BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050B21

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004290467.1|  PREDICTED: ras-related protein Rab7              79.0    7e-15   Fragaria vesca subsp. vesca
ref|XP_007201851.1|  hypothetical protein PRUPE_ppa011579mg           75.1    2e-13   Prunus persica
ref|XP_010063810.1|  PREDICTED: ras-related protein Rab7              74.7    2e-13   Eucalyptus grandis [rose gum]
ref|XP_009782915.1|  PREDICTED: ras-related protein Rab7-like         72.4    3e-13   Nicotiana sylvestris
gb|KDP36048.1|  hypothetical protein JCGZ_10014                       74.3    3e-13   Jatropha curcas
ref|XP_008447760.1|  PREDICTED: ras-related protein Rab7 isoform X2   73.9    4e-13   Cucumis melo [Oriental melon]
ref|XP_004139780.1|  PREDICTED: ras-related protein Rab7-like         73.9    4e-13   Cucumis sativus [cucumbers]
gb|KCW71068.1|  hypothetical protein EUGRSUZ_F04166                   73.9    4e-13   Eucalyptus grandis [rose gum]
ref|XP_009628178.1|  PREDICTED: ras-related protein Rab7              73.6    7e-13   Nicotiana tomentosiformis
ref|XP_004237840.1|  PREDICTED: ras-related protein Rab7              73.2    7e-13   Solanum lycopersicum
gb|KJB59527.1|  hypothetical protein B456_009G259500                  73.2    8e-13   Gossypium raimondii
ref|XP_002264356.1|  PREDICTED: ras-related protein Rab7 isoform X1   72.8    9e-13   Vitis vinifera
ref|XP_010645814.1|  PREDICTED: ras-related protein Rab7 isoform X2   72.4    1e-12   
gb|KJB28941.1|  hypothetical protein B456_005G076500                  72.4    1e-12   Gossypium raimondii
gb|KJB28942.1|  hypothetical protein B456_005G076500                  72.0    2e-12   Gossypium raimondii
ref|XP_009763630.1|  PREDICTED: ras-related protein Rab7-like         71.6    3e-12   Nicotiana sylvestris
ref|XP_004496410.1|  PREDICTED: ras-related protein Rab7-like         71.6    3e-12   Cicer arietinum [garbanzo]
ref|XP_002527104.1|  protein with unknown function                    71.6    3e-12   Ricinus communis
emb|CDP01135.1|  unnamed protein product                              71.2    3e-12   Coffea canephora [robusta coffee]
ref|XP_009606119.1|  PREDICTED: ras-related protein Rab7-like         70.9    5e-12   Nicotiana tomentosiformis
emb|CAA98168.1|  RAB7A                                                70.5    7e-12   Lotus japonicus
ref|XP_009335165.1|  PREDICTED: ras-related protein Rab7              70.1    8e-12   Pyrus x bretschneideri [bai li]
gb|ACU17616.1|  unknown                                               70.1    8e-12   Glycine max [soybeans]
gb|KHN17053.1|  Ras-related protein Rab7                              70.1    9e-12   Glycine soja [wild soybean]
ref|XP_003556176.1|  PREDICTED: ras-related protein Rab7              70.1    1e-11   
gb|ACU24093.1|  unknown                                               70.1    1e-11   Glycine max [soybeans]
ref|XP_010681464.1|  PREDICTED: ras-related protein Rab7              70.1    1e-11   Beta vulgaris subsp. vulgaris [field beet]
sp|Q41640.1|RAB7_VIGAC  RecName: Full=Ras-related protein Rab7        69.7    1e-11   Vigna aconitifolia [moth-bean]
ref|XP_007143599.1|  hypothetical protein PHAVU_007G085200g           69.7    1e-11   Phaseolus vulgaris [French bean]
ref|NP_001235371.1|  uncharacterized protein LOC100499740             69.7    1e-11   Glycine max [soybeans]
ref|XP_004489906.1|  PREDICTED: ras-related protein Rab7-like         69.7    1e-11   Cicer arietinum [garbanzo]
ref|XP_010089429.1|  Ras-related protein Rab7                         69.7    2e-11   
ref|XP_007019678.1|  RAB GTPase G3A isoform 1                         68.9    2e-11   Theobroma cacao [chocolate]
gb|KEH43618.1|  RAB GTPase-like protein A1D                           68.6    3e-11   Medicago truncatula
gb|KEH43617.1|  RAB GTPase-like protein A1D                           68.6    4e-11   Medicago truncatula
ref|XP_010243311.1|  PREDICTED: ras-related protein Rab7              68.2    4e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008348542.1|  PREDICTED: ras-related protein Rab7-like         67.4    5e-11   
ref|XP_009342702.1|  PREDICTED: ras-related protein Rab7              67.8    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_008361208.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...  67.8    6e-11   
ref|XP_008337228.1|  PREDICTED: ras-related protein Rab7-like         67.8    6e-11   
ref|XP_002300895.1|  hypothetical protein POPTR_0002s06310g           67.4    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010261069.1|  PREDICTED: ras-related protein Rab7-like iso...  67.4    7e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010438119.1|  PREDICTED: ras-related protein RABG3a            66.2    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010421879.1|  PREDICTED: ras-related protein RABG3a-like       66.2    2e-10   Camelina sativa [gold-of-pleasure]
ref|NP_001154217.1|  RAB GTPase homolog G3A                           66.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288671.1|  hypothetical protein CARUB_v10001979mg           66.2    2e-10   Capsella rubella
ref|NP_192710.1|  RAB GTPase homolog G3A                              66.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543071.1|  PREDICTED: ras-related protein RABG3a            66.2    2e-10   Tarenaya hassleriana [spider flower]
gb|AFU92144.1|  small GTP binding protein                             66.2    2e-10   Arachis hypogaea [goober]
emb|CAB39639.1|  rab7-like protein                                    66.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35265.1|  hypothetical protein JCGZ_09424                       65.9    2e-10   Jatropha curcas
ref|NP_849347.1|  RAB GTPase homolog G3A                              65.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190694.1|  RAB GTPase homolog G3A                           65.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43592.1|  unknown                                               65.5    3e-10   Lotus japonicus
ref|XP_009336367.1|  PREDICTED: ras-related protein Rab7              65.5    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_011074118.1|  PREDICTED: ras-related protein Rab7              65.1    5e-10   Sesamum indicum [beniseed]
gb|KJB59938.1|  hypothetical protein B456_009G286800                  65.1    5e-10   Gossypium raimondii
ref|XP_002872458.1|  AtRABG3a                                         64.7    5e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_006434552.1|  hypothetical protein CICLE_v10002522mg           64.7    6e-10   Citrus clementina [clementine]
ref|XP_011026316.1|  PREDICTED: ras-related protein Rab7              64.7    6e-10   Populus euphratica
ref|XP_010455367.1|  PREDICTED: ras-related protein RABG3a-like       64.7    6e-10   
ref|XP_007048144.1|  RAB GTPase G3A                                   64.7    6e-10   
ref|XP_008232432.1|  PREDICTED: ras-related protein Rab7              64.7    6e-10   Prunus mume [ume]
gb|KHG00821.1|  Ras-related Rab7                                      64.3    7e-10   Gossypium arboreum [tree cotton]
gb|EYU36545.1|  hypothetical protein MIMGU_mgv1a013950mg              64.3    8e-10   Erythranthe guttata [common monkey flower]
ref|XP_002307527.1|  hypothetical protein POPTR_0005s22070g           63.9    1e-09   Populus trichocarpa [western balsam poplar]
emb|CDY48910.1|  BnaA09g22850D                                        63.9    1e-09   Brassica napus [oilseed rape]
ref|XP_009113550.1|  PREDICTED: ras-related protein RABG3a            63.5    1e-09   
gb|KFK32051.1|  hypothetical protein AALP_AA6G193700                  63.5    2e-09   Arabis alpina [alpine rockcress]
gb|KFK44364.1|  hypothetical protein AALP_AA1G247900                  63.2    2e-09   Arabis alpina [alpine rockcress]
