXAFYIDXFYTVLEFQK  358



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM +CY AL + GK I CEPVLP  TDD++RTR LL  DIF+M +YRAK
Sbjct  264  LTTWTDDECKEIMKSCYNALPEKGKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAK  323

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE YRQLG + GF   K +Y+D F  +LEFHK
Sbjct  324  GKHRTEEEYRQLGRAAGFNECKGFYIDHFFTILEFHK  360



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+EC+AIM +C  A+  GGKLI CEPVLP +TDD+ RTR LL  DIF+M +YRAK
Sbjct  263  LTTWTDDECQAIMESCCKAVPGGGKLIACEPVLPKETDDSHRTRALLSGDIFVMTIYRAK  322

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TE+ YR+LGL+ GF  F+A+Y+D+F  VLEF K
Sbjct  323  GKHRTEDEYRKLGLAAGFPHFQAFYIDYFHTVLEFTK  359



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM +CY AL + GK I CEPVLP  TDD++RTR LL  DIF+M +YRAK
Sbjct  264  LTTWTDDECKEIMKSCYIALPEKGKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAK  323

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE YRQLG + GF   K +Y+D F  +LEFHK
Sbjct  324  GKHRTEEEYRQLGRAAGFNDCKGFYIDHFFTILEFHK  360



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+D+E K IM NCY AL  GGKLI CEPVLP  +DD+ RTR LL  DIF+M +YRAK
Sbjct  257  LITWTDKEIKHIMQNCYKALPAGGKLIACEPVLPEDSDDSHRTRALLQGDIFVMTIYRAK  316

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLG+S GF  FKA+++D F AVLEF K
Sbjct  317  GKHRTEEQFKQLGISAGFNLFKAFHVDHFYAVLEFQK  353



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D ECK IM NCY AL  GGKLI CEPVLP ++DD+ RTR LL +DIF+M +YRAK
Sbjct  272  LSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDDSPRTRALLENDIFVMTIYRAK  331

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K+ TE+  RQLGLS GF  FK  Y+D+F  VLEF K
Sbjct  332  GKNRTEDELRQLGLSAGFSHFKPIYIDYFYTVLEFQK  368



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GGK+I CEPVLP ++D + RTR LL  DIF+M +YRAK
Sbjct  258  LTTWTDDECKLIMRNCYEALPPGGKMIACEPVLPKESDRSHRTRALLEGDIFVMAIYRAK  317

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLGL+ GF  F+A+Y+D F  VLEF K
Sbjct  318  GKHRTEEEFKQLGLASGFPHFRAFYIDQFYTVLEFQK  354



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM NC+ AL +GGKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK
Sbjct  259  LTTWTDEECKHIMQNCHKALPEGGKLIACEPVLPEDSDESHRTRALLEGDIFVMTIYRAK  318

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQL +  GF  F+A+++D F  VLEF K
Sbjct  319  GKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  355



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D ECK I+ NCY AL +GGKLI CEPVLP ++D++ RTR LL +DIF+M +YRAK
Sbjct  188  LSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAK  247

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K+ +E+  RQLGLS GF  FK +Y+D+F  V+EF K
Sbjct  248  GKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  284



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D ECK IM NCY AL  GGKLI CEPVLP ++DD+ RTR LL +D+F+M +YRAK
Sbjct  272  LSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDDSSRTRALLENDVFVMTIYRAK  331

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K+ TEE  RQLGLS GF  F+  Y+D+F  +LEF K
Sbjct  332  GKNRTEEELRQLGLSAGFSHFRPIYIDYFYTLLEFQK  368



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D ECK I+ NCY AL +GGKLI CEPVLP ++D++ RTR LL +DIF+M +YRAK
Sbjct  273  LSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAK  332

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K+ +E+  RQLGLS GF  FK +Y+D+F  V+EF K
Sbjct  333  GKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  369



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM +C+ AL +GGKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK
Sbjct  241  LTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAK  300

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQL +  GF  F+A+++D F  VLEF K
Sbjct  301  GKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  337



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D ECK I+ NCY AL +GGKLI CEPVLP ++D++ RTR LL +DIF+M +YRAK
Sbjct  276  LSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAK  335

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K+ +E+  RQLGLS GF  FK +Y+D+F  V+EF K
Sbjct  336  GKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  372



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEECK IM +C+ AL +GGKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK
Sbjct  260  LTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAK  319

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQL +  GF  F+A+++D F  VLEF K
Sbjct  320  GKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  356



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM +CY AL + GKLI CEPVLP  TDD++RTR LL  DIF+M +YRAK
Sbjct  269  LTTWTDDECKQIMKSCYNALPEKGKLIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAK  328

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TE+ YRQLG S GF   + +Y+D F  +LEF K
Sbjct  329  GKHRTEDEYRQLGRSAGFADCRGFYIDHFFTILEFQK  365



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEE K IM NCY AL  GGKLI CEPVLP  +DD+ RTR  L  DIF+M +YRAK
Sbjct  258  LTTWTDEEIKHIMLNCYKALPAGGKLIACEPVLPETSDDSHRTRASLAGDIFVMTIYRAK  317

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQL +S GF  FK++++D+F  VLEF K
Sbjct  318  GKHRTEEQFRQLAISAGFNLFKSFHVDYFHIVLEFQK  354



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+D+ECK IM NCY AL  GGKLI CEPVLP  +DD+ RTR LL  DIF+M +YR K
Sbjct  260  LVTWTDDECKLIMENCYKALPVGGKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTK  319

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLGLS GF  F+A+  D F +VLEF K
Sbjct  320  GKHRTEEEFKQLGLSAGFPHFRAFCFDDFYSVLEFQK  356



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            W+DEE K  + +CY AL   GKLI+CEPVLP QTD+++RTR LL +DI+IM MYR K KH
Sbjct  265  WTDEEFKKALQSCYKALPVAGKLILCEPVLPEQTDESKRTRALLAADIWIMTMYRTKGKH  324

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TEE ++QLG+S GF++F+A+++D +L VLEFHK
Sbjct  325  RTEEQFKQLGISAGFKSFRAFHIDPYLPVLEFHK  358



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            +  W+DEECK ++ NCY AL   GKLIVCEPV P  TD++QRTR LL  DIFIM MYR K
Sbjct  262  MLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYRTK  321

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLG+S GF  F+A+++D +  VLEF K
Sbjct  322  GKHRTEEQFKQLGISTGFLRFRAFHIDPYFPVLEFQK  358



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            +  W+DEECK ++ NCY AL   GKLIVCEPV P  TD++QRTR LL  DIFIM MY+ K
Sbjct  239  MLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTK  298

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLG+S GF  F+A+++D +  VLEF K
Sbjct  299  GKHRTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  335



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEEC AI+ NCY AL +GGK+I CEPVLP++TD+++RTR LL  DIF+M +YR  
Sbjct  274  LTTWTDEECTAILRNCYNALPEGGKVIACEPVLPVETDNSRRTRALLEGDIFVMAIYRTL  333

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  TEE +RQLG  VGF  F+A Y+D F AV+E+ K
Sbjct  334  GRERTEEEFRQLGGVVGFTAFRAIYLDPFYAVVEYQK  370



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GG+LI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  85   LTTWTDDECKLIMENCYKALPAGGELIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  144

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH  E+ ++QLG S  F   +A+Y D+F  +LEF K
Sbjct  145  GKHRIEQEFKQLGFSASFPHLRAFYFDYFHTLLEFQK  181



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            +  W+DEECK ++ NCY AL   GKLIVCEPV P  TD++QRTR LL  DIFIM MY+ K
Sbjct  262  MLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTK  321

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE ++QLG+S GF  F+A+++D +  VLEF K
Sbjct  322  GKHRTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  358



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+DEEC  I+ NCY AL + GK+I CEPVLP +TD++QRTR LL +DIF+M +YR +
Sbjct  313  LMTWTDEECMLILKNCYKALPEKGKVIACEPVLPEETDNSQRTRALLENDIFVMTIYRVQ  372

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  TEE +RQ+GLSVGF  FKA+Y D F  +LEF K
Sbjct  373  GRGRTEEEFRQIGLSVGFSNFKAFYSDHFYTILEFQK  409



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+E K IM NCY +L  GGKLI CEPVLP  +DD+ RTR LL  DIF+M +Y AK
Sbjct  287  LTTWTDDEIKLIMKNCYDSLPAGGKLIACEPVLPETSDDSHRTRALLSGDIFVMTIYGAK  346

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +H  EE YRQLG S GF  F+A ++D+F  VLEF K
Sbjct  347  GRHRMEEEYRQLGNSAGFPHFRAVHIDYFFTVLEFQK  383



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+DEE K IM NC+ AL +GGKLI CEPVLP  +D++ RTR LL  DIF+M +YRAK
Sbjct  258  LTTWTDEEIKQIMQNCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAK  317

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE +RQL    GF  F+A+ +D F  VLEF K
Sbjct  318  GKHRTEEQFRQLANDAGFPRFRAFNVDHFYTVLEFQK  354



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D ECK I+ NCY AL  GGKLI CEPV+P ++DD+ RTR LL +DIF+M +YR K
Sbjct  262  LSTWTDCECKLILENCYKALPAGGKLIACEPVVPRKSDDSHRTRALLENDIFVMTIYRTK  321

