BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050E08

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    195   8e-56   Nicotiana tomentosiformis
ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...    195   8e-56   Nicotiana tomentosiformis
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    195   8e-56   Nicotiana sylvestris
ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    195   1e-55   Solanum lycopersicum
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    193   4e-55   Solanum tuberosum [potatoes]
ref|XP_002265238.2|  PREDICTED: probable tyrosine--tRNA ligase, m...    188   2e-53   Vitis vinifera
emb|CDP19091.1|  unnamed protein product                                187   6e-53   Coffea canephora [robusta coffee]
gb|KDP41896.1|  hypothetical protein JCGZ_26914                         186   3e-52   Jatropha curcas
ref|XP_010110726.1|  Tyrosine--tRNA ligase                              184   9e-52   Morus notabilis
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                  182   6e-51   
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    181   1e-50   Fragaria vesca subsp. vesca
ref|XP_007022036.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    181   1e-50   
ref|XP_006375482.1|  hypothetical protein POPTR_0014s13650g             176   4e-50   
gb|KCW55733.1|  hypothetical protein EUGRSUZ_I01565                     179   4e-50   Eucalyptus grandis [rose gum]
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    179   6e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004146892.1|  PREDICTED: tyrosine--tRNA ligase-like              179   7e-50   Cucumis sativus [cucumbers]
ref|XP_010028900.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    179   7e-50   Eucalyptus grandis [rose gum]
ref|XP_008453844.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    178   1e-49   
ref|XP_004166614.1|  PREDICTED: tyrosine--tRNA ligase-like              178   1e-49   
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg             177   2e-49   Prunus persica
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    176   5e-49   Prunus mume [ume]
gb|KEH32330.1|  tyrosyl-tRNA synthetase                                 176   5e-49   Medicago truncatula
ref|XP_004500343.1|  PREDICTED: tyrosine--tRNA ligase-like              176   6e-49   Cicer arietinum [garbanzo]
gb|KHN08832.1|  Tyrosine--tRNA ligase                                   176   6e-49   Glycine soja [wild soybean]
ref|XP_003544330.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    176   7e-49   Glycine max [soybeans]
ref|XP_010927782.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    177   7e-49   Elaeis guineensis
ref|XP_006645923.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    176   9e-49   
gb|EMT07165.1|  Tyrosyl-tRNA synthetase                                 176   1e-48   
ref|XP_011033705.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    176   1e-48   Populus euphratica
dbj|BAK00149.1|  predicted protein                                      176   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    175   2e-48   
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    175   2e-48   
gb|EMS54027.1|  Tyrosyl-tRNA synthetase                                 177   2e-48   Triticum urartu
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   4e-48   Citrus sinensis [apfelsine]
ref|XP_006446866.1|  hypothetical protein CICLE_v10015023mg             174   4e-48   Citrus clementina [clementine]
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   4e-48   Fragaria vesca subsp. vesca
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   5e-48   Pyrus x bretschneideri [bai li]
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                   174   5e-48   Citrus sinensis [apfelsine]
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   6e-48   Nelumbo nucifera [Indian lotus]
ref|XP_003574045.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   7e-48   Brachypodium distachyon [annual false brome]
gb|KEH34424.1|  tyrosyl-tRNA synthetase                                 173   8e-48   Medicago truncatula
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    173   8e-48   
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    173   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    173   1e-47   Pyrus x bretschneideri [bai li]
gb|KHN40972.1|  Tyrosine--tRNA ligase                                   168   1e-47   Glycine soja [wild soybean]
ref|NP_001043131.1|  Os01g0500900                                       173   1e-47   
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    172   2e-47   
ref|XP_003519285.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    172   2e-47   Glycine max [soybeans]
gb|KJB12925.1|  hypothetical protein B456_002G045400                    172   3e-47   Gossypium raimondii
ref|NP_001141566.1|  hypothetical protein                               172   3e-47   Zea mays [maize]
gb|EAZ12037.1|  hypothetical protein OsJ_01916                          172   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007022035.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    171   5e-47   
ref|XP_007022034.1|  Tyrosyl-tRNA synthetase isoform 1                  171   8e-47   
ref|XP_002447960.1|  hypothetical protein SORBIDRAFT_06g018870          171   9e-47   
ref|XP_008801775.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    171   1e-46   Phoenix dactylifera
ref|XP_004982893.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    170   1e-46   Setaria italica
ref|XP_011071261.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    170   1e-46   
gb|EYU42284.1|  hypothetical protein MIMGU_mgv1a005712mg                168   5e-46   Erythranthe guttata [common monkey flower]
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    169   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783116.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    168   1e-45   Phoenix dactylifera
emb|CAN64191.1|  hypothetical protein VITISV_016956                     170   2e-45   Vitis vinifera
gb|EYU24457.1|  hypothetical protein MIMGU_mgv1a005745mg                166   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    166   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    166   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    166   6e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007142062.1|  hypothetical protein PHAVU_008G249300g             165   6e-45   Phaseolus vulgaris [French bean]
ref|XP_002884331.1|  tRNA synthetase class I family protein             166   8e-45   Arabidopsis lyrata subsp. lyrata
gb|EPS58486.1|  hypothetical protein M569_16327                         164   9e-45   Genlisea aurea
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg             163   8e-44   
ref|NP_186915.1|  tyrosyl-tRNA synthetase                               162   9e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   2e-43   Brassica rapa
emb|CDX74240.1|  BnaA03g28070D                                          162   2e-43   
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   2e-43   Brassica rapa
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg             161   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    160   5e-43   Brassica rapa
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    160   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_006826574.1|  hypothetical protein AMTR_s00138p00020780          149   8e-39   Amborella trichopoda
ref|XP_002992920.1|  hypothetical protein SELMODRAFT_136175             141   4e-36   
ref|XP_002980036.1|  hypothetical protein SELMODRAFT_111886             141   4e-36   Selaginella moellendorffii
emb|CBI22389.3|  unnamed protein product                                138   3e-35   Vitis vinifera
ref|XP_005848281.1|  hypothetical protein CHLNCDRAFT_48743              133   3e-33   Chlorella variabilis
ref|XP_001699082.1|  hypothetical protein CHLREDRAFT_139405             130   3e-32   Chlamydomonas reinhardtii
gb|KIZ02509.1|  tyrosyl-tRNA synthetase                                 124   6e-32   Monoraphidium neglectum
ref|XP_002955541.1|  hypothetical protein VOLCADRAFT_83275              129   2e-31   Volvox carteri f. nagariensis
ref|XP_003059850.1|  predicted protein                                  125   1e-30   Micromonas pusilla CCMP1545
ref|XP_002504529.1|  predicted protein                                  125   2e-30   Micromonas commoda
ref|XP_005650588.1|  tyrosyl-tRNA synthetase                            124   4e-30   Coccomyxa subellipsoidea C-169
ref|XP_001751567.1|  predicted protein                                  119   4e-28   
ref|XP_001416448.1|  Tyrosyl-tRNA synthetase, probable                  110   5e-25   Ostreococcus lucimarinus CCE9901
ref|WP_032125960.1|  tyrosyl-tRNA synthetase                            108   1e-24   Candidatus Protochlamydia massiliensis
ref|WP_042279297.1|  tyrosyl-tRNA synthetase                            105   2e-23   Candidatus Protochlamydia sp. R18
ref|WP_039359281.1|  tyrosyl-tRNA synthetase                            105   2e-23   Candidatus Protochlamydia amoebophila
ref|WP_011175719.1|  tyrosyl-tRNA synthetase                            105   2e-23   Candidatus Protochlamydia amoebophila
gb|KIC71389.1|  Tyrosine--tRNA ligase                                   105   3e-23   Candidatus Protochlamydia amoebophila
ref|XP_003075033.1|  TyrS Tyrosyl-tRNA synthetase, probable (IC)        103   2e-22   Ostreococcus tauri
ref|WP_042103652.1|  tyrosyl-tRNA synthetase                            100   1e-21   Parachlamydiaceae bacterium HS-T3
ref|WP_013182397.1|  tyrosyl-tRNA synthetase                            100   1e-21   Waddlia chondrophila
ref|WP_006340872.1|  tyrosyl-tRNA synthetase                          96.3    4e-20   Parachlamydia acanthamoebae
ref|XP_010229641.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...  95.5    1e-19   
ref|WP_013943141.1|  tyrosyl-tRNA synthetase                          93.2    5e-19   Simkania negevensis
emb|CDZ80947.1|  Tyrosine--tRNA ligase                                90.9    3e-18   Candidatus Rubidus massiliensis
ref|WP_039384881.1|  tyrosyl-tRNA synthetase                          90.5    4e-18   Neochlamydia sp. TUME1
ref|WP_042240888.1|  tyrosyl-tRNA synthetase                          90.5    4e-18   Neochlamydia sp. S13
gb|KIC73976.1|  Tyrosine--tRNA ligase                                 90.1    7e-18   Neochlamydia sp. EPS4
ref|XP_005713019.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  90.5    8e-18   Chondrus crispus [carageen]
ref|WP_039376683.1|  tyrosyl-tRNA synthetase                          85.5    3e-16   
ref|XP_005538192.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  85.5    5e-16   Cyanidioschyzon merolae strain 10D
ref|XP_007509051.1|  tyrosyl-tRNA synthetase                          83.6    2e-15   Bathycoccus prasinos
ref|XP_011397334.1|  Tyrosine-tRNA ligase                             83.2    3e-15   Auxenochlorella protothecoides
gb|AFG55783.1|  hypothetical protein 0_14069_01                       77.8    1e-14   Pinus taeda
ref|XP_009516786.1|  hypothetical protein PHYSODRAFT_552811           80.5    2e-14   Phytophthora sojae
gb|AFG55784.1|  hypothetical protein 0_14069_01                       77.4    2e-14   Pinus taeda
gb|AFG55790.1|  hypothetical protein 0_14069_01                       77.4    2e-14   Pinus taeda
gb|AEW07904.1|  hypothetical protein 0_14069_01                       77.4    2e-14   Pinus radiata
ref|WP_022848286.1|  tyrosyl-tRNA synthetase                          79.7    3e-14   Anaerolineaceae bacterium oral taxon 439
gb|ETI39233.1|  tyrosine-tRNA ligase                                  77.8    1e-13   Phytophthora parasitica P1569
ref|XP_008910914.1|  tyrosine-tRNA ligase                             77.8    1e-13   Phytophthora parasitica INRA-310
ref|WP_041017153.1|  tyrosyl-tRNA synthetase                          76.6    4e-13   Criblamydia sequanensis
ref|XP_002907836.1|  tyrosyl-tRNA synthetase, putative                75.1    1e-12   Phytophthora infestans T30-4
ref|WP_040313631.1|  tyrosyl-tRNA synthetase                          74.7    2e-12   Actinomyces cardiffensis
gb|ENO19082.1|  tyrosine--tRNA ligase                                 74.7    2e-12   Actinomyces cardiffensis F0333
ref|XP_005707106.1|  tyrosyl-tRNA synthetase                          74.3    3e-12   Galdieria sulphuraria
ref|WP_022864835.1|  tyrosyl-tRNA synthetase                          73.9    3e-12   Varibaculum cambriense
ref|WP_013600598.1|  tyrosyl-tRNA synthetase                          73.6    4e-12   Pseudarthrobacter phenanthrenivorans
ref|XP_009837943.1|  tyrosine-tRNA ligase                             73.6    4e-12   Aphanomyces astaci
ref|WP_044150629.1|  tyrosyl-tRNA synthetase                          70.9    6e-12   
dbj|BAI65246.1|  tyrosyl-tRNA synthetase                              70.9    6e-12   Rothia mucilaginosa DY-18
ref|WP_021271485.1|  tyrosyl-tRNA synthetase                          72.4    1e-11   Bacteriovorax sp. BSW11_IV
ref|XP_004334902.1|  tyrosine-tRNA ligase                             72.4    1e-11   Acanthamoeba castellanii str. Neff
ref|WP_024058184.1|  tyrosyl-tRNA synthetase                          72.0    2e-11   Varibaculum cambriense
ref|WP_029668640.1|  tyrosyl-tRNA synthetase                          71.6    2e-11   
gb|KDO34878.1|  tyrosyl-tRNA synthetase                               71.2    3e-11   Saprolegnia parasitica CBS 223.65
ref|WP_041569078.1|  tyrosyl-tRNA synthetase                          71.2    3e-11   Chloracidobacterium thermophilum
gb|AEP11643.1|  tyrosyl-tRNA synthetase                               71.2    3e-11   Chloracidobacterium thermophilum B
ref|WP_043455304.1|  tyrosyl-tRNA synthetase                          71.2    3e-11   Pseudarthrobacter phenanthrenivorans
ref|WP_018200080.1|  tyrosyl-tRNA synthetase                          70.9    3e-11   
ref|WP_021275481.1|  tyrosyl-tRNA synthetase                          70.9    4e-11   Bacteriovorax sp. Seq25_V
ref|XP_008605106.1|  tyrosyl-tRNA synthetase                          70.5    5e-11   Saprolegnia diclina VS20
ref|WP_008470064.1|  tyrosyl-tRNA synthetase                          70.5    5e-11   Lactobacillus hominis
ref|WP_037233127.1|  tyrosyl-tRNA synthetase                          70.1    6e-11   Rothia aeria
ref|WP_024366580.1|  tyrosyl-tRNA synthetase                          70.1    7e-11   Arthrobacter sp. TB 26
gb|KDQ21806.1|  hypothetical protein BOTBODRAFT_99200                 70.1    7e-11   Botryobasidium botryosum FD-172 SS1
ref|WP_028912082.1|  tyrosyl-tRNA synthetase                          69.7    8e-11   Prevotella sp. MA2016
ref|WP_006889016.1|  tyrosyl-tRNA synthetase                          69.7    8e-11   Rothia
gb|ERT67692.1|  tyrosine--tRNA ligase                                 69.7    9e-11   Rothia aeria F0184
ref|WP_039240672.1|  tyrosyl-tRNA synthetase                          69.7    9e-11   Arthrobacter sp. MWB30
ref|WP_021949404.1|  tyrosyl-tRNA synthetase                          69.7    1e-10   
emb|CCQ46715.1|  tyrosyl-tRNA synthetase                              69.3    1e-10   Pseudarthrobacter siccitolerans
ref|WP_013559196.1|  tyrosyl-tRNA synthetase                          69.3    1e-10   Anaerolinea thermophila
ref|WP_042457579.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Streptacidiphilus jiangxiensis
ref|WP_037604940.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Streptacidiphilus rugosus
ref|WP_030266695.1|  tyrosyl-tRNA synthetase                          68.9    2e-10   Streptacidiphilus jeojiense
ref|WP_017197962.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   Arthrobacter sp. M2012083
ref|WP_016998371.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   
ref|WP_013132266.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   Thermobispora bispora
ref|WP_018779124.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   Arthrobacter sp. 161MFSha2.1
ref|WP_010528768.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   Thermophagus xiamenensis
ref|WP_018771549.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Arthrobacter sp. 162MFSha1.1
ref|XP_008868076.1|  tyrosine-tRNA ligase                             68.2    3e-10   Aphanomyces invadans
ref|WP_004355960.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Prevotella disiens
ref|WP_015936720.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Pseudarthrobacter chlorophenolicus
ref|WP_003798662.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Arthrobacter globiformis
ref|WP_024332044.1|  tyrosyl-tRNA synthetase                          67.8    4e-10   
ref|WP_042380116.1|  tyrosyl-tRNA synthetase                          67.4    5e-10   Streptacidiphilus melanogenes
ref|WP_024963599.1|  tyrosyl-tRNA synthetase                          67.4    5e-10   Trueperella pyogenes
ref|WP_026547366.1|  tyrosyl-tRNA synthetase                          67.4    6e-10   Paenarthrobacter nicotinovorans
ref|WP_018763582.1|  tyrosyl-tRNA synthetase                          67.4    6e-10   Arthrobacter sp. 135MFCol5.1
ref|WP_026541624.1|  tyrosyl-tRNA synthetase                          67.4    6e-10   Paenarthrobacter nicotinovorans
ref|WP_014921325.1|  tyrosyl-tRNA synthetase                          67.4    6e-10   Arthrobacter sp. Rue61a
ref|WP_034510938.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Actinomyces sp. S4-C9
gb|AAP58586.1|  putative tyrosyl-tRNA synthetase                      67.0    6e-10   uncultured Acidobacteria bacterium
ref|WP_025000389.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Prevotella aurantiaca
ref|WP_036910525.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Prevotella
ref|WP_025295943.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Trueperella pyogenes
ref|WP_023925721.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella nigrescens
ref|WP_004362948.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella nigrescens
ref|WP_028905488.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella intermedia
ref|WP_021267070.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Bacteriovorax sp. BAL6_X
ref|WP_014709256.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella intermedia
ref|WP_006823030.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Corynebacterium
ref|WP_018657964.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Actinomadura flavalba
ref|WP_036788433.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Porphyromonas canoris
ref|WP_036847792.1|  tyrosyl-tRNA synthetase                          67.0    8e-10   Porphyromonas sp. COT-108 OH1349
ref|WP_036865421.1|  tyrosyl-tRNA synthetase                          67.0    8e-10   Porphyromonas sp. COT-108 OH2963
ref|WP_004366699.1|  tyrosyl-tRNA synthetase                          67.0    8e-10   Prevotella nigrescens
ref|WP_016445042.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Actinomyces europaeus
ref|WP_030504916.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Microbispora rosea
ref|WP_028931561.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Pseudonocardia asaccharolytica
ref|WP_017176881.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Actinomyces timonensis
ref|WP_021277367.1|  tyrosine--tRNA ligase domain protein             64.3    9e-10   
ref|WP_028271895.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Arthrobacter sp. UNC362MFTsu5.1
ref|WP_007000220.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Actinobaculum massiliense
ref|WP_028903046.1|  MULTISPECIES: tyrosyl-tRNA synthetase            66.6    1e-09   Prevotella
ref|WP_013398793.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Rothia dentocariosa
ref|WP_041818421.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Lactobacillus johnsonii
ref|WP_037274388.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Kibdelosporangium aridum
ref|WP_033150736.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Prevotella
ref|WP_013064850.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Prevotella ruminicola
gb|AHA96684.1|  tyrosyl-tRNA synthase                                 66.2    1e-09   Lactobacillus johnsonii N6.2
ref|WP_005507861.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Rothia
ref|WP_014243863.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Halobacteriovorax marinus
ref|WP_028266666.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Arthrobacter sp. MA-N2
ref|WP_042427072.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Streptacidiphilus anmyonensis
ref|WP_005507143.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Rothia
ref|WP_028906618.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Prevotella ruminicola
ref|WP_036886463.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Prevotella bivia
ref|WP_004338209.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Prevotella bivia
ref|WP_028851238.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Thermocrispum municipale
ref|WP_036863366.1|  tyrosyl-tRNA synthetase                          66.2    2e-09   Prevotella bivia
ref|WP_014790868.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Ornithobacterium rhinotracheale
ref|WP_004898658.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   
ref|WP_017614427.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Nocardiopsis salina
ref|WP_044496576.1|  tyrosine--tRNA ligase                            65.9    2e-09   Lactobacillus johnsonii
ref|WP_026980036.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Flavobacterium suncheonense
ref|WP_021474284.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Arthrobacter
ref|WP_008824157.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella histicola
ref|WP_007324558.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Rhodopirellula baltica
ref|WP_012892535.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Streptosporangium roseum
ref|WP_008674495.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Rhodopirellula sallentina
gb|AAS08157.1|  tyrosyl-tRNA synthetase                               65.9    2e-09   Lactobacillus johnsonii NCC 533
ref|WP_036867594.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella bivia
ref|WP_035732891.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   
ref|WP_022513249.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   
ref|WP_003650704.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Lactobacillus gasseri
ref|WP_021314877.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Lactobacillus gasseri
ref|WP_006043715.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Prevotella pallens
ref|WP_012825381.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   
ref|WP_011691372.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Arthrobacter sp. FB24
ref|WP_006256112.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Alloprevotella tannerae
ref|WP_044496612.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Nesterenkonia massiliensis
ref|WP_005987818.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Actinomyces graevenitzii
ref|WP_011122161.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Rhodopirellula baltica
ref|WP_008661113.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Rhodopirellula europaea
gb|ABJ59589.1|  tyrosyl-tRNA synthetase                               65.5    2e-09   Lactobacillus gasseri ATCC 33323 = JCM 1131
ref|WP_006947867.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Prevotella marshii
ref|WP_011774354.1|  tyrosyl-tRNA synthetase                          65.5    3e-09   Paenarthrobacter aurescens
ref|WP_016335378.1|  tyrosyl-tRNA synthetase                          65.5    3e-09   Amycolatopsis keratiniphila
ref|WP_021584875.1|  tyrosyl-tRNA synthetase                          65.5    3e-09   Prevotella pleuritidis
ref|WP_007332625.1|  tyrosyl-tRNA synthetase                          65.5    3e-09   Rhodopirellula baltica
ref|WP_043622222.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Nonomuraea candida
ref|WP_038511529.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Amycolatopsis japonica
ref|WP_024991409.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Prevotella pleuritidis
ref|WP_020629629.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Amycolatopsis alba
ref|WP_013670661.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Prevotella denticola
gb|EKY16477.1|  tyrosine--tRNA ligase                                 64.7    3e-09   Actinomyces sp. oral taxon 181 str. F0379
ref|WP_021852743.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   
ref|WP_043536564.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Actinomyces polynesiensis
ref|WP_021604636.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Actinomyces graevenitzii
ref|WP_021853510.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Prevotella
ref|WP_031426654.1|  tyrosyl-tRNA synthetase                          65.1    4e-09   Flavimarina sp. Hel_I_48
ref|WP_007573255.1|  tyrosyl-tRNA synthetase                          65.1    4e-09   Prevotella multisaccharivorax
ref|WP_025065363.1|  tyrosyl-tRNA synthetase                          65.1    4e-09   Prevotella enoeca
ref|WP_042369585.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Streptacidiphilus neutrinimicus
ref|WP_027449259.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Prevotella brevis
ref|WP_024820416.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Arthrobacter sp. 31Y
ref|WP_018921741.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Salsuginibacillus kocurii
ref|WP_039155571.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   
ref|WP_034251080.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Actinomyces sp. oral taxon 181
ref|WP_005163244.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Amycolatopsis azurea
ref|WP_014567013.1|  tyrosyl-tRNA synthetase                          64.7    5e-09   Lactobacillus johnsonii
ref|WP_026538365.1|  tyrosyl-tRNA synthetase                          64.7    5e-09   Arthrobacter sp. 9MFCol3.1
ref|WP_003649560.1|  tyrosyl-tRNA synthetase                          64.7    5e-09   Lactobacillus paragasseri
gb|AJC07291.1|  tyrosyl-tRNA synthase                                 64.7    5e-09   
ref|WP_023576069.1|  tyrosyl-tRNA synthetase                          64.7    5e-09   Flavobacterium saliperosum
ref|WP_037345658.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Amycolatopsis
ref|WP_004896025.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Lactobacillus johnsonii
ref|WP_004354427.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Prevotella denticola
ref|WP_036856724.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Prevotella denticola
ref|WP_034277502.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Amycolatopsis halophila
ref|WP_025067875.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Prevotella denticola
ref|WP_034321665.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Amycolatopsis lurida
ref|WP_007028024.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   Amycolatopsis decaplanina
ref|WP_019127035.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   Actinomyces sp. ph3
gb|EJU04247.1|  hypothetical protein DACRYDRAFT_48409                 64.3    6e-09   Dacryopinax primogenitus
ref|WP_043480242.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   Arthrobacter sp. SPG23
emb|CCA26043.1|  unnamed protein product                              64.3    6e-09   Albugo laibachii Nc14
ref|WP_011956798.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   Roseiflexus sp. RS-1
ref|WP_021964934.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_003848988.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   
ref|WP_009103310.1|  tyrosyl-tRNA synthetase                          64.3    7e-09   
ref|WP_004384512.1|  MULTISPECIES: tyrosyl-tRNA synthetase            63.9    7e-09   
ref|WP_028277280.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   
ref|WP_018911465.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   
ref|WP_005439705.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   
ref|WP_021842733.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_004806341.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_022016119.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_020806596.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_029722869.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_018774401.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_005448890.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_023589348.1|  tyrosyl-tRNA synthetase                          63.9    9e-09   
ref|WP_009199613.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_012852510.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_027017834.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_023019532.1|  MULTISPECIES: tyrosyl-tRNA synthetase            63.5    9e-09   
ref|WP_021352198.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_021897094.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_016188948.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_020871768.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_027454742.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_008447361.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_024989478.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
gb|AAZ56076.1|  tyrosyl-tRNA synthetase                               63.5    1e-08   
ref|WP_020645475.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_042198650.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_031072446.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_012845555.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_003099613.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_023392472.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_014517766.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_023577906.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_014366981.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_028846608.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_006953261.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_023058571.1|  MULTISPECIES: tyrosyl-tRNA synthetase            63.2    1e-08   
ref|WP_014523269.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_026466510.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_028927384.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_040353255.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_009612411.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_035794877.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_013227826.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_003655654.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_009012990.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_007367905.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
gb|EAQ78434.1|  tyrosyl-tRNA synthetase                               63.2    2e-08   
ref|WP_035809282.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_012911063.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_007174743.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_007338393.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_003716179.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_013515994.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_036831526.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_028274405.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_024936535.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
gb|EKD32119.1|  hypothetical protein ACD_77C00174G0009                62.8    2e-08   
ref|WP_040280422.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_030040096.1|  tyrosyl-tRNA synthetase                          60.8    2e-08   
ref|WP_012398612.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_004350641.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_013265033.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_003657064.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_021756583.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_022286111.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_020547072.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_030173661.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_006281183.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_018296313.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_017981997.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_036873075.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_010417949.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_005989039.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_042409186.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_038993706.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_028897025.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_027453266.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_044851982.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
emb|CBT75367.1|  tyrosine--tRNA ligase                                62.4    3e-08   
ref|WP_004006304.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_037313083.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_041649506.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_016896392.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_022873629.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_007902436.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_020502358.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_031523987.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_022430966.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_023572950.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_003143076.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_044065228.1|  MULTISPECIES: tyrosyl-tRNA synthetase            62.0    3e-08   
ref|WP_041887384.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_006908464.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_026866815.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_044079621.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_004361041.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_044075099.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_042166486.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_021671318.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_022317024.1|  MULTISPECIES: tyrosyl-tRNA synthetase            62.0    3e-08   
ref|WP_021927795.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_036865681.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_014558675.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_036925066.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_027930652.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_031544395.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
dbj|GAF41443.1|  tyrosyl-tRNA synthetase                              62.0    4e-08   
ref|WP_020420432.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_026404207.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_035455359.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_013241818.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_018226442.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_041468091.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_017832867.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_026859655.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_026763124.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_036333822.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
gb|ETK30431.1|  tyrosyl-tRNA synthetase                               61.6    4e-08   
ref|WP_003795411.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_022146920.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_004328414.1|  MULTISPECIES: tyrosyl-tRNA synthetase            61.6    4e-08   
emb|CEP12620.1|  hypothetical protein                                 61.6    4e-08   
ref|WP_013151006.1|  MULTISPECIES: tyrosyl-tRNA synthetase            61.6    4e-08   
dbj|BAE81349.1|  tyrosyl tRNA synthetase                              61.6    5e-08   
ref|WP_012996195.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_009347608.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
gb|EXX57162.1|  tyrosine--tRNA ligase MSY1                            61.2    5e-08   
ref|WP_013838509.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_035929596.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_009079585.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
gb|ESA01810.1|  hypothetical protein GLOINDRAFT_39208                 61.6    5e-08   
ref|WP_030204930.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_033296256.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_026460182.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_010468888.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_014655359.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
gb|EPB83669.1|  tyrosyl-tRNA synthetase                               61.2    6e-08   
ref|WP_026287364.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_020556141.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_025780404.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_031129511.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_017884472.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_031173814.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_036893143.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_010662327.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_033317774.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_022310931.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_018464157.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_008611445.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_043585078.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_042254004.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_013911393.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
dbj|BAA98569.1|  tyrosyl tRNA synthetase                              60.8    7e-08   
ref|WP_039206777.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_027367168.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_014157010.1|  MULTISPECIES: tyrosyl-tRNA synthetase            60.8    7e-08   
ref|WP_025069924.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
emb|CDH56280.1|  tyrosine-trna ligase                                 60.8    8e-08   
ref|WP_022327958.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_010883004.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_022157479.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_016457404.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_036960728.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_010892051.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
gb|AAP98301.1|  tyrosyl-tRNA synthetase                               60.8    8e-08   
ref|WP_034466497.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_006848087.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_038268842.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_020660335.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_004380478.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_035280995.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
ref|WP_022110590.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
ref|WP_011543583.1|  tyrosyl-tRNA synthetase                          60.5    9e-08   
gb|KIJ67809.1|  hypothetical protein HYDPIDRAFT_107314                60.5    9e-08   
ref|WP_043780313.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_014564560.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_013439025.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_030431057.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_035175588.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
gb|KIJ59875.1|  hypothetical protein HYDPIDRAFT_117962                60.1    1e-07   
ref|WP_014259706.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_025895947.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_022663249.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_002877898.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_016395907.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
gb|EHE91484.1|  Tyrosine--tRNA ligase                                 60.5    1e-07   
ref|WP_011677971.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_022793075.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_021589640.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_027013520.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
gb|EHE88055.1|  Tyrosine--tRNA ligase                                 60.5    1e-07   
ref|WP_017619130.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_026285972.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_005529362.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_025252737.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_016776545.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_031165781.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_023635620.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_044380654.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_043055739.1|  MULTISPECIES: tyrosyl-tRNA synthetase            60.5    1e-07   
ref|WP_043462324.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_010313559.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_037370307.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_020672041.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_015415854.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_034260385.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_009106812.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_007135145.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_008867129.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_030063911.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_018659753.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_039102177.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_004377988.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_019310944.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_006681555.1|  tyrosyl-tRNA synthetase                          60.1    2e-07   
ref|WP_004271262.1|  tyrosyl-tRNA synthetase                          60.1    2e-07   
ref|WP_040361883.1|  tyrosyl-tRNA synthetase                          60.1    2e-07   
ref|WP_015786857.1|  tyrosyl-tRNA synthetase                          60.1    2e-07   