ref|XP_007207890.1|  hypothetical protein PRUPE_ppa021084mg           63.2    2e-09   Prunus persica
ref|XP_003636324.1|  Ras-related protein Rab7                         63.2    2e-09   
ref|XP_003636325.1|  Ras-related protein Rab7                         63.2    2e-09   
gb|AAA74120.1|  putative                                              62.8    3e-09   Nicotiana tabacum [American tobacco]
ref|XP_011044829.1|  PREDICTED: ras-related protein Rab7-like         62.4    4e-09   Populus euphratica
gb|KCW54354.1|  hypothetical protein EUGRSUZ_I00315                   61.6    5e-09   Eucalyptus grandis [rose gum]
gb|EPS71938.1|  hypothetical protein M569_02820                       62.0    5e-09   Genlisea aurea
ref|XP_008338652.1|  PREDICTED: ras-related protein Rab7-like         61.6    7e-09   
emb|CDX91688.1|  BnaC08g06070D                                        61.6    7e-09   
emb|CDY41473.1|  BnaA08g20750D                                        61.6    7e-09   Brassica napus [oilseed rape]
ref|XP_009110129.1|  PREDICTED: ras-related protein RABG3b            61.6    7e-09   Brassica rapa
ref|XP_010027761.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...  61.6    8e-09   
gb|ABF13310.1|  Rab7                                                  60.1    1e-08   Phaseolus vulgaris [French bean]
ref|XP_010460036.1|  PREDICTED: ras-related protein RABG3b            60.8    1e-08   Camelina sativa [gold-of-pleasure]
gb|KJB49113.1|  hypothetical protein B456_008G101600                  60.8    1e-08   Gossypium raimondii
gb|KHG02230.1|  Ras-related Rab7                                      60.8    1e-08   Gossypium arboreum [tree cotton]
ref|XP_006842165.1|  hypothetical protein AMTR_s00078p00147080        60.5    2e-08   Amborella trichopoda
ref|XP_003525083.1|  PREDICTED: ras-related protein Rab7-like         60.1    2e-08   Glycine max [soybeans]
emb|CDY05073.1|  BnaC03g28710D                                        60.1    3e-08   
gb|AFK34363.1|  unknown                                               60.1    3e-08   Medicago truncatula
ref|XP_006397152.1|  hypothetical protein EUTSA_v10028966mg           59.7    4e-08   Eutrema salsugineum [saltwater cress]
ref|XP_007159766.1|  hypothetical protein PHAVU_002G265500g           59.3    5e-08   Phaseolus vulgaris [French bean]
ref|XP_010498755.1|  PREDICTED: ras-related protein RABG3b-like       59.3    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002890529.1|  predicted protein                                58.9    6e-08   
ref|XP_009134161.1|  PREDICTED: ras-related protein RABG3a-like       58.9    6e-08   Brassica rapa
emb|CDX90732.1|  BnaA03g24120D                                        58.9    6e-08   
ref|XP_011464793.1|  PREDICTED: ras-related protein Rab7              58.9    8e-08   Fragaria vesca subsp. vesca
emb|CAA98169.1|  RAB7B                                                58.5    9e-08   Lotus japonicus
ref|XP_002532185.1|  protein with unknown function                    58.2    1e-07   
ref|NP_001242593.1|  uncharacterized protein LOC100787120             57.8    2e-07   Glycine max [soybeans]
dbj|BAJ99564.1|  predicted protein                                    57.0    3e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002440145.1|  hypothetical protein SORBIDRAFT_09g026820        56.6    3e-07   
gb|AFC93432.1|  Ras-like protein                                      57.0    3e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569676.1|  PREDICTED: ras-related protein Rab7              56.6    5e-07   Brachypodium distachyon [annual false brome]
ref|XP_006303560.1|  hypothetical protein CARUB_v10011037mg           56.2    7e-07   Capsella rubella
ref|XP_010521112.1|  PREDICTED: ras-related protein Rab7              55.8    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_008812295.1|  PREDICTED: ras-related protein Rab7              55.8    8e-07   Phoenix dactylifera
ref|XP_010935166.1|  PREDICTED: ras-related protein Rab7              55.5    1e-06   Elaeis guineensis
gb|AFW83742.2|  hypothetical protein ZEAMMB73_052378                  54.7    2e-06   
ref|XP_002458401.1|  hypothetical protein SORBIDRAFT_03g032810        55.1    2e-06   Sorghum bicolor [broomcorn]
ref|NP_001266750.1|  uncharacterized protein LOC101027204             55.1    2e-06   
ref|XP_009108378.1|  PREDICTED: ras-related protein RABG3b-like       53.5    2e-06   Brassica rapa
ref|XP_004969742.1|  PREDICTED: ras-related protein Rab7-like         54.7    3e-06   Setaria italica
ref|NP_001044060.1|  Os01g0714900                                     54.3    3e-06   
ref|XP_010652865.1|  PREDICTED: ras-related protein Rab7 isoform X1   53.9    5e-06   Vitis vinifera
ref|XP_002279477.1|  PREDICTED: ras-related protein Rab7 isoform X2   53.5    5e-06   Vitis vinifera
gb|EEC71383.1|  hypothetical protein OsI_03499                        53.9    1e-05   Oryza sativa Indica Group [Indian rice]
gb|AFW78901.1|  hypothetical protein ZEAMMB73_911919                  52.0    1e-05   
gb|KEH26012.1|  small GTPase family RAB protein                       53.1    1e-05   Medicago truncatula
ref|XP_003636340.1|  Ras-related protein Rab7                         53.1    1e-05   
ref|XP_008649936.1|  PREDICTED: ras-related protein Rab7-like         52.8    1e-05   Zea mays [maize]
ref|XP_009410766.1|  PREDICTED: ras-related protein Rab7-like         52.8    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC79597.1|  hypothetical protein OsI_20781                        51.6    4e-05   Oryza sativa Indica Group [Indian rice]
gb|AAT39219.1|  putative GTPase                                       51.2    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056165.1|  Os05g0536900                                     51.2    4e-05   
ref|XP_008671687.1|  PREDICTED: ras-related protein Rab7-like         50.1    4e-05   
gb|KDO45864.1|  hypothetical protein CISIN_1g028305mg                 51.2    5e-05   Citrus sinensis [apfelsine]
ref|XP_004961378.1|  PREDICTED: ras-related protein Rab7-like iso...  51.2    5e-05   Setaria italica
ref|XP_006427978.1|  hypothetical protein CICLE_v10026484mg           51.2    5e-05   Citrus clementina [clementine]
ref|NP_173688.1|  GTP-binding protein Rab7                            50.8    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961377.1|  PREDICTED: ras-related protein Rab7-like iso...  51.2    6e-05   
ref|XP_010915165.1|  PREDICTED: ras-related protein Rab7-like         50.8    6e-05   Elaeis guineensis
ref|XP_004148452.1|  PREDICTED: ras-related protein Rab7-like         50.8    7e-05   Cucumis sativus [cucumbers]
ref|XP_006644616.1|  PREDICTED: ras-related protein Rab7-like         50.8    7e-05   Oryza brachyantha
ref|XP_006464493.1|  PREDICTED: ras-related protein Rab7-like iso...  50.8    7e-05   Citrus sinensis [apfelsine]
ref|XP_006654709.1|  PREDICTED: ras-related protein Rab7-like         50.1    1e-04   Oryza brachyantha
ref|XP_008665947.1|  PREDICTED: ras-related protein Rab7-like         48.9    1e-04   
ref|XP_003630119.1|  Ras-related protein Rab7                         49.7    1e-04   Medicago truncatula
ref|XP_009803444.1|  PREDICTED: ras-related protein Rab7-like iso...  49.7    2e-04   Nicotiana sylvestris
ref|XP_009629178.1|  PREDICTED: ras-related protein Rab7-like iso...  49.7    2e-04   
ref|XP_008808948.1|  PREDICTED: ras-related protein Rab7-like         49.7    2e-04   Phoenix dactylifera
ref|XP_008663959.1|  PREDICTED: ras-related protein Rab7-like         47.4    4e-04   Zea mays [maize]
gb|AFK36786.1|  unknown                                               48.5    4e-04   Medicago truncatula
ref|XP_003568013.1|  PREDICTED: ras-related protein Rab7-like         48.1    6e-04   Brachypodium distachyon [annual false brome]