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K+ TEE  RQLG S GF  F+  Y+D+F  VLEF K
Sbjct  322  GKNRTEEELRQLGHSAGFSHFRPIYIDYFYTVLEFQK  358



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D+ECK I+ NC  +L  GGKLI CEP LP +TD++ RTR LL SD+FIM +Y+AK
Sbjct  274  LSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAK  333

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TEE +RQLGLS GF   + +++D+F  +LEF K
Sbjct  334  SKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  370



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D+ECK I+ NC  +L  GGKLI CEP LP +TD++ RTR LL SD+FIM +Y+AK
Sbjct  313  LSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAK  372

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TEE +RQLGLS GF   + +++D+F  +LEF K
Sbjct  373  SKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  409



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+++EC AI+ NCYAAL  GGKL+ CEPV+P  TD + RTR LL +DIF+M  YR +
Sbjct  217  LTTWTNDECTAILRNCYAALPAGGKLVACEPVVPDTTDGSTRTRALLENDIFVMTTYRTQ  276

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +RQLGL+VGF  F+A Y+D F A+LE+ K
Sbjct  277  GRERSEEEFRQLGLAVGFTFFRAIYLDPFYALLEYTK  313



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+++EC AI+ NCY AL +GGKLI CEPV+P  TD + RTR LL +DIF+M  YR +
Sbjct  266  LTTWTNDECTAILKNCYGALPEGGKLIACEPVVPETTDTSTRTRALLENDIFVMTTYRTQ  325

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +RQLGL+ GF  F+A Y+D F AVLE+ K
Sbjct  326  GRERSEEEFRQLGLAAGFTAFRAIYLDPFYAVLEYLK  362



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L+ W+D+ECK I+ NC  +L  GGKLI CEP LP +TD++ RTR LL SD+FIM +Y+AK
Sbjct  275  LSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAK  334

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TEE +RQLGLS GF   + +++D+F  +LEF K
Sbjct  335  SKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFTK  371



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK I+ NC+ AL  GGK++ CEPVLP  TD++ R+R LL  DIF+M +YR+K
Sbjct  257  LTTWTDDECKHILKNCHDALPPGGKVVACEPVLPNHTDNSHRSRALLEGDIFVMTIYRSK  316

Query  367  RKHWTEEAYRQLGLSVGFRTFKA-YYMDFFLAVLEFHK  257
             KH TE  YR+LG++ GFR FKA   +D F  VLEF K
Sbjct  317  GKHRTEMEYRELGIAAGFRYFKAKILLDQFYTVLEFQK  354



>gb|EMT14045.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=197

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+++EC AI+  C+ AL +GGKLI CEPV+P  TD + RTR LL +DIF+M  YR +
Sbjct  101  LTTWTNDECTAILKKCHEALPEGGKLIACEPVVPDTTDASTRTRALLENDIFVMTTYRTQ  160

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +RQLGL+ GF  F+A Y+D F AVLE+ K
Sbjct  161  GRERSEEEFRQLGLTAGFAGFRALYLDPFYAVLEYVK  197



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W++EEC AI++NC+ AL  GGK+I CEPV+P  TD + RTR LL +DIF+M  YR +
Sbjct  269  LTTWTNEECTAILSNCHKALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQ  328

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +R LGL+ GF +F+A Y+D F AVLE+ K
Sbjct  329  GRERSEEEFRHLGLAAGFASFRAIYLDPFYAVLEYTK  365



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W++EEC AI+ NCY+AL  GGK+I CEPV+P +TD + RTR LL +DIF+M  YR +
Sbjct  246  LTTWTNEECTAILGNCYSALPDGGKVIACEPVVPEETDGSTRTRALLENDIFVMTTYRTQ  305

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  +E+ +R LG++ GF  F+A Y+D   AVLE+ K
Sbjct  306  GRERSEDEFRNLGIAAGFTGFRAIYLDPLYAVLEYTK  342



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+EC AI+ NC+AAL  GGKL+ CEPV+P +TD + RTR LL +DIF+M  YR +
Sbjct  277  LTTWTDDECTAILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQ  336

Query  367  RKHWTEEAYRQLGL-SVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +R LG+ + GF  F+A Y+D F AVLE+ K
Sbjct  337  GRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEYTK  374



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+++EC AI+ NC+AAL  GGKL+ CEPV+P +TD + RTR LL +DIF+M  YR +
Sbjct  281  LTTWTNDECTAILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQ  340

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +  LG++ GF  F+A Y+D F AVLE+ K
Sbjct  341  GRERSEEEFHHLGIAAGFTGFRAIYLDPFYAVLEYTK  377



>gb|AAP03057.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=188

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT ++DEE   +M NC  AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK
Sbjct  92   LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  151

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE YRQLGL  GF  F+  ++D+F  V+EF K
Sbjct  152  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  188



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY A+  GGKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  118  LTTWTDDECKLIMENCYKAIPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  177

Query  367  RKHWTEEAYRQLGLSVGFRTFKAY  296
             KH TE+ ++QLG S GF   + Y
Sbjct  178  GKHMTEQEFKQLGFSAGFPHLRLY  201



>gb|AAP03056.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=206

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT ++DEE   +M NC  AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK
Sbjct  110  LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  169

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE YRQLGL  GF  F+  ++D+F  V+EF K
Sbjct  170  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  206



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+EC AI+ NC+A L  GGKL+ CEPV+P +TD + RTR LL +DIF+M  YR +
Sbjct  277  LTTWTDDECTAILRNCHAXLPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQ  336

Query  367  RKHWTEEAYRQLGL-SVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +R LG+ + GF  F+A Y+D F AVLE+ K
Sbjct  337  GRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEYTK  374



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT ++DEE   +M NC  AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK
Sbjct  138  LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  197

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE YRQLGL  GF  F+  ++D+F  V+EF K
Sbjct  198  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  234



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY A+  GGKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  213  LTTWTDDECKLIMENCYKAIPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  272

Query  367  RKHWTEEAYRQLGLSVGFRTFKAY  296
             KH TE+ ++QLG S GF   + Y
Sbjct  273  GKHMTEQEFKQLGFSAGFPHLRLY  296



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GGKLI CEPVLP  ++++QRTR LL  DIF M +YRAK
Sbjct  217  LTTWTDDECKLIMENCYKALPTGGKLIACEPVLPDDSNESQRTRALLEGDIFFMTIYRAK  276

Query  367  RKHWTEEAYRQLGLSVGFRTFKAY  296
             KH TE+ ++QLG S GF   + Y
Sbjct  277  GKHMTEQEFKQLGFSTGFPHLRLY  300



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  ++++ECK IM +CY AL + GK I+C+PVLP  TDD++RTR LL  DI+ M +YRA+
Sbjct  264  LAIFTEDECKQIMKSCYNALPEKGKFIICDPVLPHHTDDSKRTRALLEIDIYGMAIYRAQ  323

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE YRQLG + GF   K  Y+D F  +LEF+K
Sbjct  324  GKHRTEEEYRQLGRAAGFTDCKGVYIDHFFTILEFYK  360



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT ++DEE   +M NC  AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK
Sbjct  279  LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  338

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             KH TEE YRQLGL  GF  F+  ++D+F  V+EF K
Sbjct  339  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  375



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+++EC AI+  C+ AL  GGKL+ CEPV+P  TD + RTR LL +DIF+M  YR +
Sbjct  271  LTTWTNDECTAILKKCHDALPDGGKLVACEPVVPETTDASTRTRALLENDIFVMTTYRTQ  330

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  +EE +RQLG++ GF  F+A Y+D F A+LE+ K
Sbjct  331  GRERSEEEFRQLGIAAGFAGFRALYLDPFYALLEYVK  367



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L   +DEECK I+ NC  AL  GGKLI+C+P+LP  TDD+ R+R +L +DI+IM MYR K
Sbjct  258  LVTCTDEECKHILKNCSDALPSGGKLIICDPLLPNHTDDSHRSRAILEADIYIMTMYRTK  317

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYY-MDFFLAVLEFHK  257
             KH TE  YR LG++ GF   KA + +D +  VLEF K
Sbjct  318  GKHRTETEYRALGVAAGFTNLKANFKIDNYFTVLEFEK  355



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GGKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  166  LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  225

Query  367  RKHWTEEAYRQLGLSVGFRTFKAY  296
              H TE+ ++QLG   GF   + Y
Sbjct  226  GNHRTEQEFKQLGFFAGFPHLRLY  249



>gb|AAP03051.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=167

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT ++DEE   +M NC  AL  GGKLI  EP LP  +D++ RTR LL +DIFIM  YRAK
Sbjct  76   LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  135

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAV  272
             KH TEE YRQLGL  GF  F+  ++D+F  V
Sbjct  136  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPV  167



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GGKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  229  LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  288

Query  367  RKHWTEEAYRQLGLSVGFRTFKAY  296
              H TE+ ++QLG   GF   + Y
Sbjct  289  GNHRTEQEFKQLGFFAGFPHLRLY  312



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM NCY AL  GGKLI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  229  LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  288

Query  367  RKHWTEEAYRQLGLSV  320
             KH TE+ ++QLG S+
Sbjct  289  GKHMTEQEFKQLGFSL  304



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+ECK IM N Y AL  G KLI CEPVLP  ++++QRTR LL  DIF+M +YRAK
Sbjct  134  LTTWTDDECKLIMENYYKALLAGRKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  193

