BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF050B17

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796944.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    124   2e-30   Nicotiana sylvestris
ref|XP_009609766.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    122   1e-29   Nicotiana tomentosiformis
emb|CDP18155.1|  unnamed protein product                                122   1e-29   Coffea canephora [robusta coffee]
ref|XP_006353707.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    120   5e-29   
ref|XP_004241817.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    118   2e-28   Solanum lycopersicum
ref|XP_010256308.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       119   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_004250366.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       116   1e-27   
ref|XP_009348840.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    115   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_009339078.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    115   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_009624650.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    115   3e-27   Nicotiana tomentosiformis
ref|XP_009765732.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    115   4e-27   Nicotiana sylvestris
ref|XP_009624649.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   5e-27   Nicotiana tomentosiformis
gb|EYU23943.1|  hypothetical protein MIMGU_mgv1a010376mg                114   6e-27   Erythranthe guttata [common monkey flower]
ref|XP_010063788.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       114   8e-27   Eucalyptus grandis [rose gum]
ref|XP_009765731.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   9e-27   Nicotiana sylvestris
ref|XP_009624648.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   9e-27   Nicotiana tomentosiformis
ref|XP_009765726.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   Nicotiana sylvestris
ref|XP_009624646.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   Nicotiana tomentosiformis
ref|XP_002267287.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   Vitis vinifera
ref|XP_010665011.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   Vitis vinifera
ref|XP_006351174.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   
ref|XP_006351173.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   Solanum tuberosum [potatoes]
ref|XP_010665012.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   Vitis vinifera
ref|XP_010665010.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   1e-26   Vitis vinifera
ref|XP_011074916.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    113   2e-26   Sesamum indicum [beniseed]
ref|XP_011074915.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    113   2e-26   Sesamum indicum [beniseed]
ref|XP_011097272.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    113   2e-26   Sesamum indicum [beniseed]
ref|XP_011097280.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    113   2e-26   Sesamum indicum [beniseed]
ref|XP_006376320.1|  TYROSINE PHOSPHATASE 1 family protein              113   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_007020249.1|  Tyrosine phosphatase 1 isoform 1                   112   4e-26   
gb|KJB35868.1|  hypothetical protein B456_006G131400                    111   6e-26   Gossypium raimondii
ref|XP_002534020.1|  protein-tyrosine phosphatase 1, plants, puta...    111   7e-26   Ricinus communis
gb|KJB35867.1|  hypothetical protein B456_006G131400                    110   7e-26   Gossypium raimondii
gb|KGN44428.1|  hypothetical protein Csa_7G290510                       107   7e-26   Cucumis sativus [cucumbers]
ref|XP_011038164.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       111   1e-25   Populus euphratica
gb|KJB35871.1|  hypothetical protein B456_006G131400                    111   1e-25   Gossypium raimondii
gb|KJB35872.1|  hypothetical protein B456_006G131400                    111   1e-25   Gossypium raimondii
gb|KHG30608.1|  Tyrosine-protein phosphatase non-receptor type 20       110   1e-25   Gossypium arboreum [tree cotton]
ref|XP_004290440.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    110   3e-25   Fragaria vesca subsp. vesca
ref|XP_011458440.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    110   3e-25   Fragaria vesca subsp. vesca
ref|XP_008237328.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    109   5e-25   Prunus mume [ume]
gb|AAG52227.1|AC021665_10  protein tyrosine phosphatase, 5'-parti...    105   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237326.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    109   7e-25   
ref|XP_010094850.1|  Tyrosine-protein phosphatase non-receptor ty...    109   7e-25   
ref|XP_008454599.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    108   8e-25   Cucumis melo [Oriental melon]
ref|XP_008461477.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    109   9e-25   Cucumis melo [Oriental melon]
ref|XP_006434638.1|  hypothetical protein CICLE_v10001727mg             108   2e-24   Citrus clementina [clementine]
ref|XP_007201518.1|  hypothetical protein PRUPE_ppa015486mg             107   2e-24   
gb|KDO83952.1|  hypothetical protein CISIN_1g019277mg                   107   2e-24   Citrus sinensis [apfelsine]
ref|XP_004165623.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    107   2e-24   
ref|XP_004139702.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    107   2e-24   Cucumis sativus [cucumbers]
ref|XP_006473220.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    107   2e-24   Citrus sinensis [apfelsine]
gb|KDP30279.1|  hypothetical protein JCGZ_17149                         107   3e-24   Jatropha curcas
emb|CAA06615.1|  protein tyrosine phosphatase                           107   3e-24   Pisum sativum [garden pea]
ref|XP_004496384.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    107   3e-24   
ref|XP_006390734.1|  hypothetical protein EUTSA_v10018624mg             107   3e-24   
gb|AAC68859.1|  protein tyrosine phosphatase 1                          107   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177331.1|  tyrosine phosphatase 1                                106   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415897.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    106   7e-24   Camelina sativa [gold-of-pleasure]
gb|AAT35563.1|  protein tyrosine phosphatase                            106   7e-24   Phaseolus vulgaris [French bean]
emb|CAJ77612.1|  protein tyrosine phosphatase                           105   8e-24   Fagus sylvatica
ref|XP_008365849.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    106   8e-24   