>ref|XP_004290467.1| PREDICTED: ras-related protein Rab7 [Fragaria vesca subsp. vesca]
Length=205

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN HEQDI+ QG+PDA+PE + RGGCAC
Sbjct  164  NVDAAFLCIAKTALANEHEQDIYFQGVPDAVPESDQRGGCAC  205



>ref|XP_007201851.1| hypothetical protein PRUPE_ppa011579mg [Prunus persica]
 ref|XP_008237447.1| PREDICTED: ras-related protein Rab7 [Prunus mume]
 gb|EMJ03050.1| hypothetical protein PRUPE_ppa011579mg [Prunus persica]
Length=205

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN HEQDI+ QGIP+A+ E + RGGCAC
Sbjct  164  NVDAAFLCIAKTALANEHEQDIYFQGIPEAVSESDQRGGCAC  205



>ref|XP_010063810.1| PREDICTED: ras-related protein Rab7 [Eucalyptus grandis]
 gb|KCW71067.1| hypothetical protein EUGRSUZ_F04166 [Eucalyptus grandis]
Length=205

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDA+FLCIAK ALAN HE DI+ QGIPDA+P+ E RGGCAC
Sbjct  164  NVDASFLCIAKAALANDHEHDIYFQGIPDAVPDSEQRGGCAC  205



>ref|XP_009782915.1| PREDICTED: ras-related protein Rab7-like [Nicotiana sylvestris]
Length=97

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IAKTALAN HEQDI+ QGIP+A+ E E RGGCAC
Sbjct  56   NVDAAFLSIAKTALANEHEQDIYFQGIPEAVSETEQRGGCAC  97



>gb|KDP36048.1| hypothetical protein JCGZ_10014 [Jatropha curcas]
Length=205

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAKTALAN HEQDI+ QGIP+A+ E E RGGCAC
Sbjct  164  NVDPAFLCIAKTALANEHEQDIYFQGIPEAVSETEQRGGCAC  205



>ref|XP_008447760.1| PREDICTED: ras-related protein Rab7 isoform X2 [Cucumis melo]
Length=203

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN HEQDI+ QGIP+ + E E RGGCAC
Sbjct  162  NVDAAFLCIAKTALANEHEQDIYFQGIPETVVETEQRGGCAC  203



>ref|XP_004139780.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus]
 ref|XP_004161772.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus]
 ref|XP_008447759.1| PREDICTED: ras-related protein Rab7 isoform X1 [Cucumis melo]
 gb|KGN44144.1| hypothetical protein Csa_7G206950 [Cucumis sativus]
Length=205

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN HEQDI+ QGIP+ + E E RGGCAC
Sbjct  164  NVDAAFLCIAKTALANEHEQDIYFQGIPETVVETEQRGGCAC  205



>gb|KCW71068.1| hypothetical protein EUGRSUZ_F04166 [Eucalyptus grandis]
Length=202

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDA+FLCIAK ALAN HE DI+ QGIPDA+P+ E RGGCAC
Sbjct  161  NVDASFLCIAKAALANDHEHDIYFQGIPDAVPDSEQRGGCAC  202



>ref|XP_009628178.1| PREDICTED: ras-related protein Rab7 [Nicotiana tomentosiformis]
Length=204

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IAKTALAN HEQDI+ QGIP+A+ E E RGGCAC
Sbjct  163  NVDAAFLSIAKTALANEHEQDIYFQGIPEAVSETEQRGGCAC  204



>ref|XP_004237840.1| PREDICTED: ras-related protein Rab7 [Solanum lycopersicum]
 ref|XP_006359018.1| PREDICTED: ras-related protein Rab7-like [Solanum tuberosum]
Length=204

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IAKTALAN HEQDI+ QGIP+A+ E E RGGCAC
Sbjct  163  NVDAAFLSIAKTALANEHEQDIYFQGIPEAVSETEQRGGCAC  204



>gb|KJB59527.1| hypothetical protein B456_009G259500 [Gossypium raimondii]
Length=205

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN  EQDI+ QGIP+A+ E E RGGCAC
Sbjct  164  NVDAAFLCIAKTALANEREQDIYFQGIPEAVTETEQRGGCAC  205



>ref|XP_002264356.1| PREDICTED: ras-related protein Rab7 isoform X1 [Vitis vinifera]
 ref|XP_010645813.1| PREDICTED: ras-related protein Rab7 isoform X1 [Vitis vinifera]
 emb|CBI29350.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN HEQDI+ QGIP+A+ E E  GGCAC
Sbjct  164  NVDAAFLCIAKTALANEHEQDIYFQGIPEAVSETEQGGGCAC  205



>ref|XP_010645814.1| PREDICTED: ras-related protein Rab7 isoform X2 [Vitis vinifera]
Length=181

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN HEQDI+ QGIP+A+ E E  GGCAC
Sbjct  140  NVDAAFLCIAKTALANEHEQDIYFQGIPEAVSETEQGGGCAC  181



>gb|KJB28941.1| hypothetical protein B456_005G076500 [Gossypium raimondii]
Length=205

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAF CIAKTALAN  EQDI+ QGIPDA+ E E RGGCAC
Sbjct  164  NVDAAFHCIAKTALANEREQDIYFQGIPDAVSETEQRGGCAC  205



>gb|KJB28942.1| hypothetical protein B456_005G076500 [Gossypium raimondii]
Length=175

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAF CIAKTALAN  EQDI+ QGIPDA+ E E RGGCAC
Sbjct  134  NVDAAFHCIAKTALANEREQDIYFQGIPDAVSETEQRGGCAC  175



>ref|XP_009763630.1| PREDICTED: ras-related protein Rab7-like [Nicotiana sylvestris]
Length=204

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IAKTALAN HEQDI+ QG P+A+ E E RGGCAC
Sbjct  163  NVDAAFLSIAKTALANEHEQDIYFQGTPEAVSETEQRGGCAC  204



>ref|XP_004496410.1| PREDICTED: ras-related protein Rab7-like [Cicer arietinum]
Length=206

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVDAAFLCIAKTALAN  EQDI+ QGIP+A+PE E R GGCAC
Sbjct  164  NVDAAFLCIAKTALANEREQDIYFQGIPEAVPENEQRGGGCAC  206



>ref|XP_002527104.1| protein with unknown function [Ricinus communis]
 gb|EEF35267.1| protein with unknown function [Ricinus communis]
Length=205

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAKTALAN  EQDI+ QGIP+A+ E E RGGCAC
Sbjct  164  NVDPAFLCIAKTALANEREQDIYFQGIPEAVSESEQRGGCAC  205



>emb|CDP01135.1| unnamed protein product [Coffea canephora]
Length=205

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDA+F CIAKTALAN HEQDI+ Q IP+A+ E E RGGCAC
Sbjct  164  NVDASFFCIAKTALANEHEQDIYFQNIPEAVSEAEQRGGCAC  205



>ref|XP_009606119.1| PREDICTED: ras-related protein Rab7-like [Nicotiana tomentosiformis]
Length=204

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IAKTALAN HEQDI+ QGIP+A+ E E R GCAC
Sbjct  163  NVDAAFLSIAKTALANEHEQDIYFQGIPEAVAETEQRSGCAC  204



>emb|CAA98168.1| RAB7A [Lotus japonicus]
Length=205

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN H+QDI+ Q IP+A PE E +GGC C
Sbjct  164  NVDAAFLCIAKTALANEHDQDIYFQAIPEAAPENEQKGGCQC  205



>ref|XP_009335165.1| PREDICTED: ras-related protein Rab7 [Pyrus x bretschneideri]
Length=206

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NVD AFLCIAKTALAN HEQDI+ QGIPDA+ E + R  GGCAC
Sbjct  163  NVDGAFLCIAKTALANEHEQDIYFQGIPDAVSESDQRGGGGCAC  206



>gb|ACU17616.1| unknown [Glycine max]
Length=206

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFLCIAK ALAN HEQDI+ QGIP+ A+PE E R GCAC
Sbjct  164  NVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC  206



>gb|KHN17053.1| Ras-related protein Rab7 [Glycine soja]
Length=206

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFLCIAK ALAN HEQDI+ QGIP+ A+PE E R GCAC
Sbjct  164  NVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC  206