Query  367  RKHWTEEAYRQLGLSVGFRTFKAY  296
             KH TE+ ++QLG S GF   +A+
Sbjct  194  GKHKTEQEFKQLGFSTGFPHLRAF  217



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L A +D+ECK I  NC+ AL  GGKLIVC+P+LP + DD + +R +L +DI+IM MYR K
Sbjct  263  LVACTDDECKQIFKNCFDALPPGGKLIVCDPLLPDRADDNRSSRAILEADIYIMTMYRTK  322

Query  367  RKHWTEEAYRQLGLSVGFRTFKA-YYMDFFLAVLEFHK  257
             KH TE   R+LGL+ GF   K  + +D +  VLEF K
Sbjct  323  GKHRTETECRELGLAAGFHNLKPKFNVDHYFTVLEFQK  360



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            LT W+D+E K IM NCY AL  GGKLI C+PVL   ++++QRTR LL  DIF+M +YRAK
Sbjct  134  LTTWTDDEYKLIMENCYKALPAGGKLIACKPVLLDDSNESQRTRALLEGDIFVMTIYRAK  193

Query  367  RKHWTEEAYRQLGLSVGFRTFKAY  296
             KH TE+ ++QLG S GF   + Y
Sbjct  194  GKHRTEQEFKQLGFSAGFLHLRLY  217



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -3

Query  493  ALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTEEAYRQLGLSVGF  314
            AL  GGK+I CEPV+P  TD + RTR LL +DIF+M  YR + +  +EE +R LGL+ GF
Sbjct  267  ALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQGRERSEEEFRHLGLAAGF  326

Query  313  RTFKAYYMDFFLAVLEFHK  257
             +F+A Y+D F AVLE+ K
Sbjct  327  ASFRAIYLDPFYAVLEYTK  345



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+D+ECK IM NCY AL  GGKLI CEPVL   ++++QRTR LL  DIF+M +YRAK
Sbjct  229  LATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAK  288

Query  367  RKHWTE  350
             KH TE
Sbjct  289  GKHRTE  294



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +W D+EC  ++ NCY AL + GK+I  E VLP+ TD +  TR LL +D+F+M +Y   
Sbjct  256  LCSWDDDECVGLLKNCYKALPEKGKVIALEQVLPMHTDTSPSTRALLQADVFLMAIYSPG  315

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE+ +R+L  + GFRT +      F   LEF K
Sbjct  316  SKRRTEDIFRRLSEAAGFRTLEIVLPGSFYTALEFQK  352



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+D+ECK IM NCY AL  GGKLI CEPVL   ++++QRTR LL  DIF+M +YRAK
Sbjct  229  LATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAK  288



>gb|KDO38720.1| hypothetical protein CISIN_1g0449412mg, partial [Citrus sinensis]
Length=58

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFI  389
            LT W+D+ECK IM NCY AL  GGKLI CEPVLP  ++++QRTR LL  DI +
Sbjct  6    LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL  58



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  514  IMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKHWTE  350
            IM  CY AL  GGKLIVCEPVLP  ++++QRTR LL  DIF+M +YRAK   WT+
Sbjct  197  IMEKCYKALPAGGKLIVCEPVLPDDSNESQRTRALLEGDIFVMTIYRAKAYQWTK  251



>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt)
 pdb|3REO|B Chain B, Monolignol O-Methyltransferase (Momt)
 pdb|3REO|C Chain C, Monolignol O-Methyltransferase (Momt)
 pdb|3REO|D Chain D, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|A Chain A, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|B Chain B, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|C Chain C, Monolignol O-Methyltransferase (Momt)
 pdb|3TKY|D Chain D, Monolignol O-Methyltransferase (Momt)
Length=368

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++ NCYAAL   GK+IV E +LP   D +  T+ ++ +D  ++  Y    K 
Sbjct  274  WSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALML-AYNPGGKE  332

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L ++ GFR FK     F   V+EF K
Sbjct  333  RTEKEFQALAMASGFRGFKVASCAFNTYVMEFLK  366



>gb|AFQ94040.1| monolignol 4-O-methyltransferase 4 [synthetic construct]
Length=368

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++ NCYAAL   GK+IV E +LP   D +  T+ ++ +D  ++  Y    K 
Sbjct  274  WSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALML-AYNPGGKE  332

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L ++ GFR FK     F   V+EF K
Sbjct  333  RTEKEFQALAMASGFRGFKVASCAFNTYVMEFLK  366



>sp|O04385.2|IEMT_CLABR RecName: Full=(Iso)eugenol O-methyltransferase; AltName: Full=S-adenosysl-L-methionine:(Iso)eugenol 
O-methyltransferase; 
Short=IEMT; Flags: Precursor [Clarkia breweri]
 gb|AAC01533.1| SAM:(Iso)eugenol O-methyltransferase [Clarkia breweri]
Length=368

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++ NCYAAL   GK+IV E +LP   D +  T+ ++ +D  ++  Y    K 
Sbjct  274  WSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALML-AYNPGGKE  332

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L ++ GFR FK     F   V+EF K
Sbjct  333  RTEKEFQALAMASGFRGFKVASCAFNTYVMEFLK  366



>gb|AGS49208.1| O-methyltransferase [Zea mays]
Length=364

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K W E  +R+L    GF  FKA Y+
Sbjct  328  GKEWYEREFRELAKGAGFSGFKATYI  353



>ref|XP_009385332.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=361

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE+C  I+NNC+ AL++ GK+IV E +LPI  + T + + +   D++++      
Sbjct  266  LHNWSDEDCVKILNNCWKALTENGKVIVVECILPIVPEPTAKAQAVFQLDLYMLVCSNGG  325

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            R+  +EE ++ L +  GF  FKA ++     V+EF K
Sbjct  326  RER-SEEGFKDLAIEAGFPGFKATHVFADTWVMEFTK  361



>gb|EPS67212.1| hypothetical protein M569_07558 [Genlisea aurea]
Length=364

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE+CK I+ +CY AL   GK+I+ E +LP   D++  T+ ++  DI IM  +    K 
Sbjct  272  WSDEDCKKILKHCYEALPGNGKVILVECILPNAPDNSSATQNVVHVDI-IMLGHNIGGKE  330

Query  358  WTEEAYRQLGLSVGFRTFK  302
             TEE +R LGL+ GF  FK
Sbjct  331  RTEEEFRALGLASGFNNFK  349



>gb|AAO12872.1| putative O-methyltransferase, partial [Vitis vinifera]
Length=127

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (53%), Gaps = 1/108 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +WSDE C  ++ NCY AL   GK+IV + V+P   + + + +     D+F+MN+    
Sbjct  21   LHSWSDEHCVKLLRNCYHALPDNGKVIVVDAVIPDAPEPSAQVKSTYQLDLFMMNL-NPD  79

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*PSQDIISIYL  224
             K  TE+ + +L    GF + K     +  +++EFH     D+I I +
Sbjct  80   GKERTEKEFAELAKEAGFFSTKVAGCAYSFSLVEFHNKMQHDLIMIVI  127



>ref|XP_006441264.1| hypothetical protein CICLE_v100208141mg, partial [Citrus clementina]
 gb|ESR54504.1| hypothetical protein CICLE_v100208141mg, partial [Citrus clementina]
Length=122

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  ++ ++  D  IM  +    K 
Sbjct  28   WSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPGGKE  86

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +R L  + GF+ F+     F   ++EF K
Sbjct  87   RTEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  120



>gb|EPS69337.1| hypothetical protein M569_05429, partial [Genlisea aurea]
Length=102

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMY-RA  371
            L  W DE+CK I+  CY  + + GK++V E +LP   D++  T+ ++ +D+ ++  + R 
Sbjct  6    LHDWGDEDCKKILKKCYEGIPENGKVMVVEYILPDTIDNSLATQNVVDTDLIMLARFMRG  65

Query  370  KRKHWTEEAYRQLGLSVGFRTFK  302
            K +  TEE +R LGL+ GF  FK
Sbjct  66   KER--TEEEFRTLGLASGFNHFK  86



>emb|CAN64514.1| hypothetical protein VITISV_023818 [Vitis vinifera]
Length=114

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +WSDE C  ++ NCY AL   GK+IV + V+P   + + + +     D+F+MN+    
Sbjct  17   LHSWSDEHCVKLLRNCYHALPDNGKVIVVDAVIPDAPEPSAQVKSTYQLDLFMMNL-NPD  75

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE+ + +L    GF + K     +  +++EFHK
Sbjct  76   GKERTEKEFAELAKEAGFFSTKVACCAYSFSLVEFHK  112



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L  S GF+ FK +   F   ++EF K
Sbjct  330  RTEKEFEALAKSAGFQGFKVFCSAFNTYIMEFLK  363



>ref|XP_009384362.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+DE C  ++ NC+ AL + GK+IV E +LP+  + T R +++   DI  M+ Y   
Sbjct  267  LHDWTDEHCAKLLKNCWKALPEKGKVIVMECILPVVPEATPRDQYIYQLDI-CMSTYNIG  325

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE+ ++ L +  GF  FKA  M     ++EF K
Sbjct  326  GKERTEQEFQALAMDAGFSGFKALPMFAGTCIMEFTK  362