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL+
Sbjct  395  RRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVLN  454

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            IS+LDL VSSGLLESKSAARRMLKQGGLYLNNA+VD E+KKIE DDIVD KV+LLSAGKK
Sbjct  455  ISILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGKK  514

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  515  NKMVVRIS  522



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL+
Sbjct  394  RRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMKYDQVLN  453

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I +LDL VS GLLESKSAARRMLKQGGLYLNN +VDSE+KKIE DDIVD KV+LLSAGKK
Sbjct  454  IPILDLYVSGGLLESKSAARRMLKQGGLYLNNGKVDSESKKIEADDIVDDKVILLSAGKK  513

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  514  NKMVVRIS  521



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL+
Sbjct  395  RRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVLN  454

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I +LDL VSSGLLESKSAARRMLKQGGLYLNNA+VD E+KKIE DDIVD KV+LLSAGKK
Sbjct  455  IPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGKK  514

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  515  NKMVVRIS  522



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ ++QVL 
Sbjct  394  RRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYEQVLD  453

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I +LDL VSSGLLESKSAARRMLKQGGLYLNNA+VDSE+KKIE DDIVD KV+LLSAGKK
Sbjct  454  IPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGKK  513

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  514  NKMVVRIS  521



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+  +QVL+
Sbjct  395  RRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNHEQVLN  454

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I +LDL VSSGLLESKSAARRMLKQGGLYLNNA+VDSE+KKIE DDIVD KV+LLSAGKK
Sbjct  455  IPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGKK  514

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  515  NKMVVRIS  522



>ref|XP_002265238.2| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Vitis 
vinifera]
Length=485

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEE TRFVHGQEGLDEALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D+VL+
Sbjct  359  RRLAEEATRFVHGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLN  417

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLS+S+GLLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAGKK
Sbjct  418  LSLLDLSISTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGKK  477

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  478  NKVVVRIS  485



>emb|CDP19091.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEE+TRFVHGQEGLDEALKATEALRPG A TKLD KTIEGI  DVPSCSLP+DQVLS
Sbjct  399  RRLAEEITRFVHGQEGLDEALKATEALRPGAA-TKLDAKTIEGIGEDVPSCSLPYDQVLS  457

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLSVSSGLLESKSAARR+LKQGGLYLNN+RVDSEAKKIE +DI+DGKV+LLSAGKK
Sbjct  458  LSLLDLSVSSGLLESKSAARRLLKQGGLYLNNSRVDSEAKKIEANDIIDGKVILLSAGKK  517

Query  193  NKMVVRIS  170
            NKMVVR+S
Sbjct  518  NKMVVRVS  525



>gb|KDP41896.1| hypothetical protein JCGZ_26914 [Jatropha curcas]
Length=509

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 123/128 (96%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +DQVL+
Sbjct  383  RRLAEEVTRFVHGEDGLSEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVLN  441

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVS+GLLESKSAARR+LKQGGLYLNN+RVDSE+K++E +DIVDGKVLLLSAGKK
Sbjct  442  LSLVDLSVSAGLLESKSAARRLLKQGGLYLNNSRVDSESKRVEAEDIVDGKVLLLSAGKK  501

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  502  NKVVVRIS  509



>ref|XP_010110726.1| Tyrosine--tRNA ligase [Morus notabilis]
 gb|EXC27891.1| Tyrosine--tRNA ligase [Morus notabilis]
Length=481

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL + + + 
Sbjct  355  RRLAEEVTRFVHGEEGLREALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYAEAIG  413

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVS+GLLESKSAARR+LKQGGLYLNNARVDSE+K++E DDIVDGKVLLLSAGKK
Sbjct  414  LSLVDLSVSAGLLESKSAARRLLKQGGLYLNNARVDSESKRVEADDIVDGKVLLLSAGKK  473

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  474  NKVVVRIS  481



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GL EA+KATEALRPG A+TKLDWKTIEGIA DVPSCSL +DQVL+
Sbjct  366  RRLAEEVTRFVHGQDGLLEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVLN  424

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSV++GL++SKSAARR+LKQGGLYLNN+RVDSE+K++E  DIV+GKVLLLSAGKK
Sbjct  425  LSLVDLSVTAGLIDSKSAARRLLKQGGLYLNNSRVDSESKRVESQDIVEGKVLLLSAGKK  484

Query  193  NKMVVRIS  170
            NK++VRIS
Sbjct  485  NKVIVRIS  492



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDWKT++ I+ DVPSCS P+ QVL 
Sbjct  353  RRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWKTMQAISEDVPSCSFPYHQVLD  411

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +SV+DLSVSSGL +SKSAARR+LKQGGLYLNN+RVDSE+K+IE  D+VDGK+LLLSAGKK
Sbjct  412  LSVVDLSVSSGLFDSKSAARRLLKQGGLYLNNSRVDSESKRIEPQDVVDGKLLLLSAGKK  471

Query  193  NKMVVRIS  170
            NK++VRIS
Sbjct  472  NKVLVRIS  479



>ref|XP_007022036.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 ref|XP_007022037.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13561.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13562.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
Length=491

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TRFVHG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV++
Sbjct  365  QRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVVN  423

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSV SGL ESKSAARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGKK
Sbjct  424  LSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGKK  483

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  484  NKVVVRIS  491



>ref|XP_006375482.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
 gb|ERP53279.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
Length=329

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAE+VT FVHG++GL+EALKATEALRPG A+TKLDWKT EGIA DVPSCSL  DQVL+
Sbjct  203  RRLAEQVTLFVHGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVLN  261

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            IS++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGKVLLLSAGKK
Sbjct  262  ISLIDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGKK  321

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  322  NKVIVRIT  329



>gb|KCW55733.1| hypothetical protein EUGRSUZ_I01565, partial [Eucalyptus grandis]
Length=479

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL+
Sbjct  353  RRLAEEVTRFVHGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVLN  411

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSV +GL+ESKSAARR+LKQGG+YLNN RVD E+K+IE +DIVDGKVLLLSAGKK
Sbjct  412  CSLVDLSVLAGLMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGKK  471

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  472  NKVVVRIS  479



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 118/127 (93%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            RLAEE+TRFVHG+EGL EA+KATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL++
Sbjct  373  RLAEELTRFVHGEEGLKEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDDVLNL  431

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSV SGLLES+SA RRMLKQGGLYLNN R+D+E+K+IE DDIVDGKVLLLSAGKKN
Sbjct  432  SIVDLSVLSGLLESRSAVRRMLKQGGLYLNNTRIDNESKRIEVDDIVDGKVLLLSAGKKN  491

Query  190  KMVVRIS  170
            KMVVR+S
Sbjct  492  KMVVRVS  498



>ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
 gb|KGN53185.1| hypothetical protein Csa_4G025150 [Cucumis sativus]
Length=493

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL+
Sbjct  367  RRLAEEVTRFVHGEDGLREALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVLN  425

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +SV+DLSV+SGLLESKSAARR+LKQGGLYLNN RVDSE+K++E  DIVDGKVLLLSAGKK
Sbjct  426  LSVVDLSVTSGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDIVDGKVLLLSAGKK  485

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  486  NKVVVRIS  493



>ref|XP_010028900.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
Length=506

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL+
Sbjct  380  RRLAEEVTRFVHGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVLN  438

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSV +GL+ESKSAARR+LKQGG+YLNN RVD E+K+IE +DIVDGKVLLLSAGKK
Sbjct  439  CSLVDLSVLAGLMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGKK  498

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  499  NKVVVRIS  506



>ref|XP_008453844.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
melo]
Length=493

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+ GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL+
Sbjct  367  RRLAEEVTRFVHGENGLSEALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVLN  425

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +SV+DLSV++GLLESKSAARR+LKQGGLYLNN RVDSE+K++E  D++DGKVLLLSAGKK
Sbjct  426  LSVVDLSVTTGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDVIDGKVLLLSAGKK  485

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  486  NKVVVRIS  493



>ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
Length=493

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL+
Sbjct  367  RRLAEEVTRFVHGEDGLREALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVLN  425

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +SV+DLSV+SGLLESKSAARR+LKQGGLYLNN RVDSE+K++E  DI+DGKVLLLSAGKK
Sbjct  426  LSVVDLSVTSGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDIIDGKVLLLSAGKK  485

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  486  NKVVVRIS  493



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEALRPG ADTKLDWKTI+ I+ DVPSCS P++QVL 
Sbjct  356  RRLAEEVTRFVHGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVLD  414

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVD+E K++E  DIVDGK+LLLSAGKK
Sbjct  415  LSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGKK  474

Query  193  NKMVVRI  173
            NK++V+I
Sbjct  475  NKVLVQI  481



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLA+EVTRFVHGQ+GLDEALKATEALRPG ADTKLDWKTI+ I+ DVPSCS P++QVL 
Sbjct  356  RRLAQEVTRFVHGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVLD  414

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVD+E K++E  DIVDGK+LLLSAGKK
Sbjct  415  LSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGKK  474

Query  193  NKMVVRI  173
            NK++V+I
Sbjct  475  NKVLVQI  481



>gb|KEH32330.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=482

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EAL+ATEALRPG ++TKLDWKTIEGIA DVPSCSL +D+VL+
Sbjct  356  RRLAEEVTRFVHGEDGLSEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVLN  414

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVSSGL +SKSAARR+LKQGG+YLNN+RVDSE K+IE  DIVDGKVLLLSAGKK
Sbjct  415  QSLVDLSVSSGLFDSKSAARRLLKQGGVYLNNSRVDSENKRIEAADIVDGKVLLLSAGKK  474

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  475  NKVLVRIA  482



>ref|XP_004500343.1| PREDICTED: tyrosine--tRNA ligase-like [Cicer arietinum]
Length=501

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL+EA+KATEALRPG ++TKLDWKTIEGIA DVPSCSL +D+VL+
Sbjct  375  RRLAEEVTRFVHGEDGLNEAIKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVLN  433

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVSSGL +SKSAARR+LKQGGLYLNN+RVD+E K++E  DIVDGKVLLLSAGKK
Sbjct  434  QSLVDLSVSSGLFDSKSAARRLLKQGGLYLNNSRVDNENKRVEAADIVDGKVLLLSAGKK  493

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  494  NKVLVRIA  501



>gb|KHN08832.1| Tyrosine--tRNA ligase [Glycine soja]
Length=482

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL+
Sbjct  356  RRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVLN  414

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGL ESKSAARR+LKQGGLYLNN RVDSE+K+IE  DIVDGKVLLLSAGKK
Sbjct  415  LSLVDLSVSSGLFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGKK  474

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  475  NKVLVRIA  482



>ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=490

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL+
Sbjct  364  RRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVLN  422

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGL ESKSAARR+LKQGGLYLNN RVDSE+K+IE  DIVDGKVLLLSAGKK
Sbjct  423  LSLVDLSVSSGLFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGKK  482

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  483  NKVLVRIA  490



>ref|XP_010927782.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=544

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL EALKATE LRPG A+TKLDW+TIEGIA DVPSC L +DQVL+
Sbjct  418  RRLAEEVTRFVHGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCCLAYDQVLN  476

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVS+GLL SKSAARR++KQGGLYLNN RVD+EAK IE  DIVDGK+LLLSAGKK
Sbjct  477  SSLVDLSVSTGLLSSKSAARRLMKQGGLYLNNRRVDNEAKMIEAGDIVDGKLLLLSAGKK  536

Query  193  NKMVVRIS  170
            NK+V+RIS
Sbjct  537  NKIVIRIS  544



>ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Oryza brachyantha]
Length=485

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL 
Sbjct  359  RRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLK  417

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+VS+GLL SKSA RR++KQGGLYLNN R+DSE K +EE D+V+GKVLLLSAGKK
Sbjct  418  SPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVNGKVLLLSAGKK  477

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  478  NKMVVRIS  485



>gb|EMT07165.1| Tyrosyl-tRNA synthetase [Aegilops tauschii]
Length=512

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQVL 
Sbjct  386  RRLAEEVTRFVHGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLRYDQVLK  444

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+ S+GLL SKSAARR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKK
Sbjct  445  SPLVDLAASTGLLASKSAARRLIKQGGLYLNNMKIDSEDKLVEEGDIVDGKVLLLSAGKK  504

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  505  NKMVVRIS  512



>ref|XP_011033705.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Populus euphratica]
Length=502

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAE+VT FVHG++GL+EALKATEALRPG A+TKLDWKT EGIA DVPSCSL  DQVL+
Sbjct  376  RRLAEQVTLFVHGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVLN  434

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            IS++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGKVLLLSAGKK
Sbjct  435  ISLIDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGKK  494