>ref|XP_003556176.1| PREDICTED: ras-related protein Rab7 [Glycine max]
 sp|Q43463.1|RAB7_SOYBN RecName: Full=Ras-related protein Rab7 [Glycine max]
 gb|AAA34004.1| Rab7p [Glycine max]
 gb|KHN03703.1| Ras-related protein Rab7 [Glycine soja]
Length=206

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFLCIAK ALAN HEQDI+ QGIP+ A+PE E R GCAC
Sbjct  164  NVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC  206



>gb|ACU24093.1| unknown [Glycine max]
Length=206

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFLCIAK ALAN HEQDI+ QGIP+ A+PE E R GCAC
Sbjct  164  NVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC  206



>ref|XP_010681464.1| PREDICTED: ras-related protein Rab7 [Beta vulgaris subsp. vulgaris]
Length=205

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAK ALAN  EQDI+ QGIP+A+ E E RGGCAC
Sbjct  164  NVDGAFLCIAKAALANEREQDIYFQGIPEAVSETEQRGGCAC  205



>sp|Q41640.1|RAB7_VIGAC RecName: Full=Ras-related protein Rab7 [Vigna aconitifolia]
 gb|AAA34242.1| Rab7p [Vigna aconitifolia]
Length=206

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFLCIAK ALAN HEQDI+ QGIP+ A+PE E R GCAC
Sbjct  164  NVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC  206



>ref|XP_007143599.1| hypothetical protein PHAVU_007G085200g [Phaseolus vulgaris]
 gb|ESW15593.1| hypothetical protein PHAVU_007G085200g [Phaseolus vulgaris]
Length=206

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFLCIAK ALAN HEQDI+ QGIP+ A+PE E R GCAC
Sbjct  164  NVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC  206



>ref|NP_001235371.1| uncharacterized protein LOC100499740 [Glycine max]
 gb|ACU13453.1| unknown [Glycine max]
Length=206

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFLCIAK ALAN HEQDI+ QG+P+ A+PE E R GCAC
Sbjct  164  NVDAAFLCIAKAALANEHEQDIYFQGVPEAAVPENEQRSGCAC  206



>ref|XP_004489906.1| PREDICTED: ras-related protein Rab7-like [Cicer arietinum]
Length=205

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTALAN  +QDI+ Q IP+A PE E RGGCAC
Sbjct  164  NVDAAFLCIAKTALANERDQDIYFQPIPEAAPENEQRGGCAC  205



>ref|XP_010089429.1| Ras-related protein Rab7 [Morus notabilis]
 gb|EXB37795.1| Ras-related protein Rab7 [Morus notabilis]
Length=262

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAF  IAKTALAN +EQDI+ QGIP+AI E E RGGCAC
Sbjct  221  NVDAAFFSIAKTALANENEQDIYFQGIPEAISESEQRGGCAC  262



>ref|XP_007019678.1| RAB GTPase G3A isoform 1 [Theobroma cacao]
 gb|EOY16903.1| RAB GTPase G3A isoform 1 [Theobroma cacao]
Length=205

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAKTALAN  EQDI+ QGIP+A+ E E R GCAC
Sbjct  164  NVDHAFLCIAKTALANEREQDIYFQGIPEAVSETEQRNGCAC  205



>gb|KEH43618.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=207

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NVDAAFLCIAKTALAN  EQDI+ QGIP+A+PE E    GGCAC
Sbjct  164  NVDAAFLCIAKTALANEREQDIYFQGIPEAVPESEQSGGGGCAC  207



>gb|KEH43617.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=234

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NVDAAFLCIAKTALAN  EQDI+ QGIP+A+PE E    GGCAC
Sbjct  191  NVDAAFLCIAKTALANEREQDIYFQGIPEAVPESEQSGGGGCAC  234



>ref|XP_010243311.1| PREDICTED: ras-related protein Rab7 [Nelumbo nucifera]
Length=206

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVDAAFLC+AK+ALAN HEQDI+ Q IP+A+ E E R GGCAC
Sbjct  164  NVDAAFLCVAKSALANEHEQDIYFQSIPEAVSETEQRGGGCAC  206



>ref|XP_008348542.1| PREDICTED: ras-related protein Rab7-like [Malus domestica]
Length=150

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NVDAAFLCIAKTALAN +EQDI+ QGIPDA+ E + R  GGCAC
Sbjct  107  NVDAAFLCIAKTALANENEQDIYFQGIPDAVSESDQRGGGGCAC  150



>ref|XP_009342702.1| PREDICTED: ras-related protein Rab7 [Pyrus x bretschneideri]
Length=207

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NVD AFLCIAKTALAN HEQDI+ QG+P+A+ E + R  GGCAC
Sbjct  164  NVDGAFLCIAKTALANEHEQDIYFQGVPEAVTESDQRGGGGCAC  207



>ref|XP_008361208.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein Rab7-like 
[Malus domestica]
Length=207

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NVD AFLCIAKTALAN HEQDI+ QG+P+A+ E + R  GGCAC
Sbjct  164  NVDGAFLCIAKTALANEHEQDIYFQGVPEAVTESDQRGGGGCAC  207



>ref|XP_008337228.1| PREDICTED: ras-related protein Rab7-like [Malus domestica]
Length=207

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NVD AFLCIAKTALAN HEQDI+ QG+P+A+ E + R  GGCAC
Sbjct  164  NVDGAFLCIAKTALANEHEQDIYFQGVPEAVTESDQRGGGGCAC  207



>ref|XP_002300895.1| hypothetical protein POPTR_0002s06310g [Populus trichocarpa]
 gb|ABK95304.1| unknown [Populus trichocarpa]
 gb|EEE80168.1| hypothetical protein POPTR_0002s06310g [Populus trichocarpa]
Length=205

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL IAK ALAN HEQDI+ QGIP+A  E E RGGCAC
Sbjct  164  NVDPAFLSIAKIALANEHEQDIYFQGIPEAASESEQRGGCAC  205



>ref|XP_010261069.1| PREDICTED: ras-related protein Rab7-like isoform X5 [Nelumbo 
nucifera]
Length=206

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVDAAF C+AKTALAN HEQDI+ Q IP+A+ E E R GGCAC
Sbjct  164  NVDAAFFCVAKTALANEHEQDIYFQSIPEAVSETEQRGGGCAC  206



>ref|XP_010438119.1| PREDICTED: ras-related protein RABG3a [Camelina sativa]
Length=206

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  164  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKSGGCAC  206



>ref|XP_010421879.1| PREDICTED: ras-related protein RABG3a-like [Camelina sativa]
Length=206

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  164  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKSGGCAC  206



>ref|NP_001154217.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
 gb|AEE82785.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
Length=217

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  175  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKGGGCAC  217



>ref|XP_006288671.1| hypothetical protein CARUB_v10001979mg [Capsella rubella]
 gb|EOA21569.1| hypothetical protein CARUB_v10001979mg [Capsella rubella]
Length=206

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  164  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKTGGCAC  206



>ref|NP_192710.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
 sp|Q948K8.1|RAG3A_ARATH RecName: Full=Ras-related protein RABG3a; Short=AtRABG3a; AltName: 
Full=Ras-related protein Rab76; Short=AtRab76 [Arabidopsis 
thaliana]
 dbj|BAB68376.1| AtRab76 [Arabidopsis thaliana]
 dbj|BAF01041.1| AtRab76 [Arabidopsis thaliana]
 gb|ABL66760.1| At4g09720 [Arabidopsis thaliana]
 gb|AEE82783.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
Length=206

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  164  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKGGGCAC  206



>ref|XP_010543071.1| PREDICTED: ras-related protein RABG3a [Tarenaya hassleriana]
Length=206

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AF  IAK ALAN HEQDI+ QGIP+A+PE E R GGCAC
Sbjct  164  NVDEAFFTIAKKALANDHEQDIYFQGIPEAVPETEPRGGGCAC  206



>gb|AFU92144.1| small GTP binding protein [Arachis hypogaea]
Length=205

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLCIAKTAL+N ++QDI+ Q +P+ +P+ E  GGCAC
Sbjct  164  NVDAAFLCIAKTALSNEYDQDIYFQAMPETVPDNEQSGGCAC  205