>sp|O23760.1|COMT1_CLABR RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase; Flags: Precursor [Clarkia breweri]
 gb|AAB71141.1| caffeic acid O-methyltransferase [Clarkia breweri]
Length=370

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL + GK+IV E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  276  WSDEHCLKFLKNCYAALPEHGKVIVAECILPLSPDPSLATKGVIHIDA-IMLAHNPGGKE  334

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L +  GF+ FK     F   V+EF K
Sbjct  335  RTEKEFEALAIGAGFKGFKVACCAFNTYVMEFLK  368



>gb|AEW26218.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
Length=121

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  27   WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  85

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  86   RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  119



>ref|XP_009361271.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=365

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD+ C  I+ NCY AL   GK+I+ E +LP+  D +  T+ ++  D+ IM  Y    K 
Sbjct  271  WSDDHCLKILKNCYTALPDNGKVILAEGILPVAPDSSLATKVVVNLDV-IMLGYNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F +  +EF K
Sbjct  330  RTEKEFEALAKGSGFKGFRVICSAFHIYAIEFLK  363



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD+ C   + NCY AL   GK+I+ E +LP+  D +  T+ ++  D+ IM  Y    K 
Sbjct  271  WSDDHCLKFLKNCYTALPDNGKVILVESILPVAPDSSLATKVVVNLDV-IMLGYNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L +  GF+ F+     F +  +EF K
Sbjct  330  RTEKEFEALAMGSGFKGFRVICSAFHIYAIEFLK  363



>gb|KDO42391.1| hypothetical protein CISIN_1g048707mg [Citrus sinensis]
Length=114

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WS+E C  I+ NCY AL + GK+IV E +LP+  D +  ++ ++  D  IM  +    + 
Sbjct  20   WSEEACVKILKNCYEALPENGKVIVAECILPVLPDPSLASKQVIHIDC-IMLAHTTGGRE  78

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ ++ L  + GF+ FK     F   ++EF K P
Sbjct  79   MTEQDFKTLAKAAGFQGFKVVCSAFSTYIMEFLKKP  114



>ref|XP_010478733.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=352

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +W DE C  I++NCY +L   GK+IV + V+P    DT   R L   ++F+MNM    
Sbjct  255  LHSWDDEHCVKILSNCYQSLPSNGKVIVVDMVIPDLPGDTLLDRSLFQFELFMMNM-NPS  313

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T++ +  L    GF + +  +     +V+EFHK
Sbjct  314  GKERTKKEFETLARLAGFSSVQVPFTSLCFSVVEFHK  350



>gb|KDO43800.1| hypothetical protein CISIN_1g033647mg [Citrus sinensis]
Length=114

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WS+E C  I+ NCY AL + GK+IV + +LP+  D +  ++ ++  D F++  Y    + 
Sbjct  20   WSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFML-AYTIGGRE  78

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ ++ L  + GF+ FK     F   ++EF K P
Sbjct  79   MTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP  114



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  I+ NCY AL   G++I+CE +LP+  +     + +   D+ IM  +    K 
Sbjct  275  WSDEHCAKILENCYKALPNNGRVILCECILPVAPEPVPSAQGVFHLDM-IMLAHNPGGKE  333

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ Y+ L    GF  FKA Y      VLEF K
Sbjct  334  RTEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>gb|AGS49204.1| O-methyltransferase [Zea mays]
Length=364

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + R +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKARGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  I+ NC+ AL   GK+I+CE +LP+  +     + +   D+ IM  +    K 
Sbjct  275  WSDEHCAKILENCHKALPNNGKVILCECILPVAPEPIPSAQGVFHVDM-IMLAHNPGGKE  333

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ Y+ L    GF  FKA Y      VLEF K
Sbjct  334  RTEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>ref|XP_002963026.1| hypothetical protein SELMODRAFT_78541 [Selaginella moellendorffii]
 gb|EFJ36489.1| hypothetical protein SELMODRAFT_78541 [Selaginella moellendorffii]
Length=394

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD+ C  ++NNCY +L  GGK+I+ E + P   D +QR R  L  D+ +M  +  K + 
Sbjct  298  WSDDSCIKVLNNCYKSLKNGGKIIMVEFLAPDPGDHSQRARVALSYDLVMMAHFLGKER-  356

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             +E  +R L  + GF   +       +AV+E HK P
Sbjct  357  -SEREFRDLLRAAGFSQIRIALRVDCVAVVEAHKNP  391



>ref|XP_006413044.1| hypothetical protein EUTSA_v10027501mg [Eutrema salsugineum]
 gb|ESQ54497.1| hypothetical protein EUTSA_v10027501mg [Eutrema salsugineum]
Length=369

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++ NCY ALS  GK+IV E ++PI  D +  T+ ++  D  IM  + A  + 
Sbjct  275  WSDEHCLKLLKNCYEALSDNGKVIVVECLVPIAPDTSLLTKQVVHLDC-IMMAHTAGGRE  333

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TEE +  L   VGF+ F+     F   ++EF+K
Sbjct  334  RTEEEFESLARRVGFKGFQVICNVFGTYIMEFYK  367



>ref|XP_002869549.1| hypothetical protein ARALYDRAFT_354029 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45808.1| hypothetical protein ARALYDRAFT_354029 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++NNCY AL   GK+IV E ++P+  D +  T+ ++  D  IM  + A  + 
Sbjct  275  WSDEHCLKLLNNCYKALPDNGKVIVVECLVPVAPDSSLLTKQVVHLDC-IMMAHTAGGRE  333

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TEE +  L   VGF+ F+     F   ++EF+K
Sbjct  334  RTEEEFELLARRVGFKGFQVICNVFGTYIMEFYK  367



>ref|XP_009392797.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  I+ +C+ AL + GK+IV E VLP+  + T R + +   D+ IM  +   
Sbjct  267  LHDWSDEHCAKILKSCWEALPEKGKVIVVECVLPVVPEPTPRAQGVFHVDL-IMLAHNPG  325

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TEE +  L    GF  FKA Y+     V+EF K
Sbjct  326  GKERTEEEFHGLAKQAGFSGFKATYIFANAWVIEFTK  362



>gb|AEW26161.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26162.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26169.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26170.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26174.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26179.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26180.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26183.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26184.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26185.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26188.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26189.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26190.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26192.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26193.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26194.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26195.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26196.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26197.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26198.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26199.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26202.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26203.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26204.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26207.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26208.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26214.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26217.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26219.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26220.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26227.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26228.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26229.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26230.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26239.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26241.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26242.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26245.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26246.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
Length=224

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  130  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  188

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  189  RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AEW26176.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
Length=224

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  130  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  188

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  189  RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AEW26209.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
Length=224

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  130  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  188

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  189  RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AAC18863.1| caffeic acid 3-O-methyltransferase [Mesembryanthemum crystallinum]
Length=350

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C + + NCYAAL   GK+IVCE +LP+  + +   R +   D  IM  +    K 
Sbjct  256  WSDEHCLSFLKNCYAALPNHGKVIVCEYILPVAPETSHAARTVFHVDA-IMLAHNPGGKE  314

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L    GF  FK     +   V+EF K
Sbjct  315  RTEQEFQALAKGSGFEGFKVACSAYDTKVMEFLK  348



>ref|XP_002980303.1| hypothetical protein SELMODRAFT_112597 [Selaginella moellendorffii]
 gb|EFJ18563.1| hypothetical protein SELMODRAFT_112597 [Selaginella moellendorffii]
Length=394

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD+ C  ++NNCY +L  GGK+I+ E + P   D +QR R  L  D+ +M  +  K + 
Sbjct  298  WSDDACIKVLNNCYKSLKNGGKIIMVEFLAPDPGDHSQRARVALSYDLVMMAHFLGKER-  356

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             +E  +R L  + GF   +       +AV+E HK P
Sbjct  357  -SEREFRDLLRAAGFSQIRIALRVDCVAVVEAHKNP  391



>dbj|BAD14923.1| caffeic acid o-methyl transferase [Oryza sativa Japonica Group]
Length=268

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY AL + GK++V E VLP  +D T R + +   D+ IM  +   
Sbjct  173  LHDWSDEHCARLLKNCYDALPEHGKVVVVECVLPESSDATAREQGVFHVDM-IMLAHNPG  231

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L  + GF  FKA Y+      +EF K
Sbjct  232  GKERYEREFRELARAAGFTGFKATYIYANAWAIEFTK  268



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY ++ + GK+IV + VLP   D     R  L  D+ ++ +Y   
Sbjct  258  LHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDTGAGARVALSIDLLML-VYNPG  316

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T E + +L  + GF + K      F++V+EFHK
Sbjct  317  GKERTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY ++ + GK+IV + VLP   D     R  L  D+ ++ +Y   
Sbjct  258  LHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDTGAGARVALSIDLLML-VYNPG  316

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T E + +L  + GF + K      F++V+EFHK
Sbjct  317  GKERTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>gb|AFR39689.1| caffeate O-methyltransferase, partial [Populus alba]
 gb|AFR39691.1| caffeate O-methyltransferase, partial [Populus alba]
Length=95

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++ NCY AL + GK+I+ E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  1    WSDEHCLRLLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDA-IMLAHNPGGKE  59