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  495  NKVIVRIT  502



>dbj|BAK00149.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVT FVHGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL 
Sbjct  386  RRLAEEVTLFVHGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLK  444

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+ S+GLL SKSA RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKK
Sbjct  445  SPLVDLAASTGLLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGKK  504

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  505  NKMVVRIS  512



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVPSCS P+ QVL 
Sbjct  358  RRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVLD  416

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKK
Sbjct  417  LSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKK  476

Query  193  NKMVVRIS  170
            NK++V+IS
Sbjct  477  NKVLVQIS  484



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVPSCS P+ QVL 
Sbjct  354  RRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVLD  412

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKK
Sbjct  413  LSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKK  472

Query  193  NKMVVRIS  170
            NK++V+IS
Sbjct  473  NKVLVQIS  480



>gb|EMS54027.1| Tyrosyl-tRNA synthetase [Triticum urartu]
Length=796

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQEG++EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL 
Sbjct  670  RRLAEEVTRFVHGQEGVEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLK  728

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+ S+GLL SKSA RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKK
Sbjct  729  SPLVDLAASTGLLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGKK  788

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  789  NKMVVRIS  796



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL+
Sbjct  367  QRLAEEVTRFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVLN  425

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVS+GL ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGKK
Sbjct  426  VSLVDLSVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGKK  485

Query  193  NKMVVRIS  170
            NK+VVRI+
Sbjct  486  NKVVVRIA  493



>ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
 gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
Length=493

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVT FVHG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL+
Sbjct  367  RRLAEEVTHFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVLN  425

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVS+GL ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGKK
Sbjct  426  VSLVDLSVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGKK  485

Query  193  NKMVVRIS  170
            NK+VVRI+
Sbjct  486  NKVVVRIA  493



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ GLDEALKATEA+RPG ADT LDW T++ I+ DVPSCS P+ QVL 
Sbjct  358  RRLAEEVTRFVHGQNGLDEALKATEAMRPG-ADTNLDWNTMQAISEDVPSCSFPYHQVLD  416

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + V+DLSVSSGL ++KSAARR+LKQGGLY+NN RV+SE+K+IE  DIVDGK+LLLSAGKK
Sbjct  417  LPVVDLSVSSGLFDTKSAARRLLKQGGLYMNNLRVESESKRIEPQDIVDGKLLLLSAGKK  476

Query  193  NKMVVRIS  170
            NK++VRIS
Sbjct  477  NKVLVRIS  484



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 117/127 (92%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            RLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS P+ QVL +
Sbjct  359  RLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVLDL  417

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKKN
Sbjct  418  SLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKKN  477

Query  190  KMVVRIS  170
            K++V+I+
Sbjct  478  KVLVQIN  484



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 117/127 (92%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            RLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS P+ QVL +
Sbjct  355  RLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVLDL  413

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKKN
Sbjct  414  SLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKKN  473

Query  190  KMVVRIS  170
            K++V+I+
Sbjct  474  KVLVQIN  480



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVT FVHG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL+
Sbjct  369  RRLAEEVTHFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVLN  427

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DL+VS+GL ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGKK
Sbjct  428  VSLVDLAVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGKK  487

Query  193  NKMVVRIS  170
            NK+VVRI+
Sbjct  488  NKVVVRIA  495



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL EALKATEALRPG A+T LDWKTIEGIA DVPSC+L + QVL+
Sbjct  405  RRLAEEVTRFVHGEEGLLEALKATEALRPG-AETVLDWKTIEGIAEDVPSCTLDYKQVLN  463

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVS+GLLESKSAARR+LKQGGLYLNN RV+SE + IE  DI+DGKVLLLSAGKK
Sbjct  464  ASLVDLSVSTGLLESKSAARRLLKQGGLYLNNIRVESEIRSIEVGDIIDGKVLLLSAGKK  523

Query  193  NKMVVRIS  170
            NKM+VRIS
Sbjct  524  NKMIVRIS  531



>ref|XP_003574045.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=512

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEEVTRFVHGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCSLP+DQVL 
Sbjct  386  RILAEEVTRFVHGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVLK  444

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+ S+GLL SKSA RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGKK
Sbjct  445  SPLVDLAASTGLLASKSAVRRLIKQGGLYLNNIKIDSEDKLVEEGDIVDGKVLLLSAGKK  504

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  505  NKMVVRIS  512



>gb|KEH34424.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=500

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVT+FVHG++GL+EAL+ATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL+
Sbjct  374  RRLAEEVTKFVHGEDGLNEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDDVLN  432

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVSSGL +SKSAARR+LKQGG+YLNN+RVDSE K+IE  DIVDGKVLLLSAGKK
Sbjct  433  QSLVDLSVSSGLFDSKSAARRLLKQGGVYLNNSRVDSENKRIEVADIVDGKVLLLSAGKK  492

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  493  NKVLVRIA  500



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVP CS P+ QVL 
Sbjct  354  RRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPXCSFPYHQVLD  412

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGKK
Sbjct  413  LSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGKK  472

Query  193  NKMVVRIS  170
            NK++V+IS
Sbjct  473  NKVLVQIS  480



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW  I+ I+ DVPSCS P+ +VL+
Sbjct  354  RRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVLN  412

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLSVSSGLL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGKK
Sbjct  413  LSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGKK  472

Query  193  NKMVVRIS  170
            NK++V+IS
Sbjct  473  NKVLVQIS  480



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW  I+ I+ DVPSCS P+ +VL+
Sbjct  358  RRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVLN  416

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLSVSSGLL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGKK
Sbjct  417  LSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGKK  476

Query  193  NKMVVRIS  170
            NK++V+IS
Sbjct  477  NKVLVQIS  484



>gb|KHN40972.1| Tyrosine--tRNA ligase [Glycine soja]
Length=279

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEG-LDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  377
            RRLAEEVTRFVHG++G L EALKATEALRPG ++TKLDWKTIEGIA DVP CSL +D VL
Sbjct  152  RRLAEEVTRFVHGEDGFLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAVL  210

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
            ++S++DL VSSGL ESKSAARR+LKQGGLYLNN RVD+E K+IE  DIVDGKVLLLSAGK
Sbjct  211  NLSLVDLLVSSGLFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAGK  270

Query  196  KNKMVVRI  173
            KNK++VRI
Sbjct  271  KNKVLVRI  278



>ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group]
 dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group]
 gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group]
 dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC LP+ QVL 
Sbjct  371  RRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVLK  429

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+VS+GLL SKSA RR++KQGGLYLNN R+DSE K +EE D+VDGKVLLLSAGKK
Sbjct  430  SPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGKK  489

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  490  NKMVVRIS  497



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS  + QVL 
Sbjct  354  RRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFLYHQVLD  412

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLSVSSGLL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGKK
Sbjct  413  LSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGKK  472

Query  193  NKMVVRIS  170
            NK++V+IS
Sbjct  473  NKVLVQIS  480



>ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=496

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEALRPG ++TKLDWKTIEGIA DVP CSL +D VL+
Sbjct  370  RRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAVLN  428

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DL VSSGL ESKSAARR+LKQGGLYLNN RVD+E K+IE  DIVDGKVLLLSAGKK
Sbjct  429  LSLVDLLVSSGLFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAGKK  488

Query  193  NKMVVRI  173
            NK++VRI
Sbjct  489  NKVLVRI  495



>gb|KJB12925.1| hypothetical protein B456_002G045400 [Gossypium raimondii]
Length=491

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEE+TRFVHG++GL EALKATEALRPG ++TKLDW+TIEGIA DVPS SLP+ +VL+
Sbjct  365  RKLAEEITRFVHGEDGLTEALKATEALRPG-SETKLDWETIEGIAEDVPSRSLPYTEVLN  423

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGL ESKSAARR+LKQGG+YLNN RVD+E+K+IE +DIVDGKVLLLSAGKK
Sbjct  424  LSIVDLSVSSGLFESKSAARRLLKQGGIYLNNNRVDNESKRIEAEDIVDGKVLLLSAGKK  483

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  484  NKVVVRIS  491



>ref|NP_001141566.1| hypothetical protein [Zea mays]
 gb|ACF86629.1| unknown [Zea mays]
 tpg|DAA37471.1| TPA: hypothetical protein ZEAMMB73_107188 [Zea mays]
Length=496

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQV  
Sbjct  370  KRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVFK  428

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+VS+GLL SKSA +R++KQGGLYLNN R+DSE K +EE DIVDGKVLLLSAGKK
Sbjct  429  SPLIDLAVSTGLLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEEGDIVDGKVLLLSAGKK  488

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  489  NKMVVRIS  496



>gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group]
Length=545

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC LP+ QVL 
Sbjct  419  RRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVLK  477

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+VS+GLL SKSA RR++KQGGLYLNN R+DSE K +EE D+VDGKVLLLSAGKK
Sbjct  478  SPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGKK  537

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  538  NKMVVRIS  545



>ref|XP_007022035.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
 gb|EOY13560.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
Length=486

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TRFVHG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV++
Sbjct  365  QRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVVN  423

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSV SGL ESKSAARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGKK
Sbjct  424  LSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGKK  483

Query  193  NK  188
            NK
Sbjct  484  NK  485



>ref|XP_007022034.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY13559.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=542

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TRFVHG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV++
Sbjct  421  QRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVVN  479

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSV SGL ESKSAARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGKK
Sbjct  480  LSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGKK  539

Query  193  NK  188
            NK
Sbjct  540  NK  541



>ref|XP_002447960.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
 gb|EES12288.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
Length=521

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQV  
Sbjct  395  KRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVFK  453

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+VS+GLL SKSA +R++KQGGLYLNN R+DSE K +E+ DIVDGKVLLLSAGKK
Sbjct  454  SPLVDLAVSTGLLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEDGDIVDGKVLLLSAGKK  513

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  514  NKMVVRIS  521



>ref|XP_008801775.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=544

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL EALKATE LRPG A+TKLDW+TIEGIA DVPSCSL + QVL+
Sbjct  418  RRLAEEVTRFVHGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVLN  476

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVS+GLL SKSAARR++KQGGLYLNN RVD+E K IE  DIVD KVLLLSAGKK
Sbjct  477  SSLVDLSVSTGLLSSKSAARRLMKQGGLYLNNRRVDNEEKVIEAGDIVDEKVLLLSAGKK  536

Query  193  NKMVVRI  173
            NKMV+RI
Sbjct  537  NKMVIRI  543



>ref|XP_004982893.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Setaria italica]
Length=494

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG+EGL EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQVL 
Sbjct  368  KRLAEEVTRFVHGEEGLVEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVLK  426

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL+VS+GLL SKSA +R++KQGGLYLNN R+DSE K +EE DIVDGKVLLLSAGKK
Sbjct  427  SPLVDLAVSTGLLASKSAVKRLIKQGGLYLNNIRIDSEDKLVEEGDIVDGKVLLLSAGKK  486

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  487  NKMVVRIS  494



>ref|XP_011071261.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Sesamum 
indicum]
Length=503

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 1/124 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGLDEALKAT+ALRPG A+TKLDWKTIE IA DVPS SL  DQVL+
Sbjct  341  RRLAEEVTRFVHGEEGLDEALKATQALRPG-AETKLDWKTIETIAEDVPSISLQQDQVLN  399

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLSV +GLLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKV+LLSAGKK
Sbjct  400  LSLLDLSVRTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEPNDIVDGKVILLSAGKK  459

Query  193  NKMV  182
            NKM+
Sbjct  460  NKMI  463



>gb|EYU42284.1| hypothetical protein MIMGU_mgv1a005712mg [Erythranthe guttata]
Length=473

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEEVTRFVHG+EGL+EA+KAT ALRPG ++TKLDW +IE IA DVPS SL  DQVL+
Sbjct  347  RKLAEEVTRFVHGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLGKDQVLN  405

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLSV SGLL+SKSAARRMLKQGGLYLNN RVDSE ++IE DDIVDGKV+LLSAGKK
Sbjct  406  LSLLDLSVCSGLLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGKK  465

Query  193  NKMVVRIS  170
            NKM+VRIS
Sbjct  466  NKMIVRIS  473



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATEALRPG A+T+LD +TIEGI+ DVPSCSL + QVL+
Sbjct  409  RRLAEEVTRFVHGEDGLAEALKATEALRPG-AETRLDAETIEGISEDVPSCSLAYYQVLN  467

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVS+GLL +KSA RR++KQGGLYLNN RVD+E K++EE DI+DGK+LLLSAGKK
Sbjct  468  SSLIDLSVSTGLLSTKSAVRRLMKQGGLYLNNKRVDTEEKRVEEADIIDGKILLLSAGKK  527

Query  193  NKMVVRIS  170
            NKMVVRIS
Sbjct  528  NKMVVRIS  535



>ref|XP_008783116.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
 ref|XP_008783117.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=543

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EALKATE LRPG A+TKLDW+TIEGIA DVPSCSL + QVL+
Sbjct  417  RRLAEEVTRFVHGEDGLTEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVLN  475

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSVS+GLL SKSAARR+++QGGLYLNN RVD+EAK IE  DIVD K+LLLSAGKK
Sbjct  476  SSLVDLSVSTGLLSSKSAARRLMEQGGLYLNNRRVDNEAKVIEAGDIVDEKILLLSAGKK  535

Query  193  NKMVVRI  173
            NKMV++I
Sbjct  536  NKMVIKI  542



>emb|CAN64191.1| hypothetical protein VITISV_016956 [Vitis vinifera]
Length=868

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEE TRFVHGQEGLDEALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D+VL+
Sbjct  359  RRLAEEATRFVHGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLN  417

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
            +S+LDLS+S+GLLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAG
Sbjct  418  LSLLDLSISTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAG  475



>gb|EYU24457.1| hypothetical protein MIMGU_mgv1a005745mg [Erythranthe guttata]
Length=472

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEEVTRFVHG+EGL+EA+KAT ALRPG ++TKLDW +IE IA DVPS SL  D+VL+
Sbjct  346  RKLAEEVTRFVHGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLEKDRVLN  404

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S+LDLSV SGLL+SKSAARRMLKQGGLYLNN RVDSE ++IE DDIVDGKV+LLSAGKK
Sbjct  405  LSLLDLSVCSGLLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGKK  464

Query  193  NKMVVRIS  170
            NKM+VRIS
Sbjct  465  NKMIVRIS  472



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V   
Sbjct  386  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGS  444

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKN
Sbjct  445  SIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKN  504

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  505  KVVVRIS  511



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V   
Sbjct  380  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGS  438

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKN
Sbjct  439  SIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKN  498

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  499  KVVVRIS  505



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V   
Sbjct  386  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGS  444

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKN
Sbjct  445  SIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKN  504

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  505  KVVVRIS  511



>ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
 gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
Length=478

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+EVT FVHG++GL EAL+ATEAL+PG+  TKLDWK+IEGIA D+PSCSLP++ VL+
Sbjct  352  QRLAKEVTLFVHGEDGLAEALQATEALKPGSG-TKLDWKSIEGIAEDLPSCSLPYEDVLN  410

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +S++DLSVSSGL ESKSAARR+LKQGGLYLNN+RVD+E K+IE  DIVDGKVLLLSAGKK
Sbjct  411  LSLVDLSVSSGLFESKSAARRLLKQGGLYLNNSRVDNEGKRIEAADIVDGKVLLLSAGKK  470

Query  193  NKMVVRIS  170
            NK++VRI+
Sbjct  471  NKVLVRIA  478



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V  +
Sbjct  386  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGL  444

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKN
Sbjct  445  SIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKN  504

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  505  KVVVRIS  511



>gb|EPS58486.1| hypothetical protein M569_16327, partial [Genlisea aurea]
Length=428

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            RLAEE+TRFVHG+EGL EA+KAT AL PGN +T L W++IEGIA DVPSC L  +QVL+ 
Sbjct  304  RLAEELTRFVHGEEGLAEAVKATRALNPGN-ETNLRWESIEGIAGDVPSCRLNRNQVLNS  362

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSV++GL+ES+SAARR+LKQGGLYLNN RVD+E KKIE+DDIVDGK+LLLSAGKKN
Sbjct  363  SLVDLSVATGLVESRSAARRLLKQGGLYLNNVRVDNEGKKIEDDDIVDGKILLLSAGKKN  422

Query  190  KMVVRI  173
            KMVVRI
Sbjct  423  KMVVRI  428



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE I+ D+PSCSLP D+VL +
Sbjct  423  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERISEDIPSCSLPIDRVLGL  481

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E +++EE+DIV+GK L+LSAGKKN
Sbjct  482  SIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENRRVEEEDIVEGKGLVLSAGKKN  541

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  542  KVVVRIS  548



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V  +
Sbjct  386  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVSGL  444

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K+++E+DIV+G+ L+LSAGKKN
Sbjct  445  SIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVDEEDIVEGRGLVLSAGKKN  504

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  505  KVVVRIS  511



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSL  D+V   
Sbjct  386  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLSIDRVSGS  444

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGKKN
Sbjct  445  SIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGKKN  504

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  505  KVVVRIS  511



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +
Sbjct  375  KLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVAGV  433

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++D+SVS+GL ESKSAARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GKKN
Sbjct  434  SIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGKKN  493

Query  190  KMVVRIS  170
            K+V+RIS
Sbjct  494  KVVIRIS  500



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +
Sbjct  375  KLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVAGV  433

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++D+SVS+GL ESKSAARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GKKN
Sbjct  434  SIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGKKN  493

Query  190  KMVVRIS  170
            K+V+RIS
Sbjct  494  KVVIRIS  500



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +
Sbjct  395  KLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVAGV  453

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++D+SVS+GL ESKSAARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GKKN
Sbjct  454  SIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGKKN  513

Query  190  KMVVRIS  170
            K+V+RIS
Sbjct  514  KVVIRIS  520



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LA EVTRFVHG+EGL EA+KATEALRPG A+TKL+W  IE IA D+PSCSLP D+V   
Sbjct  374  KLAAEVTRFVHGEEGLKEAIKATEALRPG-AETKLEWNLIERIAEDIPSCSLPIDRVSGF  432

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            SV+DLSVS+GL ESKSAA+RMLKQGG+Y+NNARVD E K++EE DI+DGK L+LS+GKKN
Sbjct  433  SVVDLSVSAGLFESKSAAKRMLKQGGIYMNNARVDDENKRVEEADIIDGKGLVLSSGKKN  492

Query  190  KMVVRIS  170
            K+VVRIS
Sbjct  493  KVVVRIS  499



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V  +
Sbjct  378  KLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPTCSLPIDRVSGV  436

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            S++D+SVS+GL ESKSAARR LKQGG+Y+NN RVD E K++EE+DIV+GK L+LS+GKKN
Sbjct  437  SIVDVSVSAGLFESKSAARRTLKQGGVYMNNQRVDDENKRVEEEDIVEGKGLVLSSGKKN  496

Query  190  KMVVRIS  170
            K+V+RIS
Sbjct  497  KVVIRIS  503



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            ++LAEEVTRFVHG+EGL EA++ATEALRPG  +TKLDWK IE IA D+PSCSL  ++VL+
Sbjct  389  KKLAEEVTRFVHGEEGLREAIRATEALRPGT-ETKLDWKMIEKIAEDIPSCSLAKEEVLN  447

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++D++VSSGLLES+SAARRM+KQGG+YLNN RV+ E+K++ +DDIV+GKVLLLSAGKK
Sbjct  448  SSIIDIAVSSGLLESRSAARRMMKQGGIYLNNERVEEESKRVGDDDIVEGKVLLLSAGKK  507

Query  193  NKMVVRIS  170
            NK+VVRIS
Sbjct  508  NKIVVRIS  515



>ref|XP_006826574.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
 gb|ERM93811.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
Length=495

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL EA+KATEAL+PG ++ KLD K IE I +DVPSC L + +VL+
Sbjct  367  RRLAEEVTRFVHGKDGLLEAVKATEALKPG-SEAKLDSKIIEEIGADVPSCCLDYHEVLN  425

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++DLSV+SGLLESKSAARR++KQGGLYLNN RV+ E   +EE+DIVDGKVLLLSAGKK
Sbjct  426  RSLVDLSVASGLLESKSAARRLMKQGGLYLNNKRVNGEDILVEEEDIVDGKVLLLSAGKK  485

Query  193  NKMVVRI  173
            NKMV++I
Sbjct  486  NKMVIKI  492



>ref|XP_002992920.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
 gb|EFJ06009.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
Length=467

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL+EALK T+AL PG+  T LDW  IE I+ DVPSC+L    V+ 
Sbjct  342  RRLAEEVTRFVHGEDGLEEALKVTQALSPGST-TTLDWTAIEAISRDVPSCTLD-SSVVV  399

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              V+DL VS GL  SK+ ARR++KQGG+Y+NNA+VD E   + E DI+DGK+LLLSAGKK
Sbjct  400  GPVVDLCVSCGLAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGKK  459

Query  193  NKMVVRI  173
            NKMVVRI
Sbjct  460  NKMVVRI  466



>ref|XP_002980036.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
 gb|EFJ18906.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
Length=467

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG++GL+EALK T+AL PG+  T LDW  IE I+ DVPSC+L    ++ 
Sbjct  342  RRLAEEVTRFVHGEDGLEEALKVTQALAPGST-TTLDWTAIEAISKDVPSCTLD-SSIVV  399

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              V+DL VS GL  SK+ ARR++KQGG+Y+NNA+VD E   + E DI+DGK+LLLSAGKK
Sbjct  400  GPVVDLCVSCGLAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGKK  459