>emb|CAB39639.1| rab7-like protein [Arabidopsis thaliana]
 emb|CAB78095.1| rab7-like protein [Arabidopsis thaliana]
Length=208

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  166  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKGGGCAC  208



>gb|KDP35265.1| hypothetical protein JCGZ_09424 [Jatropha curcas]
Length=207

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AKTALA  HE DI+ QGI + + E E RGGCAC
Sbjct  166  NVDEAFLCVAKTALATEHEHDIYFQGISETVSEVEQRGGCAC  207



>ref|NP_849347.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
 gb|ABN04777.1| At4g09720 [Arabidopsis thaliana]
 gb|AEE82784.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
Length=172

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  130  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKGGGCAC  172



>ref|NP_001190694.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
 gb|AEE82786.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
Length=211

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPDA+ E E + GGCAC
Sbjct  169  NVDEAFLTIAKTALANEHEQDIYFQGIPDAVTENEPKGGGCAC  211



>gb|AFK43592.1| unknown [Lotus japonicus]
Length=205

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IAKTALA   EQDI+ Q IP+A+ E E RGGCAC
Sbjct  164  NVDAAFLSIAKTALATDREQDIYFQNIPEAVAESEQRGGCAC  205



>ref|XP_009336367.1| PREDICTED: ras-related protein Rab7 [Pyrus x bretschneideri]
Length=207

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AKT L N HEQDI+ QGI + + E + RGGCAC
Sbjct  166  NVDEAFLCVAKTGLTNEHEQDIYFQGISETVSEADQRGGCAC  207



>ref|XP_011074118.1| PREDICTED: ras-related protein Rab7 [Sesamum indicum]
Length=205

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL IAK ALAN H+QDI+ QG+P+A+ E E +GGCAC
Sbjct  164  NVDPAFLSIAKAALANEHDQDIYFQGMPEAVSETEQQGGCAC  205



>gb|KJB59938.1| hypothetical protein B456_009G286800 [Gossypium raimondii]
 gb|KJB59939.1| hypothetical protein B456_009G286800 [Gossypium raimondii]
Length=205

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IAK+ALA   EQDI+ QGIP+A+ E E R GCAC
Sbjct  164  NVDAAFLSIAKSALAKEREQDIYFQGIPEAVTETEQRSGCAC  205



>ref|XP_002872458.1| AtRABG3a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48717.1| AtRABG3a [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPD + E E + GGCAC
Sbjct  164  NVDEAFLTIAKTALANEHEQDIYFQGIPDGVTENEPKGGGCAC  206



>ref|XP_006434552.1| hypothetical protein CICLE_v10002522mg [Citrus clementina]
 ref|XP_006473152.1| PREDICTED: ras-related protein Rab7-like [Citrus sinensis]
 gb|ESR47792.1| hypothetical protein CICLE_v10002522mg [Citrus clementina]
Length=204

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL IA+ ALAN  EQDI+ QGIP+A  E E RGGCAC
Sbjct  163  NVDAAFLSIARAALANEREQDIYFQGIPEAPSENEQRGGCAC  204



>ref|XP_011026316.1| PREDICTED: ras-related protein Rab7 [Populus euphratica]
Length=205

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL IAK ALAN HEQDI+ Q +P+A  E E RGGCAC
Sbjct  164  NVDPAFLSIAKIALANEHEQDIYFQAVPEAASESEQRGGCAC  205



>ref|XP_010455367.1| PREDICTED: ras-related protein RABG3a-like [Camelina sativa]
Length=197

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN HEQDI+ QGIPD + E E + GGCAC
Sbjct  155  NVDEAFLTIAKTALANEHEQDIYFQGIPDTVTENEPKSGGCAC  197



>ref|XP_007048144.1| RAB GTPase G3A [Theobroma cacao]
 gb|EOX92301.1| RAB GTPase G3A [Theobroma cacao]
Length=207

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AKTALA+ HE DI+ QGI +   E E RGGCAC
Sbjct  166  NVDEAFLCVAKTALASEHEHDIYFQGISETASEVEQRGGCAC  207



>ref|XP_008232432.1| PREDICTED: ras-related protein Rab7 [Prunus mume]
 ref|XP_008226511.1| PREDICTED: ras-related protein Rab7-like [Prunus mume]
Length=207

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAKT + N HEQDI+ QGI +++ E E RG CAC
Sbjct  166  NVDEAFLCIAKTGMINEHEQDIYFQGISESVSEAEQRGSCAC  207



>gb|KHG00821.1| Ras-related Rab7 [Gossypium arboreum]
Length=203

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL I+K+ALAN  EQDI+ QGIP+A+ E E R GCAC
Sbjct  162  NVDAAFLSISKSALANELEQDIYFQGIPEAMTETEQRSGCAC  203



>gb|EYU36545.1| hypothetical protein MIMGU_mgv1a013950mg [Erythranthe guttata]
Length=205

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AF C+AK ALAN H+QDI+ Q +P+ +PE E +GGCAC
Sbjct  164  NVDPAFFCVAKAALANEHDQDIYFQEMPETVPETEQQGGCAC  205



>ref|XP_002307527.1| hypothetical protein POPTR_0005s22070g [Populus trichocarpa]
 gb|ABK95455.1| unknown [Populus trichocarpa]
 gb|EEE94523.1| hypothetical protein POPTR_0005s22070g [Populus trichocarpa]
Length=205

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL IAKTALA+ H QDI+ QGIP+ + E E RGGCAC
Sbjct  164  NVDPAFLSIAKTALAHEHGQDIYFQGIPEDVTENEQRGGCAC  205



>emb|CDY48910.1| BnaA09g22850D [Brassica napus]
Length=206

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN H+QDI+ QGIP+A+ E E R GGCAC
Sbjct  164  NVDEAFLTIAKTALANEHDQDIYFQGIPEAVIENEPRGGGCAC  206



>ref|XP_009113550.1| PREDICTED: ras-related protein RABG3a [Brassica rapa]
Length=206

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFL IAKTALAN H+QDI+ QGIP+A+ E E R GGCAC
Sbjct  164  NVDEAFLTIAKTALANEHDQDIYFQGIPEAVIENEPRGGGCAC  206



>gb|KFK32051.1| hypothetical protein AALP_AA6G193700 [Arabis alpina]
Length=206

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AF  IAKTALAN HEQDI+ QGIPDA  E E + GGCAC
Sbjct  164  NVDEAFFTIAKTALANEHEQDIYFQGIPDATTENEPKGGGCAC  206



>gb|KFK44364.1| hypothetical protein AALP_AA1G247900 [Arabis alpina]
Length=205

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCI K ALAN  EQDI+ QGIP+A  E E RGGC+C
Sbjct  164  NVDDAFLCITKLALANEREQDIYFQGIPEAGSEPEQRGGCSC  205



>ref|XP_007207890.1| hypothetical protein PRUPE_ppa021084mg [Prunus persica]
 gb|EMJ09089.1| hypothetical protein PRUPE_ppa021084mg [Prunus persica]
Length=207

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAKT + N HEQDI+ QGI + + E E RG CAC
Sbjct  166  NVDEAFLCIAKTGMINEHEQDIYFQGISETVSEAEQRGRCAC  207



>ref|XP_003636324.1| Ras-related protein Rab7 [Medicago truncatula]
Length=209

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFL IAKTALAN  EQDI+ Q IP+  +PE E RGGCAC
Sbjct  167  NVDAAFLRIAKTALANEREQDIYFQPIPEPVVPENEQRGGCAC  209



>ref|XP_003636325.1| Ras-related protein Rab7 [Medicago truncatula]
Length=206

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFL IAKTALAN  EQDI+ Q IP+  +PE E RGGCAC
Sbjct  164  NVDAAFLRIAKTALANEREQDIYFQPIPEPVVPENEQRGGCAC  206



>gb|AAA74120.1| putative [Nicotiana tabacum]
Length=204

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL   KT LAN H QDI+ QGIP+A+ E E R GCAC
Sbjct  163  NVDAAFLFYCKTRLANEHRQDIYFQGIPEAVSETEQRSGCAC  204



>ref|XP_011044829.1| PREDICTED: ras-related protein Rab7-like [Populus euphratica]
Length=205