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ F+     F   V+EF K
Sbjct  60   RTDKEFEGLARGAGFKGFEVMCCAFNTHVIEFRK  93



>ref|XP_010934981.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=240

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  I+ NCY AL   GK+I+CE +LP+  +     + +   D+ IM  +    K 
Sbjct  148  WSDEHCAKILENCYKALPNNGKVILCECILPVAPEPVPSAQSVFHLDM-IMLAHNPGGKE  206

Query  358  WTEEAYRQLGLSVGFRTFKAYY  293
             TE+ Y+ L    GF  FKA Y
Sbjct  207  RTEKQYQDLTKRAGFTGFKAQY  228



>gb|AFR39675.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39676.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39677.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39678.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39680.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39682.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39683.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39684.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39685.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39686.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39687.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
 gb|AFR39694.1| caffeate O-methyltransferase, partial [Populus fremontii]
 gb|AFR39696.1| caffeate O-methyltransferase, partial [Populus fremontii]
 gb|AFR39698.1| caffeate O-methyltransferase, partial [Populus fremontii]
Length=95

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  1    WSDEHCLRFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDA-IMLAHNPGGKE  59

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  60   RTEKEFEGLARGAGFKGFEVMCCAFNTYVIEFRK  93



>gb|AEW26163.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
Length=224

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  130  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  188

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  189  RTQKEFEDLXKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AFR39679.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
Length=95

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  1    WSDEHCLRFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDA-IMLAHNPGGKE  59

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  60   RTEKEFEGLARGAGFKGFEVMCSAFNTYVIEFRK  93



>ref|XP_009395003.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  I+NNC+ AL + GK+I  E VLP+  + + RT+ +   D+ IM  +   
Sbjct  313  LHDWSDESCAKILNNCWKALPENGKVIAVECVLPVVPEPSLRTQSVCHVDL-IMLAHNPG  371

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE  +++L    GF  FK  Y+      LEF K
Sbjct  372  GKERTEMEFQELAKQAGFSGFKPTYVYANTWALEFTK  408



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  I+ NC  AL + GK+IV E VLP+  + T R + +   D+ IM  +   
Sbjct  267  LHDWSDEHCTKILKNCCEALPEKGKVIVVECVLPVVPEPTPRAQGVFNIDL-IMLAHNPG  325

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE+ +  L    GF  FKA Y+     V+EF K
Sbjct  326  GKERTEKEFEGLAKEAGFSGFKASYIFANTWVMEFTK  362



>gb|AGS49196.1| O-methyltransferase [Zea mays]
Length=364

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYVNAWAIEFIK  364



>gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium]
Length=366

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  ++ ++  D  IM  +    K 
Sbjct  272  WSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPGGKE  330

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +R L  + GF+ F+     F   ++EF K
Sbjct  331  RTEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  ++ ++  D  IM  +    K 
Sbjct  272  WSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPGGKE  330

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +R L  + GF+ F+     F   ++EF K
Sbjct  331  RTEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>gb|AGS49217.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEHEFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49206.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTETTPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_009384375.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+DE+C  I+ NC+ AL + GK+IV E +LP+  +   R++ +   DI +M ++   
Sbjct  269  LHDWTDEQCARILKNCWKALPEEGKVIVVEYLLPVIPEPDSRSQGIFPLDIGMM-IHTGG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            R+  T+E +  +    GF  FKA Y+  +  V+EF K
Sbjct  328  RER-TQEEFEAMAKEAGFTGFKATYISLYSWVMEFTK  363



>gb|AGS49200.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24348.1| O-methyltransferase [Zea mays]
 gb|AAQ24350.1| O-methyltransferase [Zea mays]
 gb|AAQ24356.1| O-methyltransferase [Zea mays]
 gb|AAQ24363.1| O-methyltransferase [Zea mays]
 gb|AAQ24365.1| O-methyltransferase [Zea mays]
 gb|AAQ24366.1| O-methyltransferase [Zea mays]
 gb|AAQ24368.1| O-methyltransferase [Zea mays]
 gb|AAQ24370.1| O-methyltransferase [Zea mays]
Length=358

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24345.1| O-methyltransferase [Zea mays]
 gb|AAQ24354.1| O-methyltransferase [Zea mays]
Length=358

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|EAZ41571.1| hypothetical protein OsJ_26105 [Oryza sativa Japonica Group]
Length=361

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY AL + GK++V E VLP  +D T R + +   D+ IM  +   
Sbjct  266  LHDWSDEHCARLLKNCYDALPEHGKVVVVECVLPESSDATAREQGVFHVDM-IMLAHNPG  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L  + GF  FKA Y+      +EF K
Sbjct  325  GKERYEREFRELARAAGFTGFKATYIYANAWAIEFTK  361



>gb|AGS49195.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49216.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|EAZ05653.1| hypothetical protein OsI_27880 [Oryza sativa Indica Group]
Length=361

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY AL + GK++V E VLP  +D T R + +   D+ IM  +   
Sbjct  266  LHDWSDEHCARLLKNCYDALPEHGKVVVVECVLPESSDATAREQGVFHVDM-IMLAHNPG  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L  + GF  FKA Y+      +EF K
Sbjct  325  GKERYEREFRELARAAGFTGFKATYIYANAWAIEFTK  361



>gb|AAQ24351.1| O-methyltransferase [Zea mays]
 gb|AAQ24357.1| O-methyltransferase [Zea mays]
 gb|AAQ24359.1| O-methyltransferase [Zea mays]
Length=358

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AGS49205.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AAQ24342.1| O-methyltransferase [Zea mays]
Length=359

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24344.1| O-methyltransferase [Zea mays]
 gb|AAQ24358.1| O-methyltransferase [Zea mays]
 gb|AAQ24362.1| O-methyltransferase [Zea mays]
Length=359

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24361.1| O-methyltransferase [Zea mays]
Length=359

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24343.1| O-methyltransferase [Zea mays]
 gb|AAQ24353.1| O-methyltransferase [Zea mays]
 gb|AAQ24364.1| O-methyltransferase [Zea mays]
Length=359

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>ref|NP_001106047.1| catechol O-methyltransferase [Zea mays]
 gb|AAQ24340.1| O-methyltransferase [Zea mays]
 gb|AAQ24341.1| O-methyltransferase [Zea mays]
 gb|ABQ58826.1| flavonoid O-methyltransferase [Zea mays]
 gb|AFW61191.1| brown midrib3 [Zea mays]
 gb|AGS49212.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49215.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49209.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49207.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49191.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|NP_001061031.1| Os08g0157500 [Oryza sativa Japonica Group]
 sp|Q6ZD89.1|OMT1_ORYSJ RecName: Full=Flavone 3'-O-methyltransferase 1; Short=OsOMT1; 
AltName: Full=Quercetin 3'-O-methyltransferase 1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAC99512.1| putative Caffeic acid 3-O-methyltransferase [Oryza sativa Japonica 
Group]
 gb|ABB90678.1| O-methyltransferase [Oryza sativa Japonica Group]
 gb|ABF72191.1| flavone O-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF22945.1| Os08g0157500 [Oryza sativa Japonica Group]
 dbj|BAG89194.1| unnamed protein product [Oryza sativa Japonica Group]
Length=368

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY AL + GK++V E VLP  +D T R + +   D+ IM  +   
Sbjct  273  LHDWSDEHCARLLKNCYDALPEHGKVVVVECVLPESSDATAREQGVFHVDM-IMLAHNPG  331

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L  + GF  FKA Y+      +EF K
Sbjct  332  GKERYEREFRELARAAGFTGFKATYIYANAWAIEFTK  368



>gb|AGS49213.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49199.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49190.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AAQ24337.1| O-methyltransferase [Zea mays]
 gb|AAQ24349.1| O-methyltransferase [Zea mays]
 gb|AAQ24352.1| O-methyltransferase [Zea mays]
 gb|AAQ24367.1| O-methyltransferase [Zea mays]
 gb|AAQ24369.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGF25396.1| caffeic acid 3-O-methyltransferase [Zea nicaraguensis]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q06509.1|COMT1_MAIZE RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Zea mays]
 gb|AAB03364.1| O-methyltransferase [Zea mays]
 gb|AAQ24346.1| O-methyltransferase [Zea mays]
 gb|AAQ24347.1| O-methyltransferase [Zea mays]
 gb|AGS49180.1| O-methyltransferase [Zea mays]
 gb|AGS49218.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49189.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49187.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AAQ24338.1| O-methyltransferase [Zea mays]
 gb|AAQ24360.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49185.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  I+ NCY AL   GK+I+ E +LP+  + T   + +   D+ IM  +    K 
Sbjct  275  WSDEHCAKILENCYKALPDNGKVILVECILPVAPEPTPSAQGVFHVDM-IMLAHNPGGKE  333

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ Y+ L    GF  FKA Y      ++EF K
Sbjct  334  RTEKEYQALAKGAGFTGFKAQYCFSTAWIIEFTK  367



>gb|AAA80579.1| 3' flavonoid O-methyltransferase [Chrysosplenium americanum]
Length=343

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            W++E+C  ++ NCY AL   GK+IV E +LP+  D +  ++  + +D+ I+    +  K 
Sbjct  247  WNEEQCLKLLKNCYDALPNNGKVIVAEYILPVVPDSSLASKLSVTADVMIVTQ-NSGGKE  305