Query  193  NKMVVRI  173
            NKMVVRI
Sbjct  460  NKMVVRI  466



>emb|CBI22389.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 98/104 (94%), Gaps = 1/104 (1%)
 Frame = -1

Query  481  EALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssglleSKSAARRMLK  302
            + +RPG A+TKLDWKTIEGIA DVPSCSL +D+VL++S+LDLS+S+GLLESKSAARR+LK
Sbjct  297  DVVRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLNLSLLDLSISTGLLESKSAARRLLK  355

Query  301  QGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  170
            QGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  356  QGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  399



>ref|XP_005848281.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
 gb|EFN56179.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
Length=440

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL +ALKATEAL PG A TKLD  ++E  A D PS SLP DQV+ 
Sbjct  314  RRLAEEVTRFVHGEEGLRQALKATEALAPGAA-TKLDADSLEAAAGDAPSASLPRDQVVG  372

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              + D+ V+ G+  SK+A RRM+K GG+ +NN +VD E   + EDD++DG+++L++AGKK
Sbjct  373  APLADVMVAVGMQPSKAAVRRMIKGGGVRVNNEKVDDELAALGEDDLIDGRLVLIAAGKK  432

Query  193  NKMVVRIS  170
            NKM+VR++
Sbjct  433  NKMLVRVA  440



>ref|XP_001699082.1| hypothetical protein CHLREDRAFT_139405 [Chlamydomonas reinhardtii]
 gb|EDO98937.1| predicted protein [Chlamydomonas reinhardtii]
Length=492

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG+EGL +ALKATEAL+PG A T+LD  T+E +A D PS SLP   V  
Sbjct  365  KRLAEEVTRFVHGEEGLAQALKATEALKPGAA-TQLDAATLEEVAGDAPSASLPRASVAG  423

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              + D+ V+  L  SKSAAR+++K GG+YLNNA+V  E   +  +D++DG++LL++AGKK
Sbjct  424  APLADVMVAIKLQPSKSAARKLIKGGGVYLNNAKVVEELYVVRPEDLIDGRLLLVAAGKK  483

Query  193  NKMVVRI  173
            NKM+VRI
Sbjct  484  NKMLVRI  490



>gb|KIZ02509.1| tyrosyl-tRNA synthetase [Monoraphidium neglectum]
Length=155

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAE +T FVHG EGL  ALKATEALRPG A T+LD  T+E IA D P+CSL  +QV  
Sbjct  29   RRLAEALTEFVHGPEGLATALKATEALRPGAA-TELDAATLEAIAGDAPTCSLKREQVEG  87

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++D+ V+SG+L SK   RRM+K GG+YLNNA+V  + + +   D++DG++ LL+ GKK
Sbjct  88   QLLVDVVVASGMLPSKGEVRRMVKNGGVYLNNAKVADDKRALTPADLIDGRLALLACGKK  147

Query  193  NKMVVRI  173
            NKM+VR+
Sbjct  148  NKMLVRV  154



>ref|XP_002955541.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
 gb|EFJ43394.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
Length=520

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG+EGL +A+KATEAL+PG A T+LD  T+E +A D PS +L    V  
Sbjct  392  RRLAEEVTRFVHGEEGLAQAIKATEALKPGAA-TQLDAATLETVAGDAPSATLTRGSVEG  450

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + + D+ V+  L  SKSAAR+++K GG+YLNNA+V  E   ++  D++DG++LL++AGKK
Sbjct  451  VPLADILVAVKLQPSKSAARKLIKGGGVYLNNAKVSEELYTVKPSDLIDGRLLLIAAGKK  510

Query  193  NKMVVRIS  170
            NKM+VR++
Sbjct  511  NKMLVRVA  518



>ref|XP_003059850.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55802.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=430

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG+ GL +ALKATE L+PG ADT LD  T+E +A D+PS  L   +V+ 
Sbjct  305  KRLAEEVTRFVHGEAGLSQALKATEGLKPG-ADTVLDADTLEALAGDIPSAELSLGEVVG  363

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             +V+D+  ++GL +SK  A+R++K GG  +NN +V+ E K IEE D+VDG+VLLL+AGKK
Sbjct  364  RTVVDVMAATGLQKSKGEAKRLIKGGGARVNNVKVEDEGKVIEEGDVVDGRVLLLAAGKK  423

Query  193  NKMVVRI  173
            NK++VR+
Sbjct  424  NKLLVRV  430



>ref|XP_002504529.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65787.1| predicted protein [Micromonas sp. RCC299]
Length=506

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG+EGL +ALKATE L+PG ADT LD  T+E +A D+P+  L  D+V+ 
Sbjct  380  KRLAEEVTRFVHGKEGLTQALKATEGLKPG-ADTVLDAATLEALAGDIPTAELARDEVVG  438

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             +V+D+  ++GL +SK  A+RM+K GG  LNN +V+ E   I EDD+++G+VLLL+AGKK
Sbjct  439  KTVVDVMAATGLQKSKGEAKRMIKGGGARLNNVKVEDEEATIGEDDVIEGRVLLLAAGKK  498

Query  193  NKMVVRI  173
            NK++VR+
Sbjct  499  NKLLVRV  505



>ref|XP_005650588.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26044.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=450

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA EVTRFVHGQ GLD+AL AT+AL PG +DTKLD  T+E +A   P+  LP  QVL 
Sbjct  323  RLLASEVTRFVHGQLGLDQALNATQALAPG-SDTKLDIDTLEAVAGSAPTVELPAGQVLG  381

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++ D+ V+  L ESKSA RR++K GG+ +NN +V  E +++ EDD +DG++ L++AGKK
Sbjct  382  QTLADIMVAIKLQESKSAGRRLIKGGGVRVNNQKVSDEQRRLSEDDFIDGRLALIAAGKK  441

Query  193  NKMVVRIS  170
            NKM++RIS
Sbjct  442  NKMLLRIS  449



>ref|XP_001751567.1| predicted protein [Physcomitrella patens]
 gb|EDQ83884.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 103/128 (80%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG++GL EALKAT+AL P  A   LD +T+E IA DVPSCS+ +  V+ 
Sbjct  376  KRLAEEVTRFVHGEQGLTEALKATQALAP-GAAAALDSQTLEAIAQDVPSCSISYS-VVG  433

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++D+SVS+GLL+SK+A RR++KQGGLYLNN +V+ E K +  +DI+D K+ LLSAGKK
Sbjct  434  KPLVDVSVSTGLLQSKAAVRRLIKQGGLYLNNVKVEDEGKTMVAEDIIDDKIFLLSAGKK  493

Query  193  NKMVVRIS  170
            N++VVR++
Sbjct  494  NRLVVRVT  501



>ref|XP_001416448.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
 gb|ABO94741.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
Length=484

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVTRFVHG +GL+EA  AT  L+PG ADT LD   +  +   VPS +LP  QVL 
Sbjct  358  RRLAEEVTRFVHGVQGLEEAQAATSVLKPG-ADTDLDVTALTALEGIVPSATLPMQQVLG  416

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            IS++ L+V  GL  SK A +R+++ GGL LNN +V S+   +   DIVDG++LLL+AGKK
Sbjct  417  ISLVQLAVDVGLQPSKGATKRLIQGGGLRLNNIKVLSDEATVSMADIVDGRLLLLAAGKK  476

Query  193  NKMVVRIS  170
            NK+++ ++
Sbjct  477  NKLLISVT  484



>ref|WP_032125960.1| tyrosyl-tRNA synthetase [Chlamydia sp. 'Diamant']
Length=424

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TR VHG EGL  A+K TE + PG + TKLD + +E +A+D+PSC + FD V++
Sbjct  297  KRLAEEITRMVHGGEGLKTAIKVTEGIAPG-SQTKLDAEMLESLAADMPSCEMAFDSVVN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL V +GL  SK  A+R+L+ GG+Y+NN +++ E   + ++ ++  +++LL+AGKK
Sbjct  356  KKLIDLLVEAGLQASKGDAKRLLRNGGVYINNEKIEDENCVVGDNYLISNRLILLAAGKK  415

Query  193  NKMVVRI  173
            NKM++R+
Sbjct  416  NKMLIRL  422



>ref|WP_042279297.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia sp. R18]
Length=425

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+
Sbjct  297  KRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL   + L  SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKK
Sbjct  356  KKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKK  415

Query  193  NKMVVRI  173
            NKM++R+
Sbjct  416  NKMIIRL  422



>ref|WP_039359281.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
Length=425

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+
Sbjct  297  KRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL   + L  SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKK
Sbjct  356  KKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKK  415

Query  193  NKMVVRI  173
            NKM++R+
Sbjct  416  NKMIIRL  422



>ref|WP_011175719.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
 sp|Q6MC06.1|SYY_PARUW RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23893.1| probable tyrosine-tRNA ligase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=425

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+
Sbjct  297  KRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL V + L  SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKK
Sbjct  356  KKLIDLLVETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKK  415

Query  193  NKMVVRI  173
            NKM++R+
Sbjct  416  NKMIIRL  422



>gb|KIC71389.1| Tyrosine--tRNA ligase [Candidatus Protochlamydia amoebophila]
Length=437

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL+
Sbjct  309  KRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVLN  367

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL   + L  SKS ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGKK
Sbjct  368  KKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGKK  427

Query  193  NKMVVRI  173
            NKM++R+
Sbjct  428  NKMIIRL  434



>ref|XP_003075033.1| TyrS Tyrosyl-tRNA synthetase, probable (IC) [Ostreococcus tauri]
 emb|CAL52305.2| Aminoacyl-tRNA synthetase, class Ic [Ostreococcus tauri]
Length=488

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA EVTRFVHGQ+GLDEA++ATE+LRPG  +T LD   +E  +  +PS ++    V+   
Sbjct  361  LAAEVTRFVHGQDGLDEAIRATESLRPGT-ETVLDAAALELASDTIPSVAISRVAVVDNL  419

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            V D+ V SGLLESK AA+RML+ GG+ +NN +V  E + I E DI+   +LLL+AGKKNK
Sbjct  420  VTDVVVVSGLLESKGAAKRMLRNGGIRVNNNKVTDETRTIVEGDIIGDNMLLLAAGKKNK  479

Query  187  MVVRI  173
            +++R+
Sbjct  480  LLIRL  484



>ref|WP_042103652.1| tyrosyl-tRNA synthetase [Parachlamydiaceae bacterium HS-T3]
Length=420

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTR VHG+EGL  A+K T+A +PG A T L  + +E ++ D+PS  LP   +++
Sbjct  294  KRLAEEVTRIVHGEEGLQTAIKVTQAAKPG-AQTDLSLEALEMLSRDMPSIQLPLADLVN  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++D+   SGL  SKS AR+++K GG YLNN +V      I+  D++  K+LLL+ GKK
Sbjct  353  KKIVDVLALSGLQSSKSEARKLIKNGGFYLNNHQVLDIDAAIQPSDLIGEKMLLLAVGKK  412

Query  193  NKMVVRI  173
            NK++V++
Sbjct  413  NKLLVKV  419



>ref|WP_013182397.1| tyrosyl-tRNA synthetase [Waddlia chondrophila]
 gb|ADI38686.1| Tyrosyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 emb|CCB90919.1| tyrosyl-tRNA synthetase [Waddlia chondrophila 2032/99]
Length=427

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA EVT+ VHG +GL  ALK TEA +PG  +T L+ + +E IA D+PS +   +++++
Sbjct  297  KRLAAEVTQMVHGDQGLKTALKVTEAAKPGR-ETDLNAEVLESIAHDMPSETFKAEEIVN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++D+ V +GL ESK  ARR+++ GG YLNN ++  E      DD VDG+++LL+ GKK
Sbjct  356  NKLIDVVVLTGLQESKGQARRLIRNGGCYLNNKKMTEENHVFTADDFVDGRLILLAVGKK  415

Query  193  NKMVVRIS*PI  161
            NK ++R+  P+
Sbjct  416  NKKLIRLDKPV  426



>ref|WP_006340872.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|EFB41848.1| hypothetical protein pah_c022o146 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86267.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=430

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEEVTR VHG+EGL  ALK TE   PG A T LD + +  +A D+P+ ++  + +L+
Sbjct  297  RKLAEEVTRIVHGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENILN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++D+        SK   R+++K GG+YLNN R++ E   +    ++DG ++L++ GKK
Sbjct  356  RRLVDVVSEITPERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGKK  415

Query  193  NKMVVRIS  170
            NK++VR+S
Sbjct  416  NKILVRVS  423



>ref|XP_010229641.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Brachypodium distachyon]
Length=473

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  383
            R LAEE+TRFVHGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCSLP+DQ
Sbjct  386  RILAEEITRFVHGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQ  441



>ref|WP_013943141.1| tyrosyl-tRNA synthetase [Simkania negevensis]
 emb|CCB88674.1| tyrosyl-tRNA synthetase [Simkania negevensis Z]
Length=424

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTRFVHG+EG+  AL+ T A+ PG ++  LD + +E IA D+P  +L   +VL 
Sbjct  297  KRLAEEVTRFVHGEEGVQIALRVTAAIAPG-SNASLDPEILEEIARDMPHVALDVSEVLD  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
                D+   +G + SKS A R+++ GG YLNN +V+  A  I +  ++  K ++L +GKK
Sbjct  356  QKYTDVITKAGFVTSKSEAARLIQNGGAYLNNEKVEDPAFTITKKHLIGNKYVMLGSGKK  415

Query  193  NKMVVRIS  170
             KM+++I+
Sbjct  416  KKMLIKIA  423



>emb|CDZ80947.1| Tyrosine--tRNA ligase [Chlamydia sp. 'Rubis']
Length=419

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA  +T  VHG+  L  ALK T+ + PG A T+LD +T++ ++ D+ SC L + +V++
Sbjct  292  KRLAHVMTELVHGENNLQLALKVTQGIAPG-AITQLDSQTLQALSKDLGSCQLSYKEVVN  350

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              +LDL V SGL  SK+ AR+ +  GG+YLNN ++  E   + +  ++DG +LLLS GKK
Sbjct  351  HKILDLLVKSGLQPSKTQARKSMTSGGIYLNNEKITDEEAVLLDKHLIDGNMLLLSFGKK  410

Query  193  NKMVVRIS  170
            NK+VV+++
Sbjct  411  NKIVVQLN  418



>ref|WP_039384881.1| tyrosyl-tRNA synthetase [Neochlamydia sp. TUME1]
 gb|KIC75964.1| Tyrosine--tRNA ligase [Neochlamydia sp. TUME1]
Length=424

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V++
Sbjct  297  KRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDATTLELMAQNMPSRILNNKTVIN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              +L+L    GLL SKS ARR+ + GG+YLNN +V+ E   I+ DD++  +++LL+ GKK
Sbjct  356  AKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGKK  415

Query  193  NKMVVRI  173
            NK+++ I
Sbjct  416  NKILISI  422



>ref|WP_042240888.1| tyrosyl-tRNA synthetase [Neochlamydia sp. S13]
Length=424

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V++
Sbjct  297  KRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVIN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              +L+L    GLL SKS ARR+ + GG+YLNN +V+ E   I+ DD++  +++LL+ GKK
Sbjct  356  AKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGKK  415

Query  193  NKMVVRI  173
            NK+++ I
Sbjct  416  NKILISI  422



>gb|KIC73976.1| Tyrosine--tRNA ligase [Neochlamydia sp. EPS4]
Length=424

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 84/127 (66%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V++
Sbjct  297  KRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVIN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              +L+L    GLL SKS ARR+ + GG+YLNN +V+ E   I+ DD++   ++LL+ GKK
Sbjct  356  AKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANHLMLLAVGKK  415

Query  193  NKMVVRI  173
            NK+++ I
Sbjct  416  NKILISI  422



>ref|XP_005713019.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
 emb|CDF33216.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
Length=510

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVTR VHG++G+  AL AT A  PG+    L  + +E I++D+PS ++    V+ 
Sbjct  384  KRLAEEVTRMVHGEKGVVSALAATAAAAPGSKAV-LSVEALEAISADMPSATMTRADVVG  442

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              +LDL V SGL +SK  ARR++K GG YLNN ++ +E   I E+D+V GK++LL+AGKK
Sbjct  443  GGILDLMVQSGLQKSKGEARRLIKGGGAYLNNGKITTEKLSISEEDLVGGKLILLAAGKK  502

Query  193  NKMVVRI  173
            NK+VVR+
Sbjct  503  NKLVVRV  509



>ref|WP_039376683.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|KIA77993.1| Tyrosine--tRNA ligase [Parachlamydia acanthamoebae]
Length=437

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEEVTR VHG+EGL  ALK TE   PG A T LD + +  +A D+P+ ++  + +L+
Sbjct  297  RKLAEEVTRIVHGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENILN  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++D+        SK   R+++K GG+YLNN R++ E   +    ++DG ++L++ GKK
Sbjct  356  RRLVDVVSEITPERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGKK  415

Query  193  NKMV  182
             K +
Sbjct  416  IKYL  419



>ref|XP_005538192.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82156.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
Length=522

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 86/134 (64%), Gaps = 8/134 (6%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPG--------NADTKLDWKTIEGIASDVPSCSLP  392
            LA EVTR VHG +G++ AL AT    PG        N  T+L    +E ++S +P  +LP
Sbjct  387  LAMEVTRIVHGDKGVETALAATAVAAPGHVPGGEHTNGSTRLRADVLEAVSSSLPGATLP  446

Query  391  FDQvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  212
               ++ + ++D+ V +GL +SK  ARR++  GG Y+N+ +V    + IE  D+++G++LL
Sbjct  447  RTALVGVPLVDVMVRAGLQKSKGEARRLIANGGAYVNDEKVSDSGRTIEATDLIEGRLLL  506

Query  211  LSAGKKNKMVVRIS  170
            L+AGKKNKM+VR+S
Sbjct  507  LAAGKKNKMLVRVS  520



>ref|XP_007509051.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO19508.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
Length=486

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = -1

Query  550  RLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            RLAEEVTRFVHG+ GL +A+ AT+ L PG +DT+LD   +E +   VP+       ++ I
Sbjct  360  RLAEEVTRFVHGEVGLQKAITATKGLLPG-SDTELDIDVLESLIDVVPTAICARTDIIGI  418

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
             ++D++V  GL +SK+  RRM+  GG+ +NN +V   +  I  ++++ G++LL+S GKKN
Sbjct  419  PIVDVAVKVGLRKSKAEVRRMIDGGGVRINNKKVLDVSTCISPEELIAGRMLLISMGKKN  478

Query  190  KMVVRI  173
            K ++++
Sbjct  479  KFLIQV  484



>ref|XP_011397334.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM24446.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
Length=476

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -1

Query  538  EVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIE-GIASDVPSCSLPFDQvlsisvl  362
            EVTRFVHG+EGL  AL AT AL PG+++  +D +T+E  +A   P  ++  +  L   ++
Sbjct  350  EVTRFVHGEEGLRGALAATRALAPGSSEGSVDLQTLEAAVAGGAPKFAVDREAALGGPLI  409

Query  361  dlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  182
            DL V  G   SK AARR+++  GL +NN  V  E + +  DD+VDG+++++S GKK K+V
Sbjct  410  DLLVRVGAQPSKGAARRLVQGRGLRVNNKVVTDEGRGLAADDLVDGRLVMVSLGKKKKLV  469

Query  181  VRI  173
            + +
Sbjct  470  LEL  472



>gb|AFG55783.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  383
            R+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  84   RKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>ref|XP_009516786.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
 gb|EGZ29511.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
Length=428

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P  +L    V+  S
Sbjct  304  LAEDITAMMHGQEGLKAALDATELLF-GKKSGPLTAEEMLRMAGDAPMSALSRADVVDQS  362

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            ++DL+V  G  +SK+  RR++K GG+YLNN RV+SEA ++E  +++DGK+L+L  G++N 
Sbjct  363  LVDLAVRIGAAKSKAECRRLIKGGGVYLNNERVESEALRVEAANLLDGKLLVLRIGRRNN  422

Query  187  MVVRI  173
             +V++
Sbjct  423  FIVQV  427



>gb|AFG55784.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55787.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  383
            R+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  84   RKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>gb|AFG55790.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55791.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55792.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55793.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55795.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55797.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  383
            R+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  84   RKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>gb|AEW07904.1| hypothetical protein 0_14069_01, partial [Pinus radiata]
 gb|AFG55785.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55786.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55788.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55789.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55794.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55796.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55798.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55799.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  383
            R+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  84   RKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>ref|WP_022848286.1| tyrosyl-tRNA synthetase [Chloroflexi bacterium oral taxon 439]
Length=430

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 76/131 (58%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSL-PFDQvl  377
            R LAEE+T  +HGQ+ LD+A +AT AL  G+ D  L    I+ I +DVPS ++ P +   
Sbjct  299  RALAEEMTYLMHGQKALDKARQATSALFGGDID-GLSADDIQDIFADVPSKTIRPAELSG  357

Query  376  sisvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   L   +S      KS   ARR + +GG+YLNN R D+ A  +   D ++G  L+L  
Sbjct  358  APVDLAAFLSETSGFLKSKGEARRAIAEGGIYLNNHRADNAAAIVTRSDFIEGAFLVLRR  417

Query  202  GKKNKMVVRIS  170
            GKKN  +VR+S
Sbjct  418  GKKNYFLVRLS  428