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL IAKTALAN H QDI+ Q IP+ + + E RGGCAC
Sbjct  164  NVDLAFLSIAKTALANEHGQDIYFQSIPEDVTDNEQRGGCAC  205



>gb|KCW54354.1| hypothetical protein EUGRSUZ_I00315 [Eucalyptus grandis]
Length=152

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AF C+A+ ALA+ H+QDI+ QGI + + E E RGGCAC
Sbjct  111  NVDEAFFCVAQAALASEHQQDIYFQGISETVSEVEPRGGCAC  152



>gb|EPS71938.1| hypothetical protein M569_02820 [Genlisea aurea]
Length=205

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAK ALAN H+QDI+ Q IP+ +   E +GGCAC
Sbjct  164  NVDPAFLCIAKAALANEHDQDIYFQAIPETVSGTEQQGGCAC  205



>ref|XP_008338652.1| PREDICTED: ras-related protein Rab7-like [Malus domestica]
Length=206

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AKT L N HEQDI+ QGI + + E + RG CAC
Sbjct  165  NVDEAFLCVAKTGLTNEHEQDIYFQGISETVSEADQRGVCAC  206



>emb|CDX91688.1| BnaC08g06070D [Brassica napus]
Length=205

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ QGIP++  E E RGGCAC
Sbjct  164  NVDESFLCITKLALANERDQDIYFQGIPESGSEPEQRGGCAC  205



>emb|CDY41473.1| BnaA08g20750D [Brassica napus]
Length=205

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ QGIP++  E E RGGCAC
Sbjct  164  NVDESFLCITKLALANERDQDIYFQGIPESGSEPEQRGGCAC  205



>ref|XP_009110129.1| PREDICTED: ras-related protein RABG3b [Brassica rapa]
Length=205

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ QGIP++  E E RGGCAC
Sbjct  164  NVDESFLCITKLALANERDQDIYFQGIPESGSEPEQRGGCAC  205



>ref|XP_010027761.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein Rab7 [Eucalyptus 
grandis]
Length=206

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AF C+A+ ALA+ H+QDI+ QGI + + E E RGGCAC
Sbjct  165  NVDEAFFCVAQAALASEHQQDIYFQGISETVSEVEPRGGCAC  206



>gb|ABF13310.1| Rab7 [Phaseolus vulgaris]
Length=110

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRG  397
            NVDAAFLCIAK ALAN HEQDI+ QGIP+ A+PE E R 
Sbjct  72   NVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRS  110



>ref|XP_010460036.1| PREDICTED: ras-related protein RABG3b [Camelina sativa]
Length=206

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ QGIP+   E E RGGCAC
Sbjct  165  NVDESFLCITKLALANERDQDIYFQGIPETGSEPEQRGGCAC  206



>gb|KJB49113.1| hypothetical protein B456_008G101600 [Gossypium raimondii]
Length=208

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQ-DIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AKTALA+ HEQ DI+ +GI +   E E RGGCAC
Sbjct  166  NVDEAFLCVAKTALASEHEQHDIYFRGISETTSEVEQRGGCAC  208



>gb|KHG02230.1| Ras-related Rab7 [Gossypium arboreum]
Length=208

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQ-DIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AKTALA+ HEQ DI+ +GI +   E E RGGCAC
Sbjct  166  NVDEAFLCVAKTALASEHEQHDIYFRGISETTSEVEQRGGCAC  208



>ref|XP_006842165.1| hypothetical protein AMTR_s00078p00147080 [Amborella trichopoda]
 gb|ERN03840.1| hypothetical protein AMTR_s00078p00147080 [Amborella trichopoda]
Length=205

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +A+ ALA+  EQDI+ Q IP+A+ E E RGGCAC
Sbjct  164  NVDPAFLSVARIALASEREQDIYFQSIPEAVSENEQRGGCAC  205



>ref|XP_003525083.1| PREDICTED: ras-related protein Rab7-like [Glycine max]
Length=207

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NV+ AFLC+AK AL N H+QDI+ +GI +A+ E E R GCAC
Sbjct  166  NVEEAFLCVAKIALENEHDQDIYFRGISEAVSEAEQRSGCAC  207



>emb|CDY05073.1| BnaC03g28710D [Brassica napus]
Length=206

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AF  IAKTALAN ++QDI+ QGIP A+PE E + GGCAC
Sbjct  164  NVDEAFFTIAKTALANENDQDIYFQGIPAAMPENEPKGGGCAC  206



>gb|AFK34363.1| unknown [Medicago truncatula]
Length=206

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVDAAFL IAKTALAN  EQDI+ Q IP+  +PE E RGG AC
Sbjct  164  NVDAAFLRIAKTALANEREQDIYFQPIPEPVVPENEQRGGWAC  206



>ref|XP_006397152.1| hypothetical protein EUTSA_v10028966mg [Eutrema salsugineum]
 gb|ESQ38605.1| hypothetical protein EUTSA_v10028966mg [Eutrema salsugineum]
Length=206

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRG-GCAC  385
            NVD AFL IAKTALAN H+QD++ QGI DA  E E +G GCAC
Sbjct  164  NVDEAFLTIAKTALANEHDQDLYFQGIQDASTENEAKGSGCAC  206



>ref|XP_007159766.1| hypothetical protein PHAVU_002G265500g [Phaseolus vulgaris]
 gb|ESW31760.1| hypothetical protein PHAVU_002G265500g [Phaseolus vulgaris]
Length=207

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NV+ AFLC+AK AL N H+QDI+ +GI DA+ E E R  CAC
Sbjct  166  NVEEAFLCVAKIALENEHDQDIYFRGISDAVSEAEHRSSCAC  207



>ref|XP_010498755.1| PREDICTED: ras-related protein RABG3b-like [Camelina sativa]
Length=206

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ QG P+   E E RGGCAC
Sbjct  165  NVDESFLCITKLALANERDQDIYFQGTPETGSEPEQRGGCAC  206



>ref|XP_002890529.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66788.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ Q IP+   E E RGGCAC
Sbjct  164  NVDDSFLCITKLALANERDQDIYFQAIPETGSESEQRGGCAC  205



>ref|XP_009134161.1| PREDICTED: ras-related protein RABG3a-like [Brassica rapa]
Length=206

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AF  IAKTALAN ++QDI+ QGIP  +PE E + GGCAC
Sbjct  164  NVDEAFFTIAKTALANENDQDIYFQGIPAVVPENEPKGGGCAC  206



>emb|CDX90732.1| BnaA03g24120D [Brassica napus]
Length=206

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AF  IAKTALAN ++QDI+ QGIP  +PE E + GGCAC
Sbjct  164  NVDEAFFTIAKTALANENDQDIYFQGIPAVVPENEPKGGGCAC  206



>ref|XP_011464793.1| PREDICTED: ras-related protein Rab7 [Fragaria vesca subsp. vesca]
Length=210

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIF---LQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AKT L + HEQDIF    +GI + + E E RGGCAC
Sbjct  166  NVDEAFLCVAKTGLTHEHEQDIFPSYFKGISETVSEAEQRGGCAC  210



>emb|CAA98169.1| RAB7B [Lotus japonicus]
Length=205

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  DAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            DAAFL IAKTALA   EQDI+ Q IP+A+ E E RGGCA 
Sbjct  166  DAAFLSIAKTALATDREQDIYFQNIPEAVAESEQRGGCAS  205



>ref|XP_002532185.1| protein with unknown function [Ricinus communis]
 gb|EEF30203.1| protein with unknown function [Ricinus communis]
Length=209

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  507  VDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            VD AFLC+AKTAL +  E DI+ QGI +++ E E RGGCAC
Sbjct  169  VDEAFLCVAKTALDSEPEHDIYFQGISESVSEVEQRGGCAC  209



>ref|NP_001242593.1| uncharacterized protein LOC100787120 [Glycine max]
 gb|ACU23066.1| unknown [Glycine max]
 gb|ACU23071.1| unknown [Glycine max]
Length=207

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NV+ AF C+AK AL N H+QDI+ +GI +A+ E E R GCAC
Sbjct  166  NVEEAFSCVAKIALENEHDQDIYFRGISEAVSEAEQRSGCAC  207



>dbj|BAJ99564.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CDM83781.1| unnamed protein product [Triticum aestivum]
Length=206