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L  + GF+ F+ +   F + ++EF K
Sbjct  306  RTEKEFEALAKAAGFQGFQVFCNAFTIYIIEFSK  339



>ref|XP_006659136.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=361

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY AL   GK+IV E VLP   D T R + +   D+ IM  +   
Sbjct  266  LHDWSDEHCARLLKNCYDALPPHGKVIVVECVLPENPDATPRAQGVFHVDM-IMLAHNPG  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R L ++ GF  FKA Y+      +EF K
Sbjct  325  GKERYEREFRDLAVAAGFTGFKATYIYANSWTIEFTK  361



>ref|NP_174579.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAF31281.1|AC006424_10 CDS [Arabidopsis thaliana]
 gb|AAL58927.1|AF462839_1 At1g33030/F9L11_18 [Arabidopsis thaliana]
 gb|AAW80884.1| At1g33030 [Arabidopsis thaliana]
 gb|AEE31551.1| O-methyltransferase-like protein [Arabidopsis thaliana]
Length=352

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +W D+ C  I++NCY +L   GK+IV + V+P    DT   R L   ++F+MNM    
Sbjct  255  LHSWDDDHCVKILSNCYQSLPSNGKVIVVDMVIPEFPGDTLLDRSLFQFELFMMNM-NPS  313

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T++ +  L    GF   +  +     +VLEFHK
Sbjct  314  GKERTKKEFEILARLAGFSNVQVPFTSLCFSVLEFHK  350



>gb|AGS49197.1| O-methyltransferase [Zea mays]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRKLAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010461123.1| PREDICTED: quercetin 3-O-methyltransferase 1 [Camelina sativa]
Length=362

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +W +E C  I+ NCY +L   GK+IV + V+P    DT   R L   ++F+MNM    
Sbjct  265  LHSWDNEHCLKILTNCYQSLPSNGKVIVVDMVIPDLPGDTLLDRSLFQFELFMMNM-NPS  323

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T++ +  L    GF + +  +     +V+EFHK
Sbjct  324  GKERTKKEFETLARLAGFSSVQVPFTSLCFSVVEFHK  360



>ref|XP_010089915.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB38591.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=149

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+IV E +LP   D +  T+ ++  D+ IM  +    K 
Sbjct  54   WSDEHCLKFLKNCYDALPENGKVIVAECILPDAPDSSLATKGVVHIDV-IMLAHNPGGKE  112

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ +  L    GF+ F+     F   V+EF K P
Sbjct  113  RTEKEFEALAKGSGFQGFRVLCDAFNTYVMEFLKKP  148



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  330  RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  363



>ref|XP_009386324.1| PREDICTED: flavone O-methyltransferase 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=361

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE+C  I+ NC+ AL++ GK+IV E +LPI  + T + + +   D++++ +    
Sbjct  266  LHDWSDEDCVKILKNCWKALTENGKVIVVECILPIVPEPTAKAQAVFQLDLYLIVLTNGG  325

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            R+  +EE ++ L    GF  FK  ++     V+EF K
Sbjct  326  RER-SEEEFKDLAREAGFPGFKDAHVFADTWVMEFTK  361



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  330  RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  363



>gb|AFR39674.1| caffeate O-methyltransferase, partial [Populus trichocarpa]
Length=95

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+I+ E +LP+  D +  T+ +   D  IM  +    K 
Sbjct  1    WSDEHCLRFLKNCYDALPENGKVILVECILPVAPDTSLATKGVXHVDA-IMLAHNPGGKE  59

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  60   RTEKEFEGLARGAGFKGFEVMCCAFNTYVIEFRK  93



>gb|KDP32880.1| hypothetical protein JCGZ_12172 [Jatropha curcas]
Length=113

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  ++ NCY AL   GK+IV E +LP+  ++   +  +   D+F+       
Sbjct  17   LHGWSDEYCLKLLKNCYEALPSKGKVIVAESILPLAPENAVSSHIVFEQDLFMFAQTPGG  76

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            ++  T++ Y  L +  GF + +     +   V+EFHK
Sbjct  77   KER-TQKDYETLAIKSGFSSCEVVCCAYNSWVMEFHK  112



>gb|AIY22648.1| caffeic acid 3-O-methyl transferase, partial [Saccharum arundinaceum]
Length=224

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+   + + +   D+ ++      
Sbjct  129  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAVPKAQGVFHVDMIMLAHNPGG  188

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
            R+ +  E +R L    GF  FKA Y+
Sbjct  189  RERYERE-FRDLAKGAGFSGFKATYI  213



>ref|XP_002893750.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70009.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +W DE C  I++NCY +L   GK+IV + V+P    DT   R L   ++F+MNM    
Sbjct  255  LHSWDDEHCVKILSNCYQSLPSNGKVIVVDMVIPEFPGDTLLDRSLFQFELFMMNM-NPS  313

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T++ +  L    GF   +  +     +V+EFHK
Sbjct  314  GKERTKKEFEILARLSGFSNVQVPFTSLCFSVVEFHK  350



>gb|KHN19569.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=232

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD+ C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  138  WSDDHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHGDV-IMLAHHPGGKE  196

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TEE +  L    GF+ F      F   V+EF K
Sbjct  197  RTEEEFEALAKGSGFQGFLVLCCAFNTYVMEFLK  230



>ref|XP_009386325.1| PREDICTED: flavone O-methyltransferase 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=355

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE+C  I+ NC+ AL++ GK+IV E +LPI  + T + + +   D++++ +    
Sbjct  260  LHDWSDEDCVKILKNCWKALTENGKVIVVECILPIVPEPTAKAQAVFQLDLYLIVLTNGG  319

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            R+  +EE ++ L    GF  FK  ++     V+EF K
Sbjct  320  RER-SEEEFKDLAREAGFPGFKDAHVFADTWVMEFTK  355



>ref|XP_010696333.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L   +DE+C  ++ NCY AL  GGKL++ E V+P   D +  ++ +   D+++ NM  A 
Sbjct  126  LKNLNDEQCLNVLKNCYMALPNGGKLMIVELVIPDIPDSSINSQSVFQFDVYLTNM-NAG  184

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T   ++ L  + GF   +A    + + +LEFHK
Sbjct  185  GKERTVVEFQTLAKTAGFSGIQAMVRAYNMTLLEFHK  221



>gb|ADR31599.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31607.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=99

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD  C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  6    WSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKE  64

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  65   RTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  98



>ref|XP_010660322.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
 emb|CBI34618.3| unnamed protein product [Vitis vinifera]
Length=363

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +WSDE C  ++ NCY AL   GK+IV + V+P   + + + +     D+F+MN+    
Sbjct  266  LHSWSDEHCVKLLRNCYHALPDNGKVIVVDAVIPDAPEPSAQVKSTYQLDLFMMNL-NPD  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE+ + +L    GF + K     +  +++EFHK
Sbjct  325  GKERTEKEFAELAKEAGFFSTKVAGCAYSFSLVEFHK  361



>gb|AGS49211.1| O-methyltransferase [Zea mays]
Length=364

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYY  293
             K   E  +R+L    GF  FKA Y
Sbjct  328  GKERYEREFRELAKGAGFSGFKATY  352



>ref|XP_010520935.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=356

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            W+DE+C  ++ NCY AL   GK+IV E +LP+  D +  T+  + +D+ ++ +   K + 
Sbjct  265  WNDEQCLKLLKNCYKALPDNGKVIVAEWILPLVRDSSLSTKLAIHTDVVMLALNPGKER-  323

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK     F   ++EF K
Sbjct  324  -TKDEFEALARGAGFQGFKVICNAFGTCIMEFLK  356



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCVKFLKNCYDALPENGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ +  L    GF+ F+     F   ++EF K P
Sbjct  330  RTEKEFEALAKGAGFQGFRVCCSAFNSYIMEFLKKP  365



>ref|XP_006305218.1| hypothetical protein CARUB_v10009584mg [Capsella rubella]
 gb|EOA38116.1| hypothetical protein CARUB_v10009584mg [Capsella rubella]
Length=352

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (51%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W DE C  I+ NCY +L   GK+IV + V+P    D+   R L   ++F+MNM    
Sbjct  255  LHGWDDEHCVKILTNCYQSLPSNGKVIVVDMVIPDLPGDSLLDRSLFQFELFMMNM-NPS  313

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T++ +  L    GF   +  +     +V+EFHK
Sbjct  314  GKERTKKEFEVLARLAGFSNVQVPFTSLCFSVVEFHK  350



>gb|AGS49194.1| O-methyltransferase [Zea mays]
Length=364

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ ++      
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDMIMLAHNPGG  328

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
            ++ +  E +R+L    GF  FKA Y+
Sbjct  329  KERYGRE-FRELAKGAGFSGFKATYI  353



>sp|Q43609.1|COMT1_PRUDU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Prunus dulcis]
 emb|CAA58218.1| caffeic O-methyltransferase [Prunus dulcis]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L    GF+ F      F   V+EF K
Sbjct  330  RTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>gb|ABI54120.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+IV E +LP+  D +  T+ ++ SD  IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F    +EF K
Sbjct  330  RTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>ref|XP_011003285.1| PREDICTED: caffeic acid 3-O-methyltransferase 3 [Populus euphratica]
Length=364