>gb|ETI39233.1| tyrosine-tRNA ligase [Phytophthora parasitica P1569]
 gb|ETK79440.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL32852.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL86112.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETM39261.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETO67974.1| tyrosine-tRNA ligase [Phytophthora parasitica P1976]
 gb|ETP09145.1| tyrosine-tRNA ligase [Phytophthora parasitica CJ01A1]
 gb|ETP37177.1| tyrosine-tRNA ligase [Phytophthora parasitica P10297]
Length=428

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V+  S
Sbjct  304  LAEDITVMMHGQEGLKAALDATELLF-GKKQGPLTAEEMLQMAGDAPMTILSRTDVVDQS  362

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            ++DL+V  G ++SK+  RR++K GG+YLNN RV+SEA ++E  +++D KVL++  G++N 
Sbjct  363  LVDLAVRIGAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGRRNN  422

Query  187  MVVRI  173
             +V++
Sbjct  423  FIVQV  427



>ref|XP_008910914.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
 gb|ETN03687.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
Length=428

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V+  S
Sbjct  304  LAEDITVMMHGQEGLKAALDATELLF-GKKQGPLTAEEMLQMAGDAPMTILSRTDVVDQS  362

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            ++DL+V  G ++SK+  RR++K GG+YLNN RV+SEA ++E  +++D KVL++  G++N 
Sbjct  363  LVDLAVRIGAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGRRNN  422

Query  187  MVVRI  173
             +V++
Sbjct  423  FIVQV  427



>ref|WP_041017153.1| tyrosyl-tRNA synthetase [Criblamydia sequanensis]
 emb|CDR33719.1| Tyrosyl-tRNA synthetase [Criblamydia sequanensis CRIB-18]
Length=420

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            ++LAEEVTRFVHG+EGL++AL AT+A  PG ++T LD  ++E    D+P    P + ++ 
Sbjct  294  KKLAEEVTRFVHGEEGLEKALLATKAAAPG-SETVLDADSLEIAMKDMPYFE-P-ELLVG  350

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL   SGL  SKSAARR++++GG+ LNN +++ E K I+ +D++  + ++++ GKK
Sbjct  351  SKLIDLIADSGLRPSKSAARRLIREGGVSLNNKKINDEEKVIQTEDLIGNRFVVVTLGKK  410

Query  193  NKMVVR  176
             KM+V+
Sbjct  411  QKMLVK  416



>ref|XP_002907836.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
 gb|EEY64400.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
Length=428

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LAEE+T  +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V++ S
Sbjct  304  LAEEITVMMHGQEGLKAALDATEMLF-GKKTGPLTSEEMLCMAGDAPMTVLSRADVINQS  362

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            ++DL+V  G  +SK+  RR++K GG+YLNN RV+S A +I + +++D KVL++  G++N 
Sbjct  363  LVDLAVRIGATKSKAECRRLIKSGGVYLNNERVESAALRIGKSNLLDDKVLVVRVGRRNN  422

Query  187  MVVR  176
             +V+
Sbjct  423  FIVQ  426



>ref|WP_040313631.1| tyrosyl-tRNA synthetase [Actinomyces cardiffensis]
Length=420

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 67/126 (53%), Gaps = 3/126 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA EVTR VHG+E LD  L AT AL  G     +D +T+    SD+P   L   +   I 
Sbjct  298  LAAEVTRLVHGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGEATIID  357

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
             L  +        KSAARR L  GG YLNN +V+ E   I  +D++ G  +L+  G++N 
Sbjct  358  ALVETGLEKG---KSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGRRNL  414

Query  187  MVVRIS  170
             VV +S
Sbjct  415  AVVELS  420



>gb|ENO19082.1| tyrosine--tRNA ligase [Actinomyces cardiffensis F0333]
Length=423

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 67/126 (53%), Gaps = 3/126 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA EVTR VHG+E LD  L AT AL  G     +D +T+    SD+P   L   +   I 
Sbjct  301  LAAEVTRLVHGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGEATIID  360

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
             L  +        KSAARR L  GG YLNN +V+ E   I  +D++ G  +L+  G++N 
Sbjct  361  ALVETGLEKG---KSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGRRNL  417

Query  187  MVVRIS  170
             VV +S
Sbjct  418  AVVELS  423



>ref|XP_005707106.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME30586.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
Length=501

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 80/125 (64%), Gaps = 2/125 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNA--DTKLDWKTIEGIASDVPSCSLPFDQvls  374
            LAEEVTR VHG EG+  A + T A  PG    ++ LD+ T+  +  ++PS  +  + +L 
Sbjct  373  LAEEVTRLVHGDEGVKFAQRVTSASSPGRLVEESILDFDTLRQLKDEIPSKEIRKEHLLK  432

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S++++ V  G+++SKS A+R +  GG Y+NN RV+   + I ++D+V+  +LLL  GKK
Sbjct  433  KSLIEVLVECGIMKSKSEAKRFIINGGCYINNRRVEELDRSIGQEDLVENSMLLLGIGKK  492

Query  193  NKMVV  179
             K+++
Sbjct  493  QKILL  497



>ref|WP_022864835.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
Length=421

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA EVTR VHGQE LD+ L ATEAL       ++D KT++G  + +PS ++   +    +
Sbjct  298  LAAEVTRLVHGQEALDQVLAATEALWGSGDLRQVDGKTLKGATAHLPSATVEIGK---TN  354

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            ++DL +++G  + + AA R +K GG YLNN ++    + I  +D++ G ++L   GK+N
Sbjct  355  LVDLLIAAGFEKGRGAAMRTIKNGGAYLNNQKITDPDRTITSEDVLPGSLVLFRKGKRN  413



>ref|WP_013600598.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|ADX72661.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans Sphe3]
Length=438

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 75/131 (57%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG E  ++ + A+ AL  GN D T LD  T++   S++PS ++  D++ 
Sbjct  312  RKLAYEVTSLVHGVEATEKVIAASAALF-GNGDLTALDKTTLQAATSELPSATVQVDEMG  370

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + +L  S  S     KSAARR + +GG Y+NN +V      I E +++ G+ LLL  GK
Sbjct  371  IVDLLVASGLSES---KSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRGK  427

Query  196  KNKMVVRIS*P  164
            KN   V +  P
Sbjct  428  KNLATVEVLVP  438



>ref|XP_009837943.1| tyrosine-tRNA ligase [Aphanomyces astaci]
 gb|ETV72715.1| tyrosine-tRNA ligase [Aphanomyces astaci]
Length=439

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LAE  TR +HG+  L  A  A + L  G+ D       ++ +A D P  SL  + V    
Sbjct  311  LAEHTTRMIHGEVALKAAQVAAKVLFGGSLDGV---DAVDILAIDAPRSSLALELVRGKR  367

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            V+D+      + +K+  RR++K GG+Y+NN RVDS+A  IE   +++G+ +L+  GK+N 
Sbjct  368  VVDVLALIRAVPTKAEGRRLIKAGGVYINNVRVDSDAAVIEASQVIEGRAVLVRVGKRNY  427

Query  187  MVVRIS  170
             V+ IS
Sbjct  428  HVLHIS  433



>ref|WP_044150629.1| tyrosyl-tRNA synthetase, partial [Rothia mucilaginosa]
Length=211

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 71/127 (56%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  LP D++  
Sbjct  87   KTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLPADRLDM  146

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            ISVL     +      S ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GKK
Sbjct  147  ISVLTELGFAKS---NSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGKK  203

Query  193  NKMVVRI  173
            N+  V +
Sbjct  204  NQGAVEL  210



>dbj|BAI65246.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa DY-18]
Length=211

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 71/127 (56%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  LP D++  
Sbjct  87   KTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLPADRLDM  146

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            ISVL     +      S ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GKK
Sbjct  147  ISVLTELGFAKS---NSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGKK  203

Query  193  NKMVVRI  173
            N+  V +
Sbjct  204  NQGAVEL  210



>ref|WP_021271485.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. BSW11_IV]
 gb|EQC46963.1| tyrosine--tRNA ligase [Bacteriovorax sp. BSW11_IV]
Length=423

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LAEEV + VHG+EGL+ AL+AT+    G A TK+  K +  I  DVPS  L  D+ L 
Sbjct  296  KTLAEEVVKLVHGEEGLEAALRATKFFF-GEAITKISDKEVAAIFEDVPSVKL--DKALL  352

Query  373  is---vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
                 + +L V + L  SK  A+R L Q G+ LNN ++D  A K+  D++V    L+L  
Sbjct  353  EEGIEICELLVQTPLFPSKKEAKRSLDQKGVSLNNNKIDDTAMKVTRDNLVSETSLILRK  412

Query  202  GKKNKMVVRI  173
            GKKN  VVR 
Sbjct  413  GKKNYCVVRF  422



>ref|XP_004334902.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR12889.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=480

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LAEEVTR V G++GL  ALKAT  +        L    +  +  DVPS +LP   V+   
Sbjct  353  LAEEVTRLVRGEQGLHTALKATRVMFGDEPVDSLPPSELLAVLKDVPSVTLPRSSVVGQP  412

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            +  L V+     SK  ARR++K GG+Y+N+ RV ++  ++  DD++   + +L  GKK+ 
Sbjct  413  LSGLMVACRATASKGEARRLVKGGGVYVNSKRVPNDDYQVGPDDVLGDALCVLRVGKKSY  472

Query  187  MVVRIS  170
             +V+++
Sbjct  473  FLVKLT  478



>ref|WP_024058184.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
 gb|ETI82476.1| hypothetical protein Q618_VCMC00001G0057 [Varibaculum cambriense 
DORA_20]
Length=421

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA EVTR VHGQE LD+ L ATEAL       ++D  T++G  + +PS  +   +    +
Sbjct  298  LAAEVTRLVHGQEALDQVLAATEALWGSGDLHQVDGNTLKGATAHLPSAKVEIGK---TN  354

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            ++DL +++G  + + AA R +K GG YLNN +V    + I  +D++ G ++L   GK+N 
Sbjct  355  LVDLLIAAGFEKGRGAAMRTIKNGGAYLNNQKVTDPDRVITSEDVLPGSLVLFRKGKRNL  414

Query  187  MVVRI  173
             V  +
Sbjct  415  AVAYL  419



>ref|WP_029668640.1| tyrosyl-tRNA synthetase [Candidatus Ancillula trichonymphae]
Length=418

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEEVT+FVHG+E   +A++A++AL    +  K+D  TI    S + +        +S
Sbjct  295  RKLAEEVTKFVHGREAFVQAVEASDALFGRGSIEKIDEATIIAAISGLETSEANLGDKIS  354

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
               ++  +S+      +  R+ L  GG+Y+NN +V+S  + IE  DI++G+V+LL  GKK
Sbjct  355  EQFVNTKLSASF----NDYRKTLSAGGVYVNNKKVESLDRAIENTDILNGQVVLLRKGKK  410

Query  193  NKMVVRIS  170
            N   VRI+
Sbjct  411  NIAAVRIT  418



>gb|KDO34878.1| tyrosyl-tRNA synthetase [Saprolegnia parasitica CBS 223.65]
Length=429

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 76/130 (58%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + +AE VT  +HG+  L++A +A + L  G+ D  +   T+  I  D P  +L   QV+ 
Sbjct  303  QTVAEHVTTLIHGKNALEQAQRAAKVLFGGSCD-GISAATMLSI--DAPKTALAPAQVIG  359

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++D+    G +++K+  RR++K GGLY+NN RV+S+A   E    ++G+  LL  GK+
Sbjct  360  QKIVDVVGLLGAVKTKAEIRRLIKAGGLYINNVRVESDAAVFESHHAIEGQATLLRTGKR  419

Query  193  NKMVVRIS*P  164
            N  ++ I+ P
Sbjct  420  NYHIIHITTP  429



>ref|WP_041569078.1| tyrosyl-tRNA synthetase [Candidatus Chloracidobacterium thermophilum]
Length=425

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLP--FDQv  380
            R LA  VT FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS  +P      
Sbjct  293  RSLAAAVTEFVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFAD  352

Query  379  lsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
                  DL+V++ L+ SKS ARR+++ GGLY NN RV+S   +I  + ++ G+  +L  G
Sbjct  353  DGALPSDLAVAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRKG  412

Query  199  KKNKMVVRI  173
             +   ++R+
Sbjct  413  ARTYHLLRV  421



>gb|AEP11643.1| tyrosyl-tRNA synthetase [Candidatus Chloracidobacterium thermophilum 
B]
Length=426

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLP--FDQv  380
            R LA  VT FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS  +P      
Sbjct  294  RSLAAAVTEFVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFAD  353

Query  379  lsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
                  DL+V++ L+ SKS ARR+++ GGLY NN RV+S   +I  + ++ G+  +L  G
Sbjct  354  DGALPSDLAVAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRKG  413

Query  199  KKNKMVVRI  173
             +   ++R+
Sbjct  414  ARTYHLLRV  422



>ref|WP_043455304.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|KIC64694.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
Length=437

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 75/131 (57%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG E  ++ + A+ AL  GN D + LD  T++   S++PS ++  D++ 
Sbjct  311  RKLAFEVTSLVHGVEATEKVIAASAALF-GNGDLSTLDKATLQAATSELPSTTVQVDEMG  369

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + +L  S  S     KSAARR + +GG Y+NN +V      I E +++ G+ LLL  GK
Sbjct  370  IVDLLVASGLSES---KSAARRTVGEGGAYVNNEKVSDPDAVISESELLHGQYLLLRRGK  426

Query  196  KNKMVVRIS*P  164
            KN   V +  P
Sbjct  427  KNLATVEVLVP  437



>ref|WP_018200080.1| tyrosyl-tRNA synthetase [Candidatus Hydrogenedens terephthalicus]
Length=427

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 78/126 (62%), Gaps = 2/126 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA E+TR VHG+  L  A++A+EA+  G+   +L+   +E + SDVP    P + +    
Sbjct  301  LAREITRMVHGETALQSAIRASEAMFGGDLH-QLELSVLEDVFSDVPHAEAPINYITENQ  359

Query  367  vld-lsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
             L  L +++G+LESK   +R++K GGLY+NN RV  +  ++ E+ ++ G +L++  GKK+
Sbjct  360  FLLDLLINTGILESKGEGKRLIKNGGLYINNERVTEDTLRLNENYLLGGSLLVIRLGKKD  419

Query  190  KMVVRI  173
              +++ 
Sbjct  420  YRLIQF  425



>ref|WP_021275481.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. Seq25_V]
 gb|EQC43871.1| tyrosine--tRNA ligase [Bacteriovorax sp. Seq25_V]
Length=423

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA EV + VHG+EGL  AL+AT        +   D K I  I  DVPS +L  D +  
Sbjct  297  KTLASEVVKLVHGEEGLASALRATSFFFGEKIENVTD-KEISSIFEDVPSVTLSKDFLNE  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
               L+    + L +SK  ARR ++Q G+ +NN +V +  KK+ +DD+     LL+  GKK
Sbjct  356  GEFLEALAQTPLFKSKGEARRSVEQNGISINNVKVTAVDKKLSKDDLASETALLVKKGKK  415

Query  193  NKMVVRI  173
            N  V++ 
Sbjct  416  NYCVIKF  422



>ref|XP_008605106.1| tyrosyl-tRNA synthetase [Saprolegnia diclina VS20]
 gb|EQC41392.1| tyrosyl-tRNA synthetase [Saprolegnia diclina VS20]
Length=429

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 78/130 (60%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + +AE VT  +HG++ L++A +A + L  G+ D  +   T+  I  D P  +L   QV+ 
Sbjct  303  QTVAEHVTTLIHGKDALEQAQRAAKVLFGGSCD-GISAATMLSI--DAPKTALAPAQVIG  359

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              V+D+    G +++K+  RR++K GGLY+NN RV+S+A   E    ++G+  L+  GK+
Sbjct  360  QKVVDVVGLLGAVKTKAEIRRLIKAGGLYINNVRVESDAAVFESHHAIEGQATLVRTGKR  419

Query  193  NKMVVRIS*P  164
            N  +++I+ P
Sbjct  420  NYHIIQITTP  429



>ref|WP_008470064.1| tyrosyl-tRNA synthetase [Lactobacillus hominis]
 emb|CCI81347.1| Tyrosyl-tRNA synthetase [Lactobacillus hominis DSM 23910 = CRBIP 
24.179]
Length=420

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 69/127 (54%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEEVT+FVHGQEGLDEA   TEAL  GN    L    IE    + PS         +
Sbjct  297  RRLAEEVTKFVHGQEGLDEAQFITEALFKGNV-KDLSVAQIEQGFKNAPSTEAT---KEA  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             +++D  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK +++  GKK
Sbjct  353  KNIVDFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSAFDGKFVIIRKGKK  412

Query  193  NKMVVRI  173
               +VRI
Sbjct  413  KYTLVRI  419



>ref|WP_037233127.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGI99536.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGJ35093.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
Length=434

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ   
Sbjct  310  KRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQAVMSELPSVELSSDQ---  366

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + ++ +    G   SKS ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GKK
Sbjct  367  LDLITVLTELGFASSKSEARRILKEGGASVNGAKVQGEDAVITPEQLLHGKYAIVRRGKK  426

Query  193  NKMVVRI  173
            N+  + +
Sbjct  427  NQGAITV  433



>ref|WP_024366580.1| tyrosyl-tRNA synthetase [Arthrobacter sp. TB 26]
Length=437

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 79/129 (61%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG +  ++ + A+ AL  GN D T LD  T++   S++PS S+      
Sbjct  311  RKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDEATLKAATSELPSASV---DAA  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V++GL ESKSAARR + +GG Y+NNA+V      IE   ++ G+ LLL  GK
Sbjct  367  GLGIIDLLVATGLSESKSAARRTVGEGGAYVNNAKVSDPDALIERGQLLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   V +S
Sbjct  427  KNLATVEVS  435



>gb|KDQ21806.1| hypothetical protein BOTBODRAFT_99200 [Botryobasidium botryosum 
FD-172 SS1]
Length=473

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA EVT  VHG+EG+ +A   T AL   +         I+ + +D     +P  +VL 
Sbjct  345  RMLASEVTELVHGEEGVKQAEATTRALFDTDPSNVRASDVIKALQNDPRLVLVPAAEVLD  404

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              +  LS +     S+S AR++L  GGLYLNN+R+    K +++ D++DG++ +L AGK 
Sbjct  405  EPLTKLSSNFKQTRSRSEARKLLLAGGLYLNNSRIQDVNKVLQQSDLIDGRLAILRAGKD  464

Query  193  NKMVVRI  173
            N +++ +
Sbjct  465  NHLIIAL  471



>ref|WP_028912082.1| tyrosyl-tRNA synthetase [Prevotella sp. MA2016]
Length=431

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 73/130 (56%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQ  383
            +RLAEEVT  VH QE LD A++A+  L   +      KLD +T+  +   VP   +  DQ
Sbjct  301  KRLAEEVTVMVHSQEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQ  360

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  DD++DGK LL   
Sbjct  361  LGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITADDLIDGKYLLAQK  420

Query  202  GKKNKMVVRI  173
            GKKN  ++ +
Sbjct  421  GKKNYYLLIV  430



>ref|WP_006889016.1| tyrosyl-tRNA synthetase [Rothia aeria]
 gb|EID50266.1| tyrosine--tRNA ligase [Rothia aeria F0474]
Length=434

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ   
Sbjct  310  KRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQ---  366

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + ++ +    G   SKS ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GKK
Sbjct  367  LDLITVLTELGFASSKSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGKK  426

Query  193  NKMVVRI  173
            N+  + +
Sbjct  427  NQGAITV  433



>gb|ERT67692.1| tyrosine--tRNA ligase [Rothia aeria F0184]
Length=439

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ   
Sbjct  315  KRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQ---  371

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + ++ +    G   SKS ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GKK
Sbjct  372  LDLITVLTELGFASSKSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGKK  431

Query  193  NKMVVRI  173
            N+  + +
Sbjct  432  NQGAITV  438



>ref|WP_039240672.1| tyrosyl-tRNA synthetase [Arthrobacter sp. MWB30]
 gb|KIA73795.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. MWB30]
Length=436

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D   
Sbjct  311  KKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATINAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I  D+++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSESKSAARRTVGEGGAYVNNTKVSDPDAVIAPDELLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   + +S
Sbjct  427  KNLATIEVS  435



>ref|WP_021949404.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1124]
 emb|CCY65731.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1124]
Length=486

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 75/130 (58%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVT  VH +E LD A++A+  L   +      KLD +T+  I   VP   +  DQ
Sbjct  355  RRLAEEVTVMVHSREALDAAIEASNILFGKSTKESLLKLDEQTLLDIFEGVPQYEIGRDQ  414

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   +V   + ++ +  SK   R++++ GG+ LN  ++ +  ++I  DD++DGK LL+  
Sbjct  415  LGQPAVEIFTQAAAVFASKGEMRKLVQGGGVSLNKEKLTAFDRQITADDLIDGKYLLVQR  474

Query  202  GKKNKMVVRI  173
            GKKN  +V +
Sbjct  475  GKKNYYLVIV  484



>emb|CCQ46715.1| tyrosyl-tRNA synthetase [Arthrobacter siccitolerans]
Length=437

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 82/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG E  ++ + A+ AL  GN D + LD +T++   S++PS ++  D   
Sbjct  311  RKLAFEVTALVHGVEATEKVIAASAALF-GNGDLSALDKQTLQAATSELPSTTVQVD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
            ++ ++DL V+SGL +SKSAARR + +GG Y+NN +V      I E +++ G+ LLL  GK
Sbjct  367  ALGIVDLLVASGLSDSKSAARRTVGEGGAYVNNEKVLDPEAVISESELLHGQYLLLRRGK  426