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +AK AL +  +QDI+ Q + D +PE E RGGCAC
Sbjct  165  NVDEAFLSVAKLALEHERDQDIYFQTVADPVPETEQRGGCAC  206



>ref|XP_002440145.1| hypothetical protein SORBIDRAFT_09g026820 [Sorghum bicolor]
 gb|EES18575.1| hypothetical protein SORBIDRAFT_09g026820 [Sorghum bicolor]
Length=170

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAK AL + H+QDI+ + + + +P+ E  GGCAC
Sbjct  129  NVDTAFLCIAKLALEHEHDQDIYFKTVAEQVPDTEQTGGCAC  170



>gb|AFC93432.1| Ras-like protein [Triticum aestivum]
Length=206

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +AK AL +  +QDI+ Q + D +PE E RGGCAC
Sbjct  165  NVDEAFLSVAKLALEHERDQDIYFQTVADPVPETEQRGGCAC  206



>ref|XP_003569676.1| PREDICTED: ras-related protein Rab7 [Brachypodium distachyon]
Length=206

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +AK AL +  +QDI+ Q + D +PE E RGGCAC
Sbjct  165  NVDDAFLSVAKLALEHERDQDIYFQTVADPVPETEQRGGCAC  206



>ref|XP_006303560.1| hypothetical protein CARUB_v10011037mg [Capsella rubella]
 gb|EOA36458.1| hypothetical protein CARUB_v10011037mg [Capsella rubella]
Length=206

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPD-AIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ QGIP+    E E RGGCAC
Sbjct  164  NVDDSFLCITKLALANERDQDIYFQGIPETGGSEPEQRGGCAC  206



>ref|XP_010521112.1| PREDICTED: ras-related protein Rab7 [Tarenaya hassleriana]
Length=205

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD+ FL IAK ALA   EQDI+ +GIP+A+ E    GGCAC
Sbjct  164  NVDSGFLSIAKLALAKEREQDIYFEGIPEAVSETGQGGGCAC  205



>ref|XP_008812295.1| PREDICTED: ras-related protein Rab7 [Phoenix dactylifera]
Length=205

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLC+AK AL +  +QDI+ Q IP+ I E E   GCAC
Sbjct  164  NVDAAFLCVAKLALEHDRDQDIYFQNIPEPISETEQSRGCAC  205



>ref|XP_010935166.1| PREDICTED: ras-related protein Rab7 [Elaeis guineensis]
Length=205

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLC+AK AL +  +QDI+ Q IP+ I E E   GCAC
Sbjct  164  NVDAAFLCVAKLALEHDRDQDIYFQNIPEPIAEAEQSRGCAC  205



>gb|AFW83742.2| hypothetical protein ZEAMMB73_052378 [Zea mays]
Length=181

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +AK AL +  +QDI+ Q + D +PE E R GCAC
Sbjct  140  NVDNAFLTVAKLALEHERDQDIYFQSVADPVPETEQRSGCAC  181



>ref|XP_002458401.1| hypothetical protein SORBIDRAFT_03g032810 [Sorghum bicolor]
 gb|EES03521.1| hypothetical protein SORBIDRAFT_03g032810 [Sorghum bicolor]
Length=206

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +AK AL +  +QDI+ Q + D +PE E R GCAC
Sbjct  165  NVDNAFLTVAKLALEHERDQDIYFQSVTDPVPETEQRSGCAC  206



>ref|NP_001266750.1| uncharacterized protein LOC101027204 [Zea mays]
 gb|ACN31029.1| unknown [Zea mays]
Length=206

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +AK AL +  +QDI+ Q + D +PE E R GCAC
Sbjct  165  NVDNAFLTVAKLALEHERDQDIYFQSVADPVPETEQRSGCAC  206



>ref|XP_009108378.1| PREDICTED: ras-related protein RABG3b-like [Brassica rapa]
Length=106

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCA  388
            NVD  FLCI K ALAN  +Q I+ QGIP++  E E RGGCA
Sbjct  65   NVDELFLCITKLALANEGDQHIYFQGIPESGSEPEQRGGCA  105



>ref|XP_004969742.1| PREDICTED: ras-related protein Rab7-like [Setaria italica]
Length=206

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFL +AK AL +  +QDI+ Q + D +PE E R GCAC
Sbjct  165  NVDNAFLSVAKLALEHERDQDIYFQAVADPVPETEPRSGCAC  206



>ref|NP_001044060.1| Os01g0714900 [Oryza sativa Japonica Group]
 dbj|BAD87568.1| putative rab7 protein [Oryza sativa Japonica Group]
 dbj|BAF05974.1| Os01g0714900 [Oryza sativa Japonica Group]
 dbj|BAG99278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=207

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQG-IPDAIPEFETRGGCAC  385
            NVD+AFL +AK AL +  +QDI+ Q  +PD +PE E R GCAC
Sbjct  165  NVDSAFLSVAKLALEHERDQDIYFQTVVPDPVPEAEQRSGCAC  207



>ref|XP_010652865.1| PREDICTED: ras-related protein Rab7 isoform X1 [Vitis vinifera]
Length=206

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLC+A+  L+N H Q+ + + I + + E E +GGCAC
Sbjct  165  NVDAAFLCVARVGLSNEHGQENYFRAISEVVSETEQKGGCAC  206



>ref|XP_002279477.1| PREDICTED: ras-related protein Rab7 isoform X2 [Vitis vinifera]
 emb|CBI21523.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFLC+A+  L+N H Q+ + + I + + E E +GGCAC
Sbjct  164  NVDAAFLCVARVGLSNEHGQENYFRAISEVVSETEQKGGCAC  205



>gb|EEC71383.1| hypothetical protein OsI_03499 [Oryza sativa Indica Group]
Length=288

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQG-IPDAIPEFETRGGCAC  385
            NVD+AFL +AK AL +  +QDI+ Q  +PD +PE E R GCAC
Sbjct  246  NVDSAFLSVAKLALEHERDQDIYFQTVVPDPVPEAEQRSGCAC  288



>gb|AFW78901.1| hypothetical protein ZEAMMB73_911919 [Zea mays]
Length=154

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIA+ AL + H+QDI+ + + + +P+ E   GCAC
Sbjct  113  NVDTAFLCIARLALEHEHDQDIYFKTVAEQVPDTEQTSGCAC  154



>gb|KEH26012.1| small GTPase family RAB protein [Medicago truncatula]
Length=226

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAKTALAN  +QDI +Q I  A+ E E R GCAC
Sbjct  164  NVDDAFLCIAKTALANERDQDICVQPIWPAMLENEQRVGCAC  205



>ref|XP_003636340.1| Ras-related protein Rab7 [Medicago truncatula]
Length=226

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAKTALAN  +QDI +Q I  A+ E E R GCAC
Sbjct  164  NVDDAFLCIAKTALANERDQDICVQPIWPAMLENEQRVGCAC  205



>ref|XP_008649936.1| PREDICTED: ras-related protein Rab7-like [Zea mays]
 gb|AFW78900.1| hypothetical protein ZEAMMB73_911919 [Zea mays]
Length=206

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIA+ AL + H+QDI+ + + + +P+ E   GCAC
Sbjct  165  NVDTAFLCIARLALEHEHDQDIYFKTVAEQVPDTEQTSGCAC  206



>ref|XP_009410766.1| PREDICTED: ras-related protein Rab7-like [Musa acuminata subsp. 
malaccensis]
Length=205

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAFL +A+ AL +  +QDI+ Q IP+   + E RGGCAC
Sbjct  164  NVDAAFLQVAQLALQHDRDQDIYFQAIPEPASQTEQRGGCAC  205



>gb|EEC79597.1| hypothetical protein OsI_20781 [Oryza sativa Indica Group]
Length=206

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD+AFLCIAK AL + H+QDI+ + +    P+ E   GCAC
Sbjct  165  NVDSAFLCIAKLALEHEHDQDIYFKTVAQPAPDTEHTSGCAC  206



>gb|AAT39219.1| putative GTPase [Oryza sativa Japonica Group]
Length=197

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD+AFLCIAK AL + H+QDI+ + +    P+ E   GCAC
Sbjct  156  NVDSAFLCIAKLALEHEHDQDIYFKTVAQPAPDTEHTSGCAC  197