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  270  WSDEHCLRFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDV-IMMAHNPGGKE  328

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  329  RTEKEFEGLARGAGFKGFEVMCCAFNTYVIEFRK  362



>gb|AAQ24355.1| O-methyltransferase [Zea mays]
Length=358

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L    GF+ F      F   V+EF K
Sbjct  330  RTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>ref|XP_007218167.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19366.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L    GF+ F      F   V+EF K
Sbjct  330  RTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>ref|XP_007218166.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19365.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ ++ L    GF+ F      F   V+EF K
Sbjct  330  RTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>gb|AGS49181.1| O-methyltransferase [Zea mays]
Length=364

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDLHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYA+L   GK+IVCE +LP+  +     R +   D  IM  +    K 
Sbjct  268  WSDEHCLKFLKNCYASLPDHGKVIVCEYILPVAPETNHAARTVFHVDA-IMLAHNPGGKE  326

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF  F+     +   V+EF+K
Sbjct  327  RTEQEFEGLAKGAGFEGFRVACSAYDTKVIEFYK  360



>ref|XP_008376828.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD+ C   + NCY AL   GK+I+ E +LP+  D +  T+ ++  D+ IM  Y    K 
Sbjct  271  WSDDHCLKFLKNCYTALPDNGKVILAECILPVAPDSSLATQVVVNLDV-IMLGYNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F +  +EF K
Sbjct  330  RTEKEFEALAKGSGFKGFRVICSAFHIYAIEFLK  363



>gb|AAQ24339.1| O-methyltransferase [Zea mays]
Length=364

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala]
 gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala]
Length=365

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+IV E +LP   D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCVKFLKNCYDALPENGKVIVAECILPASPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ +  L  + GF+ F+     F   ++EF K P
Sbjct  330  RTEKEFEALAKAAGFQGFRVCCSAFNTYIMEFLKKP  365



>ref|XP_009398124.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=361

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 2/97 (2%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+DE+C  ++ NC+ AL + GKLIV E VLP+  +     R     DI +M     K
Sbjct  267  LHDWNDEQCSKLLKNCWKALPEKGKLIVVEYVLPLLPEPNLNLRGAFHLDINMMVFLGGK  326

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             +  T++ +  L L  GF  F + Y+  +  V+EF K
Sbjct  327  ER--TQKEFEALALEAGFSGFTSTYISMYTWVIEFKK  361



>ref|XP_008343815.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=149

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+IV E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  55   WSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHID-EIMLAHNPGGKE  113

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F    +EF K
Sbjct  114  RTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  147



>gb|EMT30204.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=339

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+DE C  +++NCY AL   GK+++ E +LP++ D+T   +    +D+ ++      
Sbjct  244  LHDWNDEHCTTLLSNCYDALPAHGKVVIVEYILPVKPDETATAQRSFEADMIMLTHTPGG  303

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            ++ +  E Y +L  S GF + KA Y+   + V+E +K
Sbjct  304  KERYLRE-YEELARSAGFASVKATYVYSNIWVIELNK  339



>gb|AGS49202.1| O-methyltransferase [Zea mays]
Length=364

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFRATYIYANAWAIEFIK  364



>ref|XP_009384387.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W+DE+C  I+ NC+ AL + GK+IV E +LP+  +   R++ +   DI +M ++   
Sbjct  270  LHDWTDEQCARILKNCWKALPEEGKVIVVEYLLPVIPEPDSRSQGVFFLDIGMM-IHTGG  328

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            R+  T+E +  +    GF  FKA Y+  +  V+EF K
Sbjct  329  RER-TQEEFEAMAKEAGFTGFKATYISLYSWVMEFTK  364



>ref|XP_006420931.1| hypothetical protein CICLE_v10005230mg [Citrus clementina]
 gb|ESR34171.1| hypothetical protein CICLE_v10005230mg [Citrus clementina]
Length=363

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WS+E C  I+ NCY AL + GK+IV + +LP+  D +  ++ ++  D F++  Y    + 
Sbjct  269  WSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFML-AYTIGGRE  327

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ ++ L  + GF+ FK     F   ++EF K P
Sbjct  328  MTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP  363



>emb|CDY19037.1| BnaC01g20310D [Brassica napus]
Length=369

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++ NCY AL   GK+I  E ++PI  D +  T+ ++  D  IM  + A  + 
Sbjct  275  WSDEHCLKLLKNCYEALPDDGKVIAVECLVPIAPDSSLLTKQIVHLDC-IMMAHTAGGRE  333

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TEE +  L   VGF+ F+     F   ++EF+K
Sbjct  334  RTEEEFESLARRVGFKGFQVICSVFGTYIMEFYK  367



>ref|XP_006386661.1| hypothetical protein POPTR_0002s18140g [Populus trichocarpa]
 gb|ERP64458.1| hypothetical protein POPTR_0002s18140g [Populus trichocarpa]
Length=113

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 4/99 (4%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD+ C  ++ NCY A+ + GK+IV E VLPI    +   + +   D+ +M      
Sbjct  17   LHNWSDDHCLKLLKNCYKAIPEDGKVIVMESVLPITAKTSPAAKAISQLDVLMMMSQNPG  76

Query  367  RKHWTEEAYRQLGLSVGFR--TFKAYYMDFFLAVLEFHK  257
             K  TE+ +  L  + GFR   F+ +  +F+  V+EF K
Sbjct  77   GKERTEDEFMALATAAGFRGIKFETFVCNFW--VMEFFK  113



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD  C   + NCY AL + GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  265  WSDHHCLKFLKNCYDALPEHGKVIVAECILPVAPDASLATKGVIHIDL-IMLAHNPGGKE  323

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ ++ L  + GF  FK +   F   V+EF K P
Sbjct  324  RTEKEFQALSKAAGFLGFKVHCCAFNTYVMEFLKTP  359



>gb|AAZ32409.1| S-methyltransferase [Catharanthus roseus]
Length=362

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 50/97 (52%), Gaps = 0/97 (0%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  W DE C  ++ NCY AL + GK+I  + +LP+  D++  T+ +   D+F + +Y   
Sbjct  266  LHDWDDEHCLKLLKNCYKALPENGKVIAVDAILPMNPDNSSSTKHISQVDLFTLVLYHPG  325

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE  +  L    GF   +   +   L V+EF+K
Sbjct  326  GKERTENEFLALVAEAGFGGIRKVCVCCDLWVMEFYK  362



>gb|AGS49219.1| O-methyltransferase [Zea mays]
Length=364

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSD-IFIMNMYRA  371
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D I + +    
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDMIMLAHNPGG  328

Query  370  KRKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            K +H  E  +R+L    GF  FKA Y+      +EF K
Sbjct  329  KERHGRE--FRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_004156527.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=359

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD  C   + NCY AL + GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  265  WSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPGGKE  323

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ ++ L  + GF  FK +   F   V+EF K P
Sbjct  324  RTEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLKTP  359



>ref|XP_006477839.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=363

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WS+E C  I+ NCY AL + GK+IV E +LP+  D +  ++ ++  D  IM  +    + 
Sbjct  269  WSEEACVKILKNCYEALPENGKVIVAECILPVLPDPSLASKQVIHIDC-IMLAHTTGGRE  327

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ ++ L  + GF+ FK     F   ++EF K P
Sbjct  328  MTEQDFKTLAKAAGFQGFKVVCSAFSTYIMEFLKKP  363



>ref|XP_004137204.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 gb|KGN53621.1| hypothetical protein Csa_4G091880 [Cucumis sativus]
Length=359

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD  C   + NCY AL + GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  265  WSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPGGKE  323

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ ++ L  + GF  FK +   F   V+EF K P
Sbjct  324  RTEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLKTP  359



>sp|Q41086.1|COMT2_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 2; Short=CAOMT-2; 
Short=COMT-2; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 2 [Populus tremuloides]
 gb|AAB68049.1| caffeic acid O-methyltransferase [Populus tremuloides]
Length=364

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  270  WSDEHCLTFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDV-IMLAHNPGGKE  328

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T+  +  L    GF+ F+     F   V+EF K
Sbjct  329  RTDREFESLARGAGFKGFEVMCCAFNTHVIEFRK  362



>gb|ADR31597.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=167

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD  C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  74   WSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKE  132

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  133  RTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  166



>gb|AGS49198.1| O-methyltransferase [Zea mays]
Length=364

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVDECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSRFKATYIYANAWAIEFIK  364



>gb|ADX98508.1| caffeic acid 3-O-methyltransferase [Panicum virgatum]
Length=361

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 49/97 (51%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C AI+ NCY AL  GGK+I  E +LP+  + T + + +   D+ IM  +   
Sbjct  266  LHDWSDAHCAAILKNCYDALPAGGKVIAVECILPVNPEATPKAQGVFHVDM-IMLAHNPG  324

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  + +L    GF  FKA Y+      +EF K
Sbjct  325  GKERYEREFEELAKGAGFTGFKATYIYANAWAIEFTK  361



>gb|EPS64988.1| hypothetical protein M569_09791, partial [Genlisea aurea]
Length=350

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE+C  I+  C  A+ + GK++V E +LP   D++  TR ++  D  IM      
Sbjct  254  LHDWSDEDCNRILKKCCEAIPESGKVMVAEYILPNTPDNSSATRNVVNMDA-IMLARSPS  312