Query  196  KNKMVVRIS*P  164
            KN   V +  P
Sbjct  427  KNLATVEVLVP  437



>ref|WP_013559196.1| tyrosyl-tRNA synthetase [Anaerolinea thermophila]
 dbj|BAJ62803.1| tyrosyl-tRNA synthetase [Anaerolinea thermophila UNI-1]
Length=426

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA  +T+ +HG+  L  A +A++AL  G  +T L    I  I S+VPSC +P  Q+  
Sbjct  297  RALARAMTQMIHGETALARAEQASQALFGGELET-LTAAEIADIFSEVPSCEVPRHQLEG  355

Query  373  isvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
                 + +      +KS   ARR +++GG+Y+NN RV+   + +   D + G+ ++L  G
Sbjct  356  EGYPLVDLLVTAGVAKSKGEARRNIQEGGIYVNNRRVEDLNRAVHLQDALQGQFVVLRKG  415

Query  199  KKNKMVVRI  173
            +KN  +VR+
Sbjct  416  RKNYTLVRL  424



>ref|WP_042457579.1| tyrosyl-tRNA synthetase [Streptacidiphilus jiangxiensis]
Length=421

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEE+T  VHGQE LD A+ A++AL       +LD +T+    +++PS  +       
Sbjct  296  RALAEELTVLVHGQEQLDRAVAASKALFGQGELGELDERTLAAAVAELPSAQV----GEL  351

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL V++GL  S+SAARR + +GG Y+NNA+++ EA      D++ G+ L+L  GK+
Sbjct  352  GEIVDLFVATGLSASRSAARRTVNEGGAYVNNAKIEDEAALATPADLLHGRWLVLRRGKR  411

Query  193  NKMVVRI  173
            N   V +
Sbjct  412  NLAAVEL  418



>ref|WP_037604940.1| tyrosyl-tRNA synthetase [Streptacidiphilus rugosus]
Length=420

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEE+T  VHGQE LD A+ A++AL       +LD +T+    +++PS  +       
Sbjct  296  RALAEELTVMVHGQEQLDRAIAASKALFGQGELAELDERTLAAAVAELPSAKV----TEL  351

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL V++GL  S+SAARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK+
Sbjct  352  GEIVDLFVATGLSASRSAARRTVGEGGAYVNNTKVEDEAALATPADLLHGRWLVLRRGKR  411

Query  193  NKMVVRIS  170
            N   V ++
Sbjct  412  NLAAVELT  419



>ref|WP_030266695.1| tyrosyl-tRNA synthetase [Streptacidiphilus jeojiense]
Length=422

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = -1

Query  541  EEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvl  362
            E+VT  VHGQE LD A+ A++AL      T+LD  T++   +++P   +        S++
Sbjct  300  EDVTTLVHGQEQLDRAIAASKALFGQGDLTELDAATLDAAVAELPQAQV----GELASIV  355

Query  361  dlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  182
            DL  ++GL+ SKSAARR +K+GG YLNNA+V  E     E D++ G+ LLL  GK++   
Sbjct  356  DLLAATGLVPSKSAARRAVKEGGAYLNNAKVTDEEAAPTEADLLHGRWLLLRRGKRSLAA  415

Query  181  VRI  173
            V +
Sbjct  416  VEL  418



>ref|WP_017197962.1| tyrosyl-tRNA synthetase [Arthrobacter sp. M2012083]
Length=436

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D   
Sbjct  311  KKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATVGAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I  D+++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   + +S
Sbjct  427  KNLATIEVS  435



>ref|WP_016998371.1| tyrosyl-tRNA synthetase [Kocuria atrinae]
Length=434

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 72/127 (57%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA EV   VHG+E   +A+ A+ A+        LD +T+  IA+++P   +  DQ   
Sbjct  310  KALAYEVNTLVHGEEATRKAIAASAAVFGKGQFADLDEETLAMIAAELPHAEVGADQTSI  369

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + +L  +  S     KSAARR+LK+GG+ +NN +V  E   +E +D++ G+ +LL  GKK
Sbjct  370  VDLLVATGLSES---KSAARRILKEGGVSVNNHKVSGEDATLEPEDLLHGRFVLLRRGKK  426

Query  193  NKMVVRI  173
            N   V +
Sbjct  427  NLAAVTV  433



>ref|WP_013132266.1| tyrosyl-tRNA synthetase [Thermobispora bispora]
 gb|ADG88733.1| tyrosyl-tRNA synthetase [Thermobispora bispora DSM 43833]
Length=421

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAE+VT  VHG+E L+  + A+ AL       +LD +T+E   ++VP   +P    L 
Sbjct  297  RALAEDVTALVHGREELERVVAASRALFGHGTLQELDERTLEAALNEVPKAKVP---ALG  353

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
               +DL  +SG++ESKSAARR +++GG YLNN +V  E      DD++ G+ L+L  GKK
Sbjct  354  APYVDLLAASGIVESKSAARRAVREGGAYLNNVKVTDEDYVPTADDLLHGRFLVLRRGKK  413

Query  193  N  191
             
Sbjct  414  T  414



>ref|WP_018779124.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 161MFSha2.1]
Length=436

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D   
Sbjct  311  KKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATINAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I  D+++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSESKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   + ++
Sbjct  427  KNLATIEVA  435



>ref|WP_010528768.1| tyrosyl-tRNA synthetase [Thermophagus xiamenensis]
Length=430

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (58%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGN-ADT--KLDWKTIEGIASDVPSCSLPFD-  386
            +RLAEEVT+ VHGQ+ L  A+ A++ L   N  DT  KLD +T+  +   VP+ ++    
Sbjct  298  KRLAEEVTQLVHGQDALQMAVDASQILFGKNVTDTLRKLDERTLLSVFEGVPTFNISRKN  357

Query  385  -QvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +     +  ++  + +  SK  ARR LK GGL +N  +V SE KK+   D+++ K LL+
Sbjct  358  LEQGIGVIDLVAGETPIFPSKGEARRTLKGGGLGINKEKVQSEDKKVNSSDLLNDKYLLV  417

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  418  QKGKKNYYLVIV  429



>ref|WP_018771549.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 162MFSha1.1]
Length=437

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 79/131 (60%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG +  ++ + A+ AL  GN D   LD  T++   S++PS ++  D   
Sbjct  311  RKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPSATVQVD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E +++ G+ LLL  GK
Sbjct  367  GMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRGK  426

Query  196  KNKMVVRIS*P  164
            KN   V +  P
Sbjct  427  KNLATVEVLVP  437



>ref|XP_008868076.1| tyrosine-tRNA ligase [Aphanomyces invadans]
 gb|ETW03847.1| tyrosine-tRNA ligase [Aphanomyces invadans]
Length=434

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 5/127 (4%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGI-ASDVPSCSLPFDQvlsi  371
            LAE  T+ +HG + L  A  A   L  G+    LD  T   I A D P   L + ++   
Sbjct  310  LAEHATKMIHGSDALKAAQVAANVLFGGS----LDGVTASDILAIDAPRSGLRWSELQGK  365

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
              +D+  + G + SK+  RR++K GG+Y+NN RVDS+A  I+   IV G+ +L+  GK+N
Sbjct  366  RAVDVLATIGAIPSKAEGRRLIKAGGVYVNNVRVDSDAAVIDASQIVQGRAVLVRVGKRN  425

Query  190  KMVVRIS  170
              V+ ++
Sbjct  426  YHVIHVT  432



>ref|WP_004355960.1| tyrosyl-tRNA synthetase [Prevotella disiens]
 gb|EFL46699.1| tyrosine--tRNA ligase [Prevotella disiens FB035-09AN]
 gb|ERJ79539.1| tyrosine--tRNA ligase [Prevotella disiens JCM 6334 = ATCC 29426]
 gb|KGF48647.1| tyrosyl-tRNA synthetase [Prevotella disiens DNF00882]
Length=432

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 72/131 (55%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVTR VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  D 
Sbjct  301  RRLAEEVTRMVHSQEDLDMAIAASNILFGKSTKENLLQLDEQTFNDVFKDVPHYEISKDL  360

Query  382  vlsisvldlsvssglle-SKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + I  +D++DGK LL+ 
Sbjct  361  LGQPAVEVFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLMQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  +V +
Sbjct  421  KGKKNYFLVIV  431



>ref|WP_015936720.1| tyrosyl-tRNA synthetase [Arthrobacter chlorophenolicus]
 gb|ACL39499.1| tyrosyl-tRNA synthetase [Arthrobacter chlorophenolicus A6]
Length=437

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 81/131 (62%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT-KLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG E  ++ + A+ AL  GN D   LD +T++   S++P+ ++  D   
Sbjct  311  RKLAFEVTSLVHGVEATEKVIAASAALF-GNGDLGALDKQTLQAATSELPTATVQVD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
            ++ ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E +++ G+ LLL  GK
Sbjct  367  ALGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVLDPETVIAESELLHGQYLLLRRGK  426

Query  196  KNKMVVRIS*P  164
            KN   V +  P
Sbjct  427  KNLATVEVLVP  437



>ref|WP_003798662.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis]
 dbj|GAB12490.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis NBRC 12137]
Length=437

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG E  ++ + A+ A+  GN D + LD +T+    +++PS S+      
Sbjct  311  RKLAYEVTALVHGAEATEKVIAASAAVF-GNGDLSVLDEQTLAAATAELPSASV---DGT  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL +SKSAARR++ +GG Y+NNA+V      I    ++ GK LLL  GK
Sbjct  367  GLGIIDLLVASGLSDSKSAARRVVGEGGAYVNNAKVTDPDAVIPPSQLLHGKYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   V++S
Sbjct  427  KNLATVQVS  435



>ref|WP_024332044.1| tyrosyl-tRNA synthetase [Actinomyces neuii]
Length=420

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 73/125 (58%), Gaps = 5/125 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvl  377
            + LAE VTR VHG +  D+ L ATEAL  G  D K +D KT+      +P+      +V 
Sbjct  296  KALAESVTRLVHGDQATDQVLAATEALW-GKGDLKAIDEKTLASATESLPATHF---EVG  351

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
            + SV+DL V +GL   K AARR +K GG YLNN +V+ E + I   D++ G  +L+  GK
Sbjct  352  TSSVVDLLVGTGLERGKGAARRTIKSGGAYLNNVKVEDEDRVISTSDLLSGGKVLIRKGK  411

Query  196  KNKMV  182
            +N  V
Sbjct  412  RNLAV  416



>ref|WP_042380116.1| tyrosyl-tRNA synthetase [Streptacidiphilus melanogenes]
Length=420

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEE+T  VHGQ+ LD A+ A++AL      ++LD  T+    +++PS  +       
Sbjct  296  RALAEELTVLVHGQDQLDRAVAASKALFGQGDLSELDAPTLAAAVAELPSAQV----GEL  351

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL V++GL  S+SAARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK+
Sbjct  352  GELVDLFVATGLSASRSAARRTINEGGAYVNNTKVEDEAATAAPADLLHGRWLVLRRGKR  411

Query  193  NKMVVRI  173
            N   V +
Sbjct  412  NLAAVEL  418



>ref|WP_024963599.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
Length=418

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 68/127 (54%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEEVT +VHG E  + A +A+  L        LD +T+    +++PS     +  + 
Sbjct  296  RVLAEEVTTWVHGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASMNDAVV  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++ L +  G      AARR +  GGLY+NN ++D   + IEE D++ G ++LL  GKK
Sbjct  356  DVLVSLGLEKGA----GAARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGKK  411

Query  193  NKMVVRI  173
            N   + I
Sbjct  412  NMTAIHI  418



>ref|WP_026547366.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 80/129 (62%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D   
Sbjct  311  KKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVAAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I +D ++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   + +S
Sbjct  427  KNLATIEVS  435



>ref|WP_018763582.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 135MFCol5.1]
Length=437

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            R+LA EVT  VHG +  ++ + A+ AL  GN D   LD  T++   S++P+ ++  D   
Sbjct  311  RKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPTTTVQVD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E +++ G+ LLL  GK
Sbjct  367  GMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRGK  426

Query  196  KNKMVVRIS*P  164
            KN   V +  P
Sbjct  427  KNLATVEVLVP  437



>ref|WP_026541624.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 80/129 (62%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D   
Sbjct  311  KKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVAAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I +D ++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   + +S
Sbjct  427  KNLATIEVS  435



>ref|WP_014921325.1| tyrosyl-tRNA synthetase [Arthrobacter sp. Rue61a]
 gb|AFR28470.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. Rue61a]
Length=436

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D   
Sbjct  311  KKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATIGAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I  ++++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIAREELLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   + +S
Sbjct  427  KNLATIEVS  435



>ref|WP_034510938.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
 gb|KGE99688.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
Length=421

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 5/125 (4%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA EVT+ VHG+E L   L+AT+AL       K+D  T+    S++P+  + F +   + 
Sbjct  298  LAAEVTKLVHGEETLQRVLEATDALWGSGDLKKVDAATLSAATSELPAGEVAFGEATIVD  357

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIE-EDDIVDGKVLLLSAGKKN  191
             L  +        K AAR  +  GG YLNN RV+SE + I  ED + DG V L+  G++N
Sbjct  358  ALVAAGLEKG---KRAARTTVSSGGAYLNNERVESEDQIISAEDALADGTV-LIRKGRRN  413

Query  190  KMVVR  176
              VVR
Sbjct  414  LAVVR  418



>gb|AAP58586.1| putative tyrosyl-tRNA synthetase [uncultured Acidobacteria bacterium]
Length=422

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 70/128 (55%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA EVTR VHG + + +A  A+E L  G+  T++    +  + ++VPS ++ F     
Sbjct  295  RELAREVTRLVHGSQAVLDAEAASEKLFRGDV-TQMSVDELLQVFANVPSSTVAFSDDGW  353

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
                 ++        K  A+R+++ GGLY+N  R+  E  ++  +D + G+V ++  GKK
Sbjct  354  ALADLVTSVGVTKS-KGEAQRLVRAGGLYVNERRIGEEKARLTAEDAIGGQVFVIRKGKK  412

Query  193  NKMVVRIS  170
            +  +VRIS
Sbjct  413  DNFLVRIS  420



>ref|WP_025000389.1| tyrosyl-tRNA synthetase [Prevotella aurantiaca]
Length=432

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  D
Sbjct  301  RRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSKD  359

Query  385  Qvlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + I  +D++DGK LL+
Sbjct  360  LLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLV  419

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  420  QKGKKNYFLVIV  431



>ref|WP_036910525.1| tyrosyl-tRNA synthetase [Prevotella sp. FD3004]
Length=431

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQ  383
            +RLAEEVT  VH QE L+ A++A+  L   +      KLD +T   +   VP   +  DQ
Sbjct  301  KRLAEEVTVMVHSQEALNTAIEASNILFGKSTKESLEKLDEQTFLDVFDGVPQFEICKDQ  360

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   ++  L+ ++ +  SK   R+M++ GG+ LN  ++  + + I  DD++DGK LL   
Sbjct  361  LGQPAIELLTTAAPVFPSKGEMRKMVQGGGVSLNKEKITDQNQAITADDLIDGKYLLAQK  420

Query  202  GKKNKMVVRI  173
            GKKN  ++ +
Sbjct  421  GKKNYYLLIV  430



>ref|WP_025295943.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AHU89057.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AJC69525.1| tyrosyl-tRNA synthetase [Trueperella pyogenes TP8]
Length=418

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 68/127 (54%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEEVT +VHG E  + A +A+  L        LD +T+    +++PS     +  + 
Sbjct  296  RVLAEEVTTWVHGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASVNDAVV  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++ L +  G      AARR +  GGLY+NN ++D   + IEE D++ G ++LL  GKK
Sbjct  356  DVLVSLGLEKGA----GAARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGKK  411

Query  193  NKMVVRI  173
            N   + I
Sbjct  412  NMTAIHI  418



>ref|WP_023925721.1| tyrosyl-tRNA synthetase [Prevotella nigrescens]
 gb|ETD28509.1| tyrosyl-tRNA synthetase [Prevotella nigrescens CC14M]
Length=432

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  D
Sbjct  301  RRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSKD  359

Query  385  Qvlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + I  +D++DGK LL+
Sbjct  360  LLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLV  419

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  420  QKGKKNYFLVIV  431



>ref|WP_004362948.1| tyrosyl-tRNA synthetase [Prevotella nigrescens]
 gb|ELX67681.1| tyrosyl-tRNA synthetase [Prevotella nigrescens F0103]
Length=432

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  D
Sbjct  301  RRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSKD  359

Query  385  Qvlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + I  +D++DGK LL+
Sbjct  360  LLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLV  419

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  420  QKGKKNYFLVIV  431



>ref|WP_028905488.1| tyrosyl-tRNA synthetase [Prevotella intermedia]
Length=432

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  D
Sbjct  301  RRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSKD  359

Query  385  Qvlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + I  +D++DGK LL+
Sbjct  360  LLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLV  419

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  420  QKGKKNYFLVIV  431



>ref|WP_021267070.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. BAL6_X]
 gb|EPZ51444.1| tyrosine--tRNA ligase [Bacteriovorax sp. BAL6_X]
Length=421

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEE+   VHG+EG+D ALKAT+       +   D + + GI  DVPS  L   Q+  
Sbjct  295  KRLAEEIVTLVHGKEGIDAALKATDFFFGKVIENTTDAE-LAGIFDDVPSVELEKSQLGE  353

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I+ LD+  S+ L +SK  AR+M+ Q G+ +NN +  +    I   D+     L+L  GKK
Sbjct  354  INYLDMLASTPLFKSKGEARKMVSQNGVAINNIKNANVEHIITTSDLASESCLILRKGKK  413

Query  193  NKMVVRI  173
            N  VV+ 
Sbjct  414  NYCVVKF  420



>ref|WP_014709256.1| tyrosyl-tRNA synthetase [Prevotella intermedia]
 gb|AFJ09408.1| tyrosine--tRNA ligase [Prevotella intermedia 17]
Length=432

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  D
Sbjct  301  RRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSKD  359

Query  385  Qvlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + I  +D++DGK LL+
Sbjct  360  LLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLV  419

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  420  QKGKKNYFLVIV  431



>ref|WP_006823030.1| tyrosyl-tRNA synthetase [Corynebacterium casei]
 emb|CCE55574.1| tyrosine--tRNA ligase [Corynebacterium casei UCMA 3821]
 gb|AHI20118.1| tyrosyl-tRNA ligase [Corynebacterium casei LMG S-19264]
Length=421

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 69/126 (55%), Gaps = 2/126 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLA+E+T  VHG++       A +AL      T+LD KT+EG  S+     L  ++  +
Sbjct  294  RRLAQEMTNLVHGEDATKAVELAAQALFGRAELTELDEKTLEGALSETNVAELGAEESFN  353

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I  L ++        K AARR +K+GG Y+NN R++SE     ED+ + G  L++  GKK
Sbjct  354  IVDLLVASGLADS--KGAARRTIKEGGAYVNNERIESEDWAPSEDNFLHGAWLVMRRGKK  411

Query  193  NKMVVR  176
            N   +R
Sbjct  412  NFAAIR  417



>ref|WP_018657964.1| tyrosyl-tRNA synthetase [Actinomadura flavalba]
Length=426

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEE+T  VHG +     + A+ AL    +  +LD +T+    ++VP  +LP      
Sbjct  298  RALAEEMTTLVHGADETARVIAASRALFGQGSLDELDERTLRSALAEVPRAALP--SGAL  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              V DL V+SGL +SKS ARR ++QGG YLNNA+V++E      DD++ G+ L+L  GK+
Sbjct  356  PPVADLLVASGLCKSKSEARRAIQQGGAYLNNAKVEAEDAVPAADDLLHGRYLVLRRGKR  415

Query  193  N  191
            N
Sbjct  416  N  416



>ref|WP_036788433.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
 gb|KGL51208.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
 gb|KGN93641.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
Length=431

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            +RLAEEVT  VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP D
Sbjct  298  KRLAEEVTCMVHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPMD  356

Query  385  Qvl---sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVL  215
            ++       +  L+    +  S+   R++LK GG+ +N  +V+SE   +   D++ GK +
Sbjct  357  KINGEGINILDLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKYI  416

Query  214  LLSAGKKNKMVVRIS  170
            L   GKKN  ++  +
Sbjct  417  LAQKGKKNYFLITFA  431



>ref|WP_036847792.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH1349]
 gb|KGN68587.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH1349]
Length=431

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            +RLAEEVT  VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP D
Sbjct  298  KRLAEEVTCMVHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPMD  356

Query  385  Qvl---sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVL  215
            ++       +  L+    +  S+   R++LK GG+ +N  +V+SE   +   D++ GK +
Sbjct  357  KINGEGINILDLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKYI  416

Query  214  LLSAGKKNKMVVRIS  170
            L   GKKN  ++  +
Sbjct  417  LAQKGKKNYFLITFA  431



>ref|WP_036865421.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH2963]
 gb|KGN94389.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH2963]
Length=431

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            +RLAEEVT  VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP D
Sbjct  298  KRLAEEVTCMVHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPMD  356

Query  385  Qvl---sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVL  215
            ++       +  L+    +  S+   R++LK GG+ +N  +V+SE   +   D++ GK +
Sbjct  357  KINGEGINILDLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKYI  416