>ref|NP_001056165.1| Os05g0536900 [Oryza sativa Japonica Group]
 dbj|BAF18079.1| Os05g0536900 [Oryza sativa Japonica Group]
 dbj|BAG97111.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64504.1| hypothetical protein OsJ_19355 [Oryza sativa Japonica Group]
Length=206

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD+AFLCIAK AL + H+QDI+ + +    P+ E   GCAC
Sbjct  165  NVDSAFLCIAKLALEHEHDQDIYFKTVAQPAPDTEHTSGCAC  206



>ref|XP_008671687.1| PREDICTED: ras-related protein Rab7-like, partial [Zea mays]
Length=132

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIA+ AL + H+QDI+ + + + +P+ E    CAC
Sbjct  91   NVDTAFLCIARLALEHEHDQDIYFKTVAEQVPDTEQTSRCAC  132



>gb|KDO45864.1| hypothetical protein CISIN_1g028305mg [Citrus sinensis]
Length=210

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFL--QGIPDAIPEFETRGGCAC  385
            N+D AFLC+A+ AL N H +DI+   QGI + + E E RGGCAC
Sbjct  168  NIDEAFLCVAEIALKNEH-KDIYYQPQGISETVSEVEQRGGCAC  210



>ref|XP_004961378.1| PREDICTED: ras-related protein Rab7-like isoform X2 [Setaria 
italica]
Length=206

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAK ALA+ H+QDI  + + + +P+ E   GCAC
Sbjct  165  NVDTAFLCIAKLALAHEHDQDICFKTVAEQVPDPEQTTGCAC  206



>ref|XP_006427978.1| hypothetical protein CICLE_v10026484mg [Citrus clementina]
 ref|XP_006464494.1| PREDICTED: ras-related protein Rab7-like isoform X2 [Citrus sinensis]
 gb|ESR41218.1| hypothetical protein CICLE_v10026484mg [Citrus clementina]
Length=210

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFL--QGIPDAIPEFETRGGCAC  385
            N+D AFLC+A+ AL N H +DI+   QGI + + E E RGGCAC
Sbjct  168  NIDEAFLCVAEIALKNEH-KDIYYQPQGISETVSEVEQRGGCAC  210



>ref|NP_173688.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
 sp|O04157.1|RAG3B_ARATH RecName: Full=Ras-related protein RABG3b; Short=AtRABG3b; AltName: 
Full=Ras-related protein Rab75; Short=AtRab75 [Arabidopsis 
thaliana]
 emb|CAA70951.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
 emb|CAA72904.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
 gb|AAC25512.1| Strong similaity to gb|Y09821 GTP-binding protein Rab7 from A. 
thaliana. EST gb|T76449 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAB68375.1| AtRab75 [Arabidopsis thaliana]
 gb|ABD42987.1| At1g22740 [Arabidopsis thaliana]
 gb|AEE30279.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
Length=203

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 2/42 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD +FLCI K ALAN  +QDI+ Q    ++P  E RGGCAC
Sbjct  164  NVDDSFLCITKLALANERDQDIYFQPDTGSVP--EQRGGCAC  203



>ref|XP_004961377.1| PREDICTED: ras-related protein Rab7-like isoform X1 [Setaria 
italica]
Length=220

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIAK ALA+ H+QDI  + + + +P+ E   GCAC
Sbjct  179  NVDTAFLCIAKLALAHEHDQDICFKTVAEQVPDPEQTTGCAC  220



>ref|XP_010915165.1| PREDICTED: ras-related protein Rab7-like [Elaeis guineensis]
Length=205

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AF+ IAK ALA+ +E+DI+ Q I + + E + RGGCAC
Sbjct  164  NVDDAFMHIAKIALAHNNEKDIYFQHIAEFVSEPQQRGGCAC  205



>ref|XP_004148452.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus]
 ref|XP_004161814.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus]
 gb|KGN62095.1| hypothetical protein Csa_2G297190 [Cucumis sativus]
Length=209

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 2/44 (5%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR--GGCAC  385
            NV+ AF+CIAK AL N  EQ+ + + I +++ E ETR  GGCAC
Sbjct  166  NVNEAFICIAKAALTNEEEQEPYFESISESVSEVETRGGGGCAC  209



>ref|XP_006644616.1| PREDICTED: ras-related protein Rab7-like [Oryza brachyantha]
Length=207

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQG-IPDAIPEFETRGGCAC  385
            NVD+AFL +AK AL +  +QDI+ Q  + D +PE E R GCAC
Sbjct  165  NVDSAFLSVAKLALEHERDQDIYFQTVVADPVPEAEQRSGCAC  207



>ref|XP_006464493.1| PREDICTED: ras-related protein Rab7-like isoform X1 [Citrus sinensis]
Length=213

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFL--QGIPDAIPEFETRGGCAC  385
            N+D AFLC+A+ AL N H +DI+   QGI + + E E RGGCAC
Sbjct  171  NIDEAFLCVAEIALKNEH-KDIYYQPQGISETVSEVEQRGGCAC  213



>ref|XP_006654709.1| PREDICTED: ras-related protein Rab7-like [Oryza brachyantha]
Length=205

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD+AFLCIAK AL + ++QDI+ + + + +P+ E   GCAC
Sbjct  164  NVDSAFLCIAKLALEHENDQDIYSKTVTEPVPDTEPTSGCAC  205



>ref|XP_008665947.1| PREDICTED: ras-related protein Rab7-like [Zea mays]
Length=144

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIA+ AL + H+QDI+ + + + + + E   GCAC
Sbjct  103  NVDTAFLCIARLALEHEHDQDIYFKTVVEQVSDTEQTSGCAC  144



>ref|XP_003630119.1| Ras-related protein Rab7 [Medicago truncatula]
 gb|AET04595.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=209

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AK A  N H+ DI+ +GI +   E E R  CAC
Sbjct  168  NVDDAFLCVAKVASENDHDLDIYFRGISETPSEAEQRSNCAC  209



>ref|XP_009803444.1| PREDICTED: ras-related protein Rab7-like isoform X2 [Nicotiana 
sylvestris]
Length=206

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFE-TRGGCAC  385
            NVDAAFLC A+ ALAN  + +I LQ IP+++   E  RGGCAC
Sbjct  164  NVDAAFLCAAQLALANEDDHNIQLQRIPESVSGIEQQRGGCAC  206



>ref|XP_009629178.1| PREDICTED: ras-related protein Rab7-like isoform X2 [Nicotiana 
tomentosiformis]
Length=206

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFE-TRGGCAC  385
            NVDAAFLC A+ ALAN  + +I LQ IP+++   E  RGGCAC
Sbjct  164  NVDAAFLCAAQLALANEDDHNIQLQRIPESVSGIEQQRGGCAC  206



>ref|XP_008808948.1| PREDICTED: ras-related protein Rab7-like [Phoenix dactylifera]
Length=230

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVDAAF  +AK ALAN  EQDI+ Q I + + E E   GCAC
Sbjct  189  NVDAAFFHVAKLALANNDEQDIYFQRIAEFVSEPEQGSGCAC  230



>ref|XP_008663959.1| PREDICTED: ras-related protein Rab7-like [Zea mays]
Length=118

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLCIA  AL + H+QDI+ + + + +P+ E    C C
Sbjct  77   NVDTAFLCIASLALEHEHDQDIYFKTVAEQVPDTEQTSRCVC  118



>gb|AFK36786.1| unknown [Medicago truncatula]
Length=209

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETRGGCAC  385
            NVD AFLC+AK A  N H+ DI+ +GI +   E E R  CAC
Sbjct  168  NVDDAFLCVAKVASENDHDLDIYFRGIFETPSEAEQRSNCAC  209



>ref|XP_003568013.1| PREDICTED: ras-related protein Rab7-like [Brachypodium distachyon]
Length=207

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -3

Query  510  NVDAAFLCIAKTALANTHEQDIFLQGIPDAIPEFETR-GGCAC  385
            NVD AFLCIAK AL + H+QDI+ + + ++ P+ E +  GCAC
Sbjct  165  NVDDAFLCIAKLALEHEHDQDIYFKTVAESAPKTEEQPAGCAC  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115