Query  367  RKHWTEEAYRQLGLSVGFRTFK  302
             K  TEE +R LGL+ GF+ FK
Sbjct  313  GKERTEEEFRTLGLASGFKHFK  334



>gb|ABK26959.1| unknown [Picea sitchensis]
Length=118

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD++C  ++ NC+ AL + GK++V + +LP+ T+ +   R     D+ +M  Y   
Sbjct  22   LHDWSDDDCAKVLKNCHKALPEKGKVVVVDAILPMATETSPYARHAFHLDLLMM-AYAPG  80

Query  367  RKHWTEEAYRQLGLSVGF  314
             K  TE+ +R+LG + GF
Sbjct  81   GKERTEQEFRELGHAAGF  98



>ref|XP_011070409.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
 ref|XP_011070410.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=364

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +W DE C  I+ NCYAAL   GK++V E V+P   + T   R  L  D+ +MNM    
Sbjct  269  LHSWDDEHCVRILKNCYAALPDHGKVMVVELVVPESPESTVDVRSKLQFDLILMNM-NPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  TE  ++ L  + GF   +     +  +++EF+K
Sbjct  328  GKERTEREFKTLAEAAGFSNIEVKCSVYSFSLMEFYK  364



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   ++EF K
Sbjct  330  RTEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLK  363



>gb|AGS49210.1| O-methyltransferase [Zea mays]
Length=364

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +   D+ ++      
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDMTMLAHNPGG  328

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            ++ +  E +R+L    GF  FKA Y+      +EF K
Sbjct  329  KERYERE-FRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_009387952.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Musa 
acuminata subsp. malaccensis]
Length=231

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSDE C  I+ NC+ AL Q GK+IV E VLP   + T   + +   D+ +M +Y   
Sbjct  142  LHDWSDEHCMKILKNCWKALPQHGKIIVVEHVLPAVPEPTANAQAVFQLDLAMM-VYCVG  200

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K  TE+ ++ L    GF  FKA ++
Sbjct  201  GKERTEKEFKALATEAGFPGFKASHV  226



>prf||2119166A caffeic acid O-methyltransferase
Length=365

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY A+   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCIKFLKNCYDAVPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK*P  251
             TE+ +  L  + GF+ F+     F   ++EF K P
Sbjct  330  RTEKEFEALAKAAGFQGFRVVCCAFNTYIMEFLKKP  365



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  330  RTEKEFEALAKGSGFQGFRVLCCAFNTYVMEFLK  363



>gb|AGS49183.1| O-methyltransferase [Zea mays]
Length=364

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+ T + + +    + IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVF-HVVMIMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYM  290
             K   E  +R+L    GF  FKA Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  330  RTEKEFEALAKGAGFQGFQVLCCAFNSYVMEFLK  363



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  330  RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFFK  363



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+IV E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F +  +EF K
Sbjct  330  RTEKEFEALAKESGFQGFRVVCSAFNIYAIEFLK  363



>gb|AGS49184.1| O-methyltransferase [Zea mays]
Length=364

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E  LP+ T+ T + + +   D+ IM  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECALPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AEI54336.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Glycine 
max]
Length=365

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLTHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  330  RTEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>gb|AFO69477.1| caffeic acid O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 2/98 (2%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQ-GGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRA  371
            L  WSD  C  ++ NCY AL + GGK+IV E VLP+ TD   + + +   D+ ++     
Sbjct  266  LHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVSTDAVPKAQGVFHVDMIMLAHNPG  325

Query  370  KRKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             R+ +  E +R L  + GF  FKA Y+      +EF K
Sbjct  326  GRERYERE-FRDLAKAAGFSGFKATYIYANAWAIEFIK  362



>ref|XP_004972800.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=360

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 49/97 (51%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  I+ NCY AL   GK+I+ E VLP+  + T + + +   D+ IM  +   
Sbjct  265  LHDWSDAHCATILKNCYDALPANGKVIIVECVLPVNPEATPKAQGVFHVDM-IMLAHNPG  323

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K   E  +R+L    GF  FKA Y+      +EF K
Sbjct  324  GKERYEREFRELAKGAGFTGFKATYIYANAWAIEFTK  360



>gb|ADI24332.1| caffeic acid 3-O-methyltransferase [Miscanthus sinensis]
Length=362

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L  WSD  C  ++ NCY AL + GK+IV E VLP+ T+   + + +   D+ ++      
Sbjct  267  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAVPKAQGVFHVDMIMLAHNPGG  326

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
            R+ +  E +R L    GF  FKA Y+      +EF K
Sbjct  327  RERYERE-FRDLAKGAGFSGFKATYIYANAWAIEFIK  362



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  330  RTEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>gb|KFK45045.1| hypothetical protein AALP_AA1G337000 [Arabis alpina]
Length=359

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAK  368
            L +W DE C  I+ NCY +L   GK+IV + V+P    DT   R L   ++F+MNM    
Sbjct  262  LHSWDDEHCVKILRNCYESLPSNGKVIVIDMVIPDFPQDTLLDRSLFQFELFMMNM-NPS  320

Query  367  RKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             K  T++ +  L    GF + +  +     + +EFHK
Sbjct  321  GKERTKKEFEILAHLSGFSSVQVSFTSLCFSAIEFHK  357



>gb|AFR39697.1| caffeate O-methyltransferase, partial [Populus fremontii]
 gb|AFR39700.1| caffeate O-methyltransferase, partial [Populus fremontii]
 gb|AFR39702.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39703.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39704.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39705.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39706.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39707.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39708.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39709.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39710.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39711.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39712.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39713.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39714.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39715.1| caffeate O-methyltransferase, partial [Populus nigra]
 gb|AFR39716.1| caffeate O-methyltransferase, partial [Populus nigra]
Length=95

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  1    WSDEHCLRFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDA-IMLAHNPGGKE  59

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T + +  L    GF+ F+     F   V+EF K
Sbjct  60   RTGKEFEGLARGAGFKGFEVMCSAFNTYVIEFRK  93



>ref|XP_003528001.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=366

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDFSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+ +   F   V+EF K
Sbjct  330  RTEKEFEALAKGSGFQGFRVHCCAFNTYVMEFLK  363



>gb|ADR31603.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=203

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSD  C   + NCY AL + GK+I+ E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  110  WSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKE  168

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  169  RTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  202



>gb|AID68566.1| caffeic O-methyltransferase [Punica granatum]
Length=370

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCYAAL   GK+IV E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  276  WSDEHCLKFLKNCYAALPDHGKVIVAECILPLSPDPSLATKGVIHIDC-IMLAHNPGGKE  334

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF  F+     F   V+EF K
Sbjct  335  RTEKEFEALAKGAGFEGFRVACCAFNTYVMEFLK  368



>ref|XP_008380838.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            W+DE C   + NCYAAL   GK+IV E +LP+  D +  T+ ++ SD  IM  +    K 
Sbjct  271  WTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F    +EF K
Sbjct  330  RTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|ABI54118.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            W+DE C   + NCYAAL   GK+IV E +LP+  D +  T+ ++ SD  IM  +    K 
Sbjct  271  WTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F    +EF K
Sbjct  330  RTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL + GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYDALPENGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   ++EF K
Sbjct  330  RTEKEFEALAKGSGFQGFRVLCSAFNSYIMEFLK  363



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D  IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             T++ +  L    GF+ FK +   F   ++EF K
Sbjct  330  RTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  363



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   ++EF K
Sbjct  330  RTEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C   + NCY AL   GK+IV E +LP+  D +  T+ ++  D+ IM  +    K 
Sbjct  271  WSDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   ++EF K
Sbjct  330  RTEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>ref|XP_009361274.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=367

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = -3

Query  538  WSDEECKAIMNNCYAALSQGGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRAKRKH  359
            WSDE C  ++ NCYAAL   GK+I+ E ++P+  D +  T+     D+ IM       K 
Sbjct  271  WSDEHCLKLLKNCYAALPDNGKVILVEIIIPVSPDSSLATKLANHVDV-IMLANNPGGKE  329

Query  358  WTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             TE+ +  L    GF+ F+     F   V+EF K
Sbjct  330  RTEDEFEALAKGSGFQGFRVMSSAFDGNVIEFLK  363



>pdb|4PGH|A Chain A, Caffeic Acid O-methyltransferase From Sorghum Bicolor
 pdb|4PGH|B Chain B, Caffeic Acid O-methyltransferase From Sorghum Bicolor
 pdb|4PGH|C Chain C, Caffeic Acid O-methyltransferase From Sorghum Bicolor
 pdb|4PGH|D Chain D, Caffeic Acid O-methyltransferase From Sorghum Bicolor
Length=358

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 2/98 (2%)
 Frame = -3

Query  547  LTAWSDEECKAIMNNCYAALSQ-GGKLIVCEPVLPIQTDDTQRTRFLLGSDIFIMNMYRA  371
            L  WSD  C  ++ NCY AL + GGK+IV E VLP+ TD   + + +   D+ ++     
Sbjct  262  LHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPG  321

Query  370  KRKHWTEEAYRQLGLSVGFRTFKAYYMDFFLAVLEFHK  257
             R+ +  E +R L  + GF  FKA Y+      +EF K
Sbjct  322  GRERYERE-FRDLAKAAGFSGFKATYIYANAWAIEFIK  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720