Query  214  LLSAGKKNKMVVRIS  170
            L   GKKN  ++  +
Sbjct  417  LAQKGKKNYFLITFA  431



>ref|WP_004366699.1| tyrosyl-tRNA synthetase [Prevotella nigrescens]
 gb|EGQ14566.1| tyrosine--tRNA ligase [Prevotella nigrescens ATCC 33563]
Length=432

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  D
Sbjct  301  RRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSKD  359

Query  385  Qvlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +   +V   +     +  SKS  R+++K GG+ LN  R+ +  + I  ++++DGK LL+
Sbjct  360  LLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKERLQAFDQVITAENLIDGKYLLV  419

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  420  QKGKKNYFLVIV  431



>ref|WP_016445042.1| tyrosyl-tRNA synthetase [Actinomyces europaeus]
 gb|EPD29409.1| tyrosine-tRNA ligase [Actinomyces europaeus ACS-120-V-Col10b]
Length=421

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (60%), Gaps = 5/127 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA EVT+ VHG+E L   L+AT+AL  G    K+D  T+    +++PS  + F +   
Sbjct  296  KTLAAEVTKLVHGEETLQRVLEATDALWGGGDLKKIDPATLSAATAELPSGKIVFGE---  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIE-EDDIVDGKVLLLSAGK  197
             +++D  V++GL + K AAR  +  GG YLNN RV++E   I  ED + DG V L+  G+
Sbjct  353  ATIVDALVAAGLEKGKRAARTTVASGGAYLNNERVENEDLIISGEDALADGTV-LIRKGR  411

Query  196  KNKMVVR  176
            +N  VVR
Sbjct  412  RNLAVVR  418



>ref|WP_030504916.1| tyrosyl-tRNA synthetase [Microbispora rosea]
Length=421

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAE++T  VHG + L   + A+ AL    +  +LD +T+E   ++VP   +P    L 
Sbjct  297  RALAEDLTTLVHGSDELARVIAASRALFGQGSLAELDARTLESALAEVPKAVVP---TLG  353

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
               ++L   SGL+ESKSAARR +K+GG YLNN ++  E      DD++ G+ L+L  GKK
Sbjct  354  APYVELLAQSGLVESKSAARRAVKEGGAYLNNTKITDEEYVPSADDLLHGRFLVLRRGKK  413

Query  193  N  191
             
Sbjct  414  T  414



>ref|WP_028931561.1| tyrosyl-tRNA synthetase [Pseudonocardia asaccharolytica]
Length=426

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 73/128 (57%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEE+T  VHG+    + + A++AL       +LD  T++   ++VP+ ++   +  +
Sbjct  299  RRLAEELTTLVHGEHQTRQVVAASQALFGRGELAELDAATLDAAMAEVPTATVRIGERPT  358

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I  L +         + AARR +K+GG Y+NNA+V  EA    E D++ G+ L++  GK+
Sbjct  359  IVDLLVETGLTDS--RGAARRTVKEGGAYVNNAKVADEAWLPGEADLLHGRWLVVRRGKR  416

Query  193  NKMVVRIS  170
            N   VR++
Sbjct  417  NMAGVRVA  424



>ref|WP_017176881.1| tyrosyl-tRNA synthetase [Actinomyces timonensis]
Length=420

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 3/126 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA EVTR+VHG+  L +A  AT AL      T +D  T+    +D+PS  L   +   
Sbjct  296  RALAREVTRWVHGEAALAQAEVATAALWGRGDLTGIDEATMAAATADLPSAELVVGESTI  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + +L  +        + AARR +  GG YLNNA+V  E   + E D++ G V+L+  G++
Sbjct  356  VDLLVGAGLEKG---RGAARRTIAAGGAYLNNAKVTDEEAVVTESDLLAGGVVLVRKGRR  412

Query  193  NKMVVR  176
               V R
Sbjct  413  TLSVAR  418



>ref|WP_021277367.1| tyrosine--tRNA ligase domain protein, partial [Bacteriovorax 
sp. DB6_IX]
 gb|EQC51535.1| tyrosine--tRNA ligase domain protein, partial [Bacteriovorax 
sp. DB6_IX]
Length=183

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSL--PFDQv  380
            + LAEEV + VHG+EGL+ AL+AT        +   D + +  I  DVP+ +L   F + 
Sbjct  55   KALAEEVVKLVHGEEGLEAALRATSFFFGQKIENVTDAQ-LSSIFEDVPAITLEKSFLEG  113

Query  379  lsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
                 L++   +   +SK  ARR ++Q G+ +NN +V    KKI  +D+     L++  G
Sbjct  114  EGGDYLEMLAQTPFFKSKGEARRSVQQNGVAINNVKVADVEKKITSEDLASETSLIIKKG  173

Query  199  KKNKMVVRIS  170
            KKN  VV+ +
Sbjct  174  KKNYCVVKFN  183



>ref|WP_028271895.1| tyrosyl-tRNA synthetase [Arthrobacter sp. UNC362MFTsu5.1]
Length=437

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLA EVT  VHG E  ++ + A+ AL  G     LD +T+    +++PS  +  D    
Sbjct  311  RRLAFEVTSLVHGVEATEKVIAASAALFGGGDLAALDERTLTAATAELPSARVAAD---G  367

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I   +++ G+ LLL  GKK
Sbjct  368  LGIVDLLVASGLSDSKSAARRTVGEGGAYVNNTKVTDPEAVIPGSELLHGRYLLLRRGKK  427

Query  193  NKMVVRIS  170
            N   V ++
Sbjct  428  NLATVEVA  435



>ref|WP_007000220.1| tyrosyl-tRNA synthetase [Actinobaculum massiliense]
 gb|EKU95914.1| tyrosine-tRNA ligase [Actinobaculum massiliae ACS-171-V-Col2]
Length=424

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA +VT +VHG E  +    A+ AL  G    +LD  T+    +++PS      Q + 
Sbjct  296  RTLARDVTTWVHGAEATERVEAASRALFGGEELFELDVATLRDAVAELPSTGAEVGQPVV  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
               +      G+     AARR +  GGLY+NN +VD +A  +  + I+DG ++LL  GKK
Sbjct  356  ELFVGTGQERGI----GAARRTVASGGLYINNQKVDDDAAVLSAEQILDGGLVLLRKGKK  411

Query  193  NKMVVRI  173
            N  V R+
Sbjct  412  NLAVARV  418



>ref|WP_028903046.1| MULTISPECIES: tyrosyl-tRNA synthetase [Prevotella]
Length=431

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 73/130 (56%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQ  383
            +RLAEEVT  VH QE L+ A++A+  L   +      KLD +T+  +   VP   +  DQ
Sbjct  301  KRLAEEVTVLVHSQEALNTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQ  360

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   
Sbjct  361  LGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQK  420

Query  202  GKKNKMVVRI  173
            GKKN  ++ +
Sbjct  421  GKKNYYLLIV  430



>ref|WP_013398793.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|ADP41072.1| tyrosine--tRNA ligase [Rothia dentocariosa ATCC 17931]
Length=434

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA EVT  VHG E  ++A+ A+EAL        LD  T++ +  ++PS  L  D++  
Sbjct  310  KRLAYEVTALVHGVEPTEQAIAASEALFGKGDFAALDESTLQAVMDELPSVELSSDRLDL  369

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I+ L     +     KS ARR+LK+GG  +N  +V  E  +I  + ++ GK  ++  GKK
Sbjct  370  ITALTELGFASS---KSEARRILKEGGASVNGVKVQGEDARISSEQLLHGKYAIVRRGKK  426

Query  193  NKMVVRI  173
            N+  + +
Sbjct  427  NQGAITV  433



>ref|WP_041818421.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
Length=420

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  297  KRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK+
Sbjct  353  KNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGKR  412

Query  193  NKMVVRI  173
               +V+I
Sbjct  413  KYTLVKI  419



>ref|WP_037274388.1| tyrosyl-tRNA synthetase [Rhodococcus rhodnii]
Length=424

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPF-DQvl  377
            +RLAEE T  VHG++   + + A++AL  G    +LD  T++   ++VP+  +   DQ  
Sbjct  298  KRLAEEFTNLVHGEKETQQVIAASQALFGGGELRELDAGTLDAAMAEVPTGDVRLADQPT  357

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + VL  S          AARR + +GG Y+NN R+ ++  +   DD++ GK L++  GK
Sbjct  358  IVEVLVASGLVAG---NGAARRTVSEGGAYVNNTRIGADDWRPTADDLLHGKWLVVRKGK  414

Query  196  KNKMVVRIS  170
            +N   VR+S
Sbjct  415  RNTAGVRVS  423



>ref|WP_033150736.1| tyrosyl-tRNA synthetase [Prevotella sp. RM4]
Length=431

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 73/130 (56%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQ  383
            +RLAEEVT  VH +E LD A++A+  L   +      KLD +T+  +   VP   +  DQ
Sbjct  301  KRLAEEVTVLVHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQ  360

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   
Sbjct  361  LGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQK  420

Query  202  GKKNKMVVRI  173
            GKKN  ++ +
Sbjct  421  GKKNYYLLIV  430



>ref|WP_013064850.1| tyrosyl-tRNA synthetase [Prevotella ruminicola]
 gb|ADE82864.1| tyrosine--tRNA ligase [Prevotella ruminicola 23]
Length=431

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 73/130 (56%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQ  383
            +RLAEEVT  VH +E LD A++A+  L   +      KLD +T+  +   VP   +  DQ
Sbjct  301  KRLAEEVTVLVHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQ  360

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   
Sbjct  361  LGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQK  420

Query  202  GKKNKMVVRI  173
            GKKN  ++ +
Sbjct  421  GKKNYYLLIV  430



>gb|AHA96684.1| tyrosyl-tRNA synthase [Lactobacillus johnsonii N6.2]
Length=426

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  303  KRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  358

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK+
Sbjct  359  KNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGKR  418

Query  193  NKMVVRI  173
               +V+I
Sbjct  419  KYTLVKI  425



>ref|WP_005507861.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa]
 gb|EET75880.1| tyrosine--tRNA ligase [Rothia mucilaginosa ATCC 25296]
Length=434

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  L  D++  
Sbjct  310  KTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLSEDRLDM  369

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            ISVL     +      S ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GKK
Sbjct  370  ISVLTELGFAKS---NSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGKK  426

Query  193  NKMVVRI  173
            N+  V +
Sbjct  427  NQGAVEL  433



>ref|WP_014243863.1| tyrosyl-tRNA synthetase [Bacteriovorax marinus]
 emb|CBW26079.1| putative tyrosyl-tRNA synthetase [Bacteriovorax marinus SJ]
Length=423

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 68/127 (54%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA+EVT+ VHGQEGLD AL+AT+       +   D   +  I  D PS  L  + +  
Sbjct  297  KSLAQEVTKLVHGQEGLDAALRATQFFFGEKIENVSD-ADVASIFEDTPSVELSSEMLNE  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              V+D+   + L +SK   RR + Q G+Y+NN  ++   + + + D+     L+L  GKK
Sbjct  356  GGVIDMLSETPLFKSKKEVRRAIDQKGIYINNVAIEGPTQTLSKADLASETALVLRKGKK  415

Query  193  NKMVVRI  173
            N  VV+ 
Sbjct  416  NYCVVKF  422



>ref|WP_028266666.1| tyrosyl-tRNA synthetase [Arthrobacter sp. MA-N2]
Length=436

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            RRLA EVT  VHG +  ++ + A+ AL  GN D + LD  T+    +++PS S+  D   
Sbjct  311  RRLAYEVTSLVHGVDATEKVIAASAALF-GNGDLSVLDEVTLASATAELPSASISAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL ESKSAARR + +GG Y+NN++V      I+  +++ G+ LLL  GK
Sbjct  367  GLGIVDLLVASGLSESKSAARRTVGEGGAYVNNSKVTDPDAVIDRAELLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   V ++
Sbjct  427  KNLATVEVT  435



>ref|WP_042427072.1| tyrosyl-tRNA synthetase [Streptacidiphilus anmyonensis]
Length=420

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAEE+T  VHGQ+ LD A+ A++AL       +LD  T+    +++PS  +       
Sbjct  296  RALAEELTVLVHGQDQLDRAVAASKALFGQGDLGELDAPTLAAAVAELPSAQV----GEL  351

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL V++GL  S+SAARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK+
Sbjct  352  GELVDLFVATGLSASRSAARRTINEGGAYVNNTKVEDEAATASPADLLHGRWLVLRRGKR  411

Query  193  NKMVVRI  173
            N   + +
Sbjct  412  NLAAIEL  418



>ref|WP_005507143.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa]
 gb|EHB87738.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa M508]
Length=434

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  L  D++  
Sbjct  310  KTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLSEDRLDM  369

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            ISVL     +      S ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GKK
Sbjct  370  ISVLTELGFAKS---NSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGKK  426

Query  193  NKMVVRI  173
            N+  V +
Sbjct  427  NQGAVEL  433



>ref|WP_028906618.1| tyrosyl-tRNA synthetase [Prevotella ruminicola]
Length=431

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 73/130 (56%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFDQ  383
            +RLAEEVT  VH +E LD A++A+  L   +      KLD +T+  +   VP   +  DQ
Sbjct  301  KRLAEEVTVLVHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKDQ  360

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL   
Sbjct  361  LGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDMIDGKYLLAQK  420

Query  202  GKKNKMVVRI  173
            GKKN  ++ +
Sbjct  421  GKKNYYLLIV  430



>ref|WP_036886463.1| tyrosyl-tRNA synthetase [Prevotella bivia]
 gb|KGF23287.1| tyrosyl-tRNA synthetase [Prevotella bivia DNF00188]
Length=432

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (56%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVTR VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  + 
Sbjct  301  RRLAEEVTRMVHSQEDLDMAIAASNILFGKSTKENLLQLDEQTFNDVFKDVPHFEVSKEL  360

Query  382  vlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            +   +V  ++     +  SKS  R+++K GG+ LN  ++ +  + I  DD++DGK LL+ 
Sbjct  361  LGQPAVEIMNQEGMTIFPSKSEMRKLVKGGGVSLNKEKLAAFDQVITADDLIDGKYLLVQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  ++ +
Sbjct  421  KGKKNYFLIIV  431



>ref|WP_004338209.1| tyrosyl-tRNA synthetase [Prevotella bivia]
 gb|EFB92554.1| tyrosine--tRNA ligase [Prevotella bivia JCVIHMP010]
 gb|EIM32376.1| tyrosyl-tRNA synthetase [Prevotella bivia DSM 20514]
Length=432

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (56%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVTR VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  + 
Sbjct  301  RRLAEEVTRMVHSQEDLDMAIAASNILFGKSTKENLLQLDEQTFNDVFKDVPHFEVSKEL  360

Query  382  vlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            +   +V  ++     +  SKS  R+++K GG+ LN  ++ +  + I  DD++DGK LL+ 
Sbjct  361  LGQPAVEIMNQEGMTIFPSKSEMRKLVKGGGVSLNKEKLAAFDQVITADDLIDGKYLLVQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  ++ +
Sbjct  421  KGKKNYFLIIV  431



>ref|WP_028851238.1| tyrosyl-tRNA synthetase [Thermocrispum municipale]
Length=424

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 2/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLAEE+T  VHG +   + + A++AL      + LD  T+E + ++VP+  +      +
Sbjct  298  RRLAEELTTLVHGADQTAQVVAASQALFGKGEFSALDEPTLESVMAEVPTGEVALSDEPT  357

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            I  L ++        K AARR +++GG Y+NN ++  E  + E  D + GK L++  GK+
Sbjct  358  IVDLLVAAGLSES--KGAARRTVREGGAYVNNTKISDEEWRPEPADALHGKWLIVRRGKR  415

Query  193  NKMVVRI  173
            N   VR+
Sbjct  416  NVAGVRL  422



>ref|WP_036863366.1| tyrosyl-tRNA synthetase [Prevotella bivia]
 gb|KGF37417.1| tyrosyl-tRNA synthetase [Prevotella bivia DNF00650]
Length=432

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (56%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVTR VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  + 
Sbjct  301  RRLAEEVTRMVHSQEDLDMAIAASNILFGKSTKENLLQLDEQTFNDVFKDVPHFEVSKEL  360

Query  382  vlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            +   +V  ++     +  SKS  R+++K GG+ LN  ++ +  + I  DD++DGK LL+ 
Sbjct  361  LGQPAVEIMNQEGMTIFPSKSEMRKLVKGGGVSLNKEKLAAFDQIITADDLIDGKYLLVQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  ++ +
Sbjct  421  KGKKNYFLIIV  431



>ref|WP_014790868.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale]
 gb|AFL97273.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale DSM 
15997]
 gb|AIP99335.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale ORT-UMN 
88]
 gb|KGB66443.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale H06-030791]
Length=429

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 74/131 (56%), Gaps = 6/131 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT----KLDWKTIEGIASDVPSCSLPFD  386
            R+LAEEVT  VH +E LD+A++A+E L  G A +    KLD KT   I   VP   +   
Sbjct  300  RKLAEEVTTMVHSKEELDKAVQASEILF-GKATSENLRKLDEKTFLDIFDGVPQAEITQA  358

Query  385  QvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
             +    +  LS  +  ++SK  ARR L+Q  + +N  ++  E  K+ E+D++ GK +LL 
Sbjct  359  DLNEDLLEILSTKTEFMKSKGEARRALQQNSIAVNKDKI-GEDYKLSENDLISGKYILLQ  417

Query  205  AGKKNKMVVRI  173
             GKKN  VV +
Sbjct  418  KGKKNYFVVIV  428



>ref|WP_004898658.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 gb|EGP13423.1| tyrosyl-tRNA synthetase cluster 1 [Lactobacillus johnsonii pf01]
Length=420

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  297  KRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK+
Sbjct  353  KNIVEFLVETKIESSKRQAREDVKNGAIYVNGERQDDIDFIIELDSDFDGKYVIIRKGKR  412

Query  193  NKMVVRI  173
               +V+I
Sbjct  413  KYTLVKI  419



>ref|WP_017614427.1| tyrosyl-tRNA synthetase [Nocardiopsis salina]
Length=434

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvlsi  371
            LAEE+T  VHG+E   +A+ A+ AL  G AD ++LD +T+E   S+VP            
Sbjct  308  LAEELTTLVHGEEECRKAIDASLALF-GRADLSELDGRTLESALSEVPKVETDTPVGELP  366

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
            SV+DL   SGL  SKSAARR +K+GG Y+NNA+V  E  +++ +D++  + ++L  GK+N
Sbjct  367  SVVDLFAESGLTPSKSAARRAIKEGGAYVNNAKVTDEDARLDAEDLLADRFVVLRRGKRN  426



>ref|WP_044496576.1| tyrosine--tRNA ligase [Lactobacillus johnsonii]
 sp|Q74LL0.2|SYY_LACJO RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Lactobacillus johnsonii NCC 533]
Length=420

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  297  KRLAEEVTKFVHGEEGLKEAQIITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK+
Sbjct  353  KNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGKR  412

Query  193  NKMVVRI  173
               +V+I
Sbjct  413  KYTLVKI  419



>ref|WP_026980036.1| tyrosyl-tRNA synthetase [Flavobacterium suncheonense]
 gb|KGO90471.1| tyrosyl-tRNA synthetase [Flavobacterium suncheonense GH29-5 = 
DSM 17707]
Length=431

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 73/131 (56%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT--KLDWKTIEGIASDVPSCSLPFD--  386
            +RLAEEVT FVHG+E L++A++A+ A      +   KLD KT   +   VP   +     
Sbjct  301  KRLAEEVTTFVHGEEELEKAIEASAAFFSPTMEALKKLDDKTFLEVFEGVPHAEIAMADL  360

Query  385  QvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            +     +  LS  +G L S S ARR LKQ  + LN  +V  E  KI + D+++ K LLL 
Sbjct  361  EEGLDMIAALSAKTGFLASNSDARRELKQNAVSLNKEKV-GEDYKITQSDLINHKFLLLQ  419

Query  205  AGKKNKMVVRI  173
             GKKN  V+++
Sbjct  420  KGKKNYYVIKV  430



>ref|WP_021474284.1| tyrosyl-tRNA synthetase [Arthrobacter sp. AK-YN10]
 gb|ERI35718.1| tyrosyl-tRNA synthetase [Arthrobacter sp. AK-YN10]
Length=436

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 80/129 (62%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG E  ++ + A+ AL  GN D + LD  T+    +++PS ++  D   
Sbjct  311  KKLAYEVTSLVHGVEATEKVIAASAALF-GNGDLSVLDEPTLAAATAELPSATVGAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL +SKSAARR + +GG Y+NNA+V      + ++ ++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNAKVSDPDAVVAQEQLLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   V +S
Sbjct  427  KNLATVEVS  435



>ref|WP_008824157.1| tyrosyl-tRNA synthetase [Prevotella histicola]
 gb|EHG15078.1| tyrosyl-tRNA synthetase [Prevotella histicola F0411]
 gb|KGF25903.1| tyrosyl-tRNA synthetase [Prevotella histicola JCM 15637 = DNF00424]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (55%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVTR VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  D 
Sbjct  301  RRLAEEVTRMVHSQEDLDMAIAASNILFGKSTKDDLLQLDEQTFADVFKDVPHYEVSKDV  360

Query  382  vlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + +  DD++DGK LL+ 
Sbjct  361  LGQPAVDVFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLAAFDQPVTADDLIDGKYLLVQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  ++ +
Sbjct  421  KGKKNYSLIIV  431



>ref|WP_007324558.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|EGF29422.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica WH47]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +  
Sbjct  303  KRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEG  361

Query  373  isvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
              +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  G
Sbjct  362  EGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTADDLDGRSVLVLRRG  421

Query  199  KKNKMVVRI  173
            K+   +++I
Sbjct  422  KRKYALLKI  430



>ref|WP_012892535.1| tyrosyl-tRNA synthetase [Streptosporangium roseum]
 gb|ACZ88800.1| Tyrosine--tRNA ligase [Streptosporangium roseum DSM 43021]
Length=422

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 76/128 (59%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAE+VT  VHG + L   + A+ AL    +  +LD +T+    ++VP   +P    L 
Sbjct  297  RTLAEDVTTLVHGADELARVVAASRALFGQGSLEELDARTLGSALAEVPRAEVP---ALG  353

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S +DL   SGL+ESKSAARR +K+GG YLNN ++  EA     DD++ G+ L+L  GK+
Sbjct  354  ASFVDLLAESGLVESKSAARRAVKEGGAYLNNVKITDEAYVPSADDLLHGRFLVLRRGKR  413

Query  193  NKMVVRIS  170
            +   V ++
Sbjct  414  SIGGVEVT  421



>ref|WP_008674495.1| tyrosyl-tRNA synthetase [Rhodopirellula sallentina]
 gb|EMI57784.1| tyrosine--tRNA ligase [Rhodopirellula sallentina SM41]
Length=449

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+ +T  VHG+EG++ A +AT+ L  G      D +  E I +DVPSC++  DQ+  
Sbjct  316  KRLAQWITTLVHGEEGVESAQRATQILFGGELGNTTDSQLRE-IFADVPSCNITQDQIDG  374

Query  373  isvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
              +  +     +    S   ARR +K+  +YLNN RV  E K+I   D     V++L  G
Sbjct  375  DGLWIVEALQLVKLCSSGGEARRSVKENSIYLNNNRVTDEQKRITASDFDGRSVVVLRRG  434

Query  199  KKNKMVVRI  173
            K+   ++++
Sbjct  435  KRKYALLKL  443



>gb|AAS08157.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii NCC 533]
Length=426

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  303  KRLAEEVTKFVHGEEGLKEAQIITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  358

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK+
Sbjct  359  KNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGKR  418

Query  193  NKMVVRI  173
               +V+I
Sbjct  419  KYTLVKI  425



>ref|WP_036867594.1| tyrosyl-tRNA synthetase [Prevotella bivia]
 gb|KGF44111.1| tyrosyl-tRNA synthetase [Prevotella bivia DNF00320]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (55%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVTR VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  + 
Sbjct  301  RRLAEEVTRMVHSQEDLDMAIAASNILFGKSTKENLLQLDEQTFNDVFKDVPHFEVSKEL  360

Query  382  vlsisvldlsvs-sglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            +   +V  ++     +  SKS  R+++K GG+ LN  +  +  + I  DD++DGK LL+ 
Sbjct  361  LGQPAVEIMNQEGMTIFPSKSEMRKLVKGGGVSLNKEKFAAFDQVITADDLIDGKYLLVQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  ++ +
Sbjct  421  KGKKNYFLIIV  431



>ref|WP_035732891.1| tyrosyl-tRNA synthetase [Gulosibacter molinativorax]
Length=440

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 75/128 (59%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA  VT  VHG+E  D A+ A+EAL        L+ +T++   +++P+     +  + 
Sbjct  316  RALARAVTVLVHGEEATDNAIAASEALFGQGDLLALNAETLQQAIAELPNT----ESTVG  371

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              +  + V +G +ES SAARR +KQGG+ LNNAR++ E + IE  D++ G V+++  GKK
Sbjct  372  AELSQVLVDTGAVESLSAARRAIKQGGVSLNNARIEDEHRVIESGDLLPGSVIVVRRGKK  431

Query  193  NKMVVRIS  170
              +   IS
Sbjct  432  TLVGATIS  439



>ref|WP_022513249.1| tyrosyl-tRNA synthetase [Dialister sp. CAG:588]
 emb|CDF27526.1| tyrosine--tRNA ligase [Dialister sp. CAG:588]
Length=420

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 74/128 (58%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEEVTRFVHGQEGL+EAL+ TEAL  GN   +L    IEG   +    +L     + 
Sbjct  294  RKLAEEVTRFVHGQEGLNEALRVTEALFSGNVQ-ELSAAEIEGAFRNTKGGTL---HSVP  349

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +++++  VS  +++SK  AR  +  G + +N  ++      I      +GK +++  GKK
Sbjct  350  MNIVEALVSGEVIKSKRQAREDVSNGAIRINGEKITDIEATITAHPNTNGKHIIVKKGKK  409

Query  193  NKMVVRIS  170
            N  ++++S
Sbjct  410  NYFLLKVS  417



>ref|WP_003650704.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
 gb|EEQ26747.1| tyrosine--tRNA ligase [Lactobacillus gasseri 202-4]
Length=420

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 71/127 (56%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  297  KRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK +++  GK+
Sbjct  353  KNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGKR  412

Query  193  NKMVVRI  173
               +V+I
Sbjct  413  EYTLVKI  419



>ref|WP_021314877.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
 gb|EQB84886.1| tyrosyl-tRNA synthase [Lactobacillus gasseri 2016]
 gb|KFL95101.1| tyrosine--tRNA ligase [Lactobacillus gasseri SJ-9E-US]
Length=420

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 71/127 (56%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  297  KRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  352

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK +++  GK+
Sbjct  353  KNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGKR  412

Query  193  NKMVVRI  173
               +V+I
Sbjct  413  KYTLVKI  419



>ref|WP_006043715.1| tyrosyl-tRNA synthetase [Prevotella pallens]
 gb|EGQ23250.1| tyrosine--tRNA ligase [Prevotella pallens ATCC 700821]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVTR VH Q  LD A+ A+  L  G A      +LD +T   +  DVP   +  +
Sbjct  301  RRLAEEVTRMVHSQADLDMAIAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSKE  359

Query  385  Qvlsisvldlsvssglle-SKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
             +   +V   +     +  SKS  R+++K GG+ LN  ++ +  + I  DD++DGK LLL
Sbjct  360  LLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQIITADDLIDGKYLLL  419

Query  208  SAGKKNKMVVRI  173
              GKKN  +V +
Sbjct  420  QRGKKNYFLVIV  431



>ref|WP_012825381.1| tyrosyl-tRNA synthetase [Haliangium ochraceum]
 ref|YP_003264647.1| tyrosyl-tRNA synthetase [Haliangium ochraceum DSM 14365]
 gb|ACY12754.1| tyrosyl-tRNA synthetase [Haliangium ochraceum DSM 14365]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 79/126 (63%), Gaps = 2/126 (2%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls-i  371
            LAE++T +VHG+E    AL A++ +  G+ +  L+   ++ + +D+P+ SLP  Q+ S I
Sbjct  305  LAEDLTDWVHGEEAKRNALAASQVMFGGSLE-NLNDAALQPLTADLPTTSLPRQQLESGI  363

Query  370  svldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKN  191
             +L+L   + L  SK AARR+++ GG+Y+NN RV    K +  +D+    +++L AGKKN
Sbjct  364  PLLELLAQTKLAASKGAARRLVQGGGVYVNNIRVADVNKTLLPEDLGTETIMILRAGKKN  423

Query  190  KMVVRI  173
              +V+ 
Sbjct  424  YHLVQF  429



>ref|WP_011691372.1| tyrosyl-tRNA synthetase [Arthrobacter sp. FB24]
 gb|ABK02906.1| tyrosyl-tRNA synthetase [Arthrobacter sp. FB24]
Length=437

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            RRLA EVT  VHG E  ++ + A+ AL  G     LD +T+    +++PS  +  D    
Sbjct  311  RRLAFEVTSLVHGVEATEKVIAASAALFGGGDLAALDEQTLSAATAELPSVRVDPD---G  367

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
              ++DL V+SGL +SKSAARR + +GG Y+NN +V      I   +++ G+ LLL  GKK
Sbjct  368  TGIVDLLVASGLADSKSAARRTVGEGGAYVNNTKVTDPDAVIPGSELLHGRYLLLRRGKK  427

Query  193  NKMVVRIS  170
            N   V ++
Sbjct  428  NLATVEVA  435



>ref|WP_006256112.1| tyrosyl-tRNA synthetase [Alloprevotella tannerae]
 gb|EEX70745.1| tyrosine--tRNA ligase [Prevotella tannerae ATCC 51259]
Length=431

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (57%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLP-F  389
            RRL EEVT  VHG+E  ++AL ATE L  G A      KLD KT+  + S VP   +   
Sbjct  300  RRLGEEVTVMVHGREEYEKALAATEILF-GKATKESLLKLDEKTLLAVFSGVPHFEVARA  358

Query  388  DQvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
            + V + +V   +  +    SK   R++++ GG+ LN  ++ +  K I E+D++DGK LL+
Sbjct  359  EAVGAKAVDLFAEKTQCFASKGEMRKLVQGGGVSLNKEKLSAFDKTITEEDLLDGKYLLV  418

Query  208  SAGKKNKMVVRI  173
              GKKN  ++ +
Sbjct  419  QRGKKNYYLITV  430



>ref|WP_044496612.1| tyrosyl-tRNA synthetase [Nesterenkonia sp. NP1]
Length=436

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 3/126 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LA EVT  VHG++ + +A+ A++AL      T++D  T+ GIA++V    LP +   +
Sbjct  312  RTLAWEVTALVHGEDAVRKAIAASDALFGKGEITEIDEPTLRGIAAEVTVAELPAE---A  368

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             + +++  ++ L+ SK  ARR ++QGG Y+NN +VD     +E    +  + L++  GKK
Sbjct  369  ATGINVLTATELVPSKGEARRAIQQGGAYINNTKVDDGDAVVEASAWLHDQYLVVRRGKK  428

Query  193  NKMVVR  176
            N  V++
Sbjct  429  NLAVIK  434



>ref|WP_005987818.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|EHM87143.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii C83]
Length=423

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 78/130 (60%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT--KLDWKTIEGIASDVPSCSLPFDQv  380
            + LA EVT +VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS  L   +V
Sbjct  297  KALAHEVTTWVHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSAQL---EV  353

Query  379  lsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
               +++DL V++GL + + AAR+ + QGG YLN  +V  E   I EDD++ G V+L+  G
Sbjct  354  GKSTIIDLLVATGLEKGRGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRKG  413

Query  199  KKNKMVVRIS  170
            ++   V R +
Sbjct  414  RRKLAVARTN  423



>ref|WP_011122161.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 ref|NP_868726.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica SH 1]
 sp|Q7UM14.1|SYY_RHOBA RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Rhodopirellula baltica SH 1]
 emb|CAD76103.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica SH 1]
Length=438

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +  
Sbjct  309  KRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEG  367

Query  373  isvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
              +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  G
Sbjct  368  EGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRRG  427

Query  199  KKNKMVVRI  173
            K+   +++I
Sbjct  428  KRKYALLKI  436



>ref|WP_008661113.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea]
 gb|EMB13997.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea 6C]
 gb|EMI25131.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea SH398]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +  
Sbjct  303  KRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEG  361

Query  373  isvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
              +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  G
Sbjct  362  EGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRRG  421

Query  199  KKNKMVVRI  173
            K+   +++I
Sbjct  422  KRKYALLKI  430



>gb|ABJ59589.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323 = JCM 
1131]
Length=426

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 71/127 (56%), Gaps = 4/127 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   +
Sbjct  303  KRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---A  358

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK +++  GK+
Sbjct  359  KNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGKR  418

Query  193  NKMVVRI  173
               +V+I
Sbjct  419  KYTLVKI  425



>ref|WP_006947867.1| tyrosyl-tRNA synthetase [Prevotella marshii]
 gb|EFM02805.1| tyrosine--tRNA ligase [Prevotella marshii DSM 16973 = JCM 13450]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (55%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPFD  386
            RRLAEEVT  VH  E L  A++A+  L  G A      KL+ +T+  +   VP  +LP D
Sbjct  302  RRLAEEVTTMVHSPEALAMAVEASNILF-GKATKESLLKLNEQTLLDVFEGVPHFTLPAD  360

Query  385  QvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
            ++   +    +    +  SK   R++++ GG+ LN  ++DS  + +   D+++G+ LL+ 
Sbjct  361  KLGLSAGELFTTEIPIFTSKGEMRKLVQGGGVSLNKEKLDSFEQPVTAQDLINGRYLLVQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  ++ +
Sbjct  421  RGKKNYYLITV  431



>ref|WP_011774354.1| tyrosyl-tRNA synthetase [Arthrobacter aurescens]
 gb|ABM06477.1| tyrosyl-tRNA synthetase [Arthrobacter aurescens TC1]
Length=436

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 80/129 (62%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQvl  377
            ++LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D   
Sbjct  311  KKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAVLDERTLEAATAELPSATIGAD---  366

Query  376  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  197
             + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I  ++++ G+ LLL  GK
Sbjct  367  GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIAREELLHGRYLLLRRGK  426

Query  196  KNKMVVRIS  170
            KN   + +S
Sbjct  427  KNLATIEVS  435



>ref|WP_016335378.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis]
 gb|AGM07632.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis HCCB10007]
Length=424

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAEE T  VHG E   + + A++AL       +LD  T++   ++VP+  +  D    
Sbjct  298  RKLAEEFTTLVHGAEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGE  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+
Sbjct  356  STIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGKR  415

Query  193  NKMVVRI  173
            N   VR+
Sbjct  416  NVAGVRV  422



>ref|WP_021584875.1| tyrosyl-tRNA synthetase [Prevotella pleuritidis]
 gb|ERJ97850.1| tyrosine--tRNA ligase [Prevotella pleuritidis F0068]
Length=432

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 6/126 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLP-F  389
            RRLAEEVT  VH +E LD A++A+  L  G A      +LD +T+  +   VP  +L   
Sbjct  301  RRLAEEVTLMVHSREALDTAIEASNILF-GKATKESLLRLDEQTLLDVFEGVPHFTLAKT  359

Query  388  DQvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
            D  L    L       +  SK   R+M++ GG+ LN  R++S  + I  DD++DGK LL+
Sbjct  360  DLGLPAVELLTRDDVKVFSSKGEMRKMVQGGGVSLNKERLESFDRLITSDDLIDGKYLLI  419

Query  208  SAGKKN  191
              GKKN
Sbjct  420  QRGKKN  425



>ref|WP_007332625.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|EKK01795.1| Tyrosyl-tRNA synthetase [Rhodopirellula baltica SH28]
Length=432

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            +RLA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   +  
Sbjct  303  KRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALEG  361

Query  373  isvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
              +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+L  G
Sbjct  362  EGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRRG  421

Query  199  KKNKMVVRI  173
            K+   +++I
Sbjct  422  KRKYALLKI  430



>ref|WP_043622222.1| tyrosyl-tRNA synthetase [Nonomuraea candida]
Length=421

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R LAE++T  +HG++ LD  L A++AL    A  +L   T+    ++VP  ++P    L 
Sbjct  297  RTLAEDLTEMLHGRQELDAVLAASKALFGQGALEELPAATLGAALAEVPKATVP---ALG  353

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             S +DL   SGL+ESKSAARR +K+GG YLNN ++  E+     DD++ G+ ++L  GKK
Sbjct  354  ASFVDLLADSGLVESKSAARRAVKEGGAYLNNRKITDESYTPTADDLLGGRFMVLRRGKK  413

Query  193  N  191
            +
Sbjct  414  S  414



>ref|WP_038511529.1| tyrosyl-tRNA synthetase [Amycolatopsis japonica]
 gb|AIG75731.1| Tyrosine-tRNA ligase [Amycolatopsis japonica]
Length=424

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 78/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D    
Sbjct  298  RKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKI--DPNGE  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK+
Sbjct  356  ATIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGKR  415

Query  193  NKMVVRI  173
            N   VR+
Sbjct  416  NVAGVRV  422



>ref|WP_024991409.1| tyrosyl-tRNA synthetase [Prevotella pleuritidis]
Length=432

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 6/126 (5%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLP-F  389
            RRLAEEVT  VH +E LD A++A+  L  G A      +LD +T+  +   VP  +L   
Sbjct  301  RRLAEEVTLMVHSREALDTAIEASNILF-GKATKESLLRLDEQTLLDVFEGVPHFTLAKT  359

Query  388  DQvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  209
            D  L    L       +  SK   R+M++ GG+ LN  R++S  + I  DD++DGK LL+
Sbjct  360  DLGLPAVELLTRDDVKVFSSKGEMRKMVQGGGVSLNKERLESFDRLITSDDLIDGKYLLI  419

Query  208  SAGKKN  191
              GKKN
Sbjct  420  QRGKKN  425



>ref|WP_020629629.1| tyrosyl-tRNA synthetase [Amycolatopsis alba]
Length=424

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 78/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            R+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D    
Sbjct  298  RKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNGE  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
             +++DL +++GL++SK AARR +K+GG Y+NN ++  EA     DD + G+ L++  GK+
Sbjct  356  STIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEAWTPSSDDALHGRWLVVRKGKR  415

Query  193  NKMVVRI  173
            N   VR+
Sbjct  416  NVAGVRV  422



>ref|WP_013670661.1| tyrosyl-tRNA synthetase [Prevotella denticola]
 gb|AEA20499.1| tyrosine--tRNA ligase [Prevotella denticola F0289]
Length=432

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 69/131 (53%), Gaps = 4/131 (3%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFD-  386
            RRLAEEVTR VH Q+ LD A+ A+  L   +      +LD +T   +  DVP   +  D 
Sbjct  301  RRLAEEVTRMVHSQDDLDMAIAASNILFGKSTKENLLQLDEQTFADVFKDVPHYEVSKDI  360

Query  385  QvlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  206
                   +       +  SKS  R+++K GG+ LN  ++ +  + +  DD++DGK LL+ 
Sbjct  361  LGQPAVEVFNQEGMQIFPSKSEMRKLVKSGGVSLNKEKLAAFDQPVTADDLIDGKYLLVQ  420

Query  205  AGKKNKMVVRI  173
             GKKN  ++ +
Sbjct  421  KGKKNYSLIIV  431



>gb|EKY16477.1| tyrosine--tRNA ligase [Actinomyces sp. oral taxon 181 str. F0379]
Length=350

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -1

Query  547  LAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsis  368
            LA  VT  VHGQ+ L+    ATEAL      + +D  T+    SD+P   LP       +
Sbjct  229  LAASVTALVHGQDELERVQAATEALWGTGDLSSIDEATLAAATSDLPRAELPLG----AT  284

Query  367  vldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNK  188
            ++D  V +GL + +SAARR L  GG Y+N  +V+ E   +  DD++ G ++L+  G++N 
Sbjct  285  LVDALVETGLEKGRSAARRTLAGGGAYVNKVKVEDEEAVLSADDLLAGGLVLIRKGRRNL  344

Query  187  MVVRI  173
             VV +
Sbjct  345  AVVAV  349



>ref|WP_021852743.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1058]
 emb|CCX65061.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1058]
Length=433

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 72/130 (55%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFDQ  383
            RRLAEEVT  VH +E  D A++A+  L   +      KLD +T+  I   VP   +  D+
Sbjct  302  RRLAEEVTVMVHSREDYDAAVEASNILFGKSTKESLMKLDEQTLLDIFEGVPQFEISRDK  361

Query  382  vlsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  203
            +   ++   +  + +  SK   R++++ GG+ LN  ++ +  + I  DD++DGK LL+  
Sbjct  362  LGLQAIELFTTEAAVFASKGEMRKLVQGGGVSLNKDKLTAFDRAITADDLIDGKYLLVQR  421

Query  202  GKKNKMVVRI  173
            GKKN  +V +
Sbjct  422  GKKNYYLVTV  431



>ref|WP_043536564.1| tyrosyl-tRNA synthetase [Actinomyces sp. MS2]
Length=420

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 3/126 (2%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvls  374
            + LA  VT  VHG++ LD  L ATEAL        LD +T+E   +++PS  +   +   
Sbjct  296  KELAARVTELVHGRDELDRVLAATEALWGRGELGALDARTLESATAELPSGDIVAGESTI  355

Query  373  isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKK  194
            +  L  +        +SAARR +  GG YLNN +V  E   I   D++ G + L+  G++
Sbjct  356  VDALVATGLEKG---RSAARRTVASGGAYLNNVKVTDEDAPISTGDLLAGGLALVRKGRR  412

Query  193  NKMVVR  176
            N  VVR
Sbjct  413  NLAVVR  418



>ref|WP_021604636.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|ERH17231.1| tyrosine--tRNA ligase [Actinomyces graevenitzii F0530]
Length=423

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 77/128 (60%), Gaps = 5/128 (4%)
 Frame = -1

Query  553  RRLAEEVTRFVHGQEGLDEALKATEALRPGNADT--KLDWKTIEGIASDVPSCSLPFDQv  380
            + LA EVT +VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS  L   +V
Sbjct  297  KALAHEVTTWVHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSSQL---EV  353

Query  379  lsisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  200
               +++DL V++GL + + AAR+ + QGG YLN  +V  E   I EDD++ G V+L+  G
Sbjct  354  GKSTIIDLLVATGLEKGRGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRKG  413

Query  199  KKNKMVVR  176
            ++   V R
Sbjct  414  RRKLAVAR  421



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760