ref|XP_009375252.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    106   9e-24   Pyrus x bretschneideri [bai li]
ref|XP_002887394.1|  hypothetical protein ARALYDRAFT_339406             105   1e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_010521123.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       105   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010471199.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    105   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008381997.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    105   1e-23   
gb|EYU22866.1|  hypothetical protein MIMGU_mgv1a009565mg                105   1e-23   Erythranthe guttata [common monkey flower]
emb|CDX72837.1|  BnaC06g32850D                                          105   1e-23   
ref|XP_009404327.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    105   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007143629.1|  hypothetical protein PHAVU_007G087900g             105   2e-23   Phaseolus vulgaris [French bean]
ref|XP_007227330.1|  hypothetical protein PRUPE_ppa016082mg             105   2e-23   
ref|XP_010428033.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       104   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006301380.1|  hypothetical protein CARUB_v10021792mg             105   3e-23   
ref|XP_010930782.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       104   3e-23   Elaeis guineensis
ref|XP_009105847.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       103   5e-23   Brassica rapa
emb|CDX96354.1|  BnaA07g29650D                                          103   5e-23   
ref|XP_009390761.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    103   8e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237920.1|  tyrosine phosphatase 1                             103   9e-23   Glycine max [soybeans]
gb|KEH43589.1|  tyrosine phosphatase                                    102   1e-22   Medicago truncatula
ref|XP_006588511.1|  PREDICTED: tyrosine phosphatase 1 isoform X1       102   1e-22   Glycine max [soybeans]
ref|XP_008781548.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    102   1e-22   Phoenix dactylifera
gb|EPS63074.1|  hypothetical protein M569_11713                       98.6    1e-22   Genlisea aurea
ref|XP_008781549.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    102   2e-22   Phoenix dactylifera
gb|KHN00785.1|  Tyrosine-protein phosphatase non-receptor type 20       101   3e-22   Glycine soja [wild soybean]
ref|XP_006606202.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    101   3e-22   Glycine max [soybeans]
ref|XP_003556188.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    101   3e-22   Glycine max [soybeans]
ref|XP_010674720.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  98.6    3e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008358192.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  98.6    4e-21   
ref|XP_010674811.1|  PREDICTED: protein-tyrosine-phosphatase PTP1     98.2    4e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004299356.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  97.8    7e-21   Fragaria vesca subsp. vesca
gb|ACY78390.1|  protein tyrosine phosphatase 1                        97.8    7e-21   Phalaenopsis amabilis
ref|NP_001065893.2|  Os11g0180200                                     90.5    5e-20   
ref|XP_008343293.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  91.7    2e-19   Malus domestica [apple tree]
ref|XP_006662780.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  91.3    6e-19   Oryza brachyantha
gb|AAX96301.1|  Protein-tyrosine phosphatase                          90.1    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662779.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  90.9    1e-18   Oryza brachyantha
ref|XP_006829464.1|  hypothetical protein AMTR_s00247p00015290        89.0    8e-18   
ref|NP_001149088.1|  receptor-type tyrosine-protein phosphatase S     87.8    2e-17   Zea mays [maize]
dbj|BAK00963.1|  predicted protein                                    87.0    4e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF86150.1|  unknown                                               86.7    6e-17   Zea mays [maize]
ref|XP_010238660.1|  PREDICTED: protein-tyrosine-phosphatase PTP1     85.9    7e-17   Brachypodium distachyon [annual false brome]
ref|NP_001169094.1|  uncharacterized protein LOC100382937             84.3    9e-17   
ref|XP_002442903.1|  hypothetical protein SORBIDRAFT_08g004710        85.9    9e-17   Sorghum bicolor [broomcorn]
gb|ABK26026.1|  unknown                                               85.5    1e-16   Picea sitchensis
dbj|BAJ94079.1|  predicted protein                                    85.9    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98480.1|  predicted protein                                    85.9    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT13080.1|  Tyrosine-protein phosphatase non-receptor type 20     84.7    2e-16   
ref|XP_010237888.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  86.3    2e-16   
ref|XP_010239266.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  86.3    4e-16   
gb|KJB35865.1|  hypothetical protein B456_006G131400                  82.4    2e-15   Gossypium raimondii
ref|XP_007020250.1|  Tyrosine phosphatase 1 isoform 2                 82.0    2e-15   
ref|XP_004978858.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  80.1    6e-15   
ref|XP_004978856.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  80.1    7e-15   
ref|XP_001774836.1|  predicted protein                                79.3    1e-14   
ref|XP_002450425.1|  hypothetical protein SORBIDRAFT_05g005210        80.9    2e-14   
ref|XP_006664386.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  77.8    4e-14   
gb|KDO83953.1|  hypothetical protein CISIN_1g019277mg                 78.2    5e-14   Citrus sinensis [apfelsine]
ref|XP_008237327.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  78.2    6e-14   Prunus mume [ume]
ref|XP_001751306.1|  predicted protein                                79.0    7e-14   
ref|XP_009390760.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  77.8    7e-14   
ref|NP_001066289.1|  Os12g0174800                                     77.4    9e-14   
gb|EAY82439.1|  hypothetical protein OsI_37652                        77.4    9e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004977238.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  75.5    2e-13   Setaria italica
gb|KHN00786.1|  hypothetical protein glysoja_000454                   73.6    4e-13   Glycine soja [wild soybean]
gb|EMT05398.1|  Tyrosine-protein phosphatase Lar-like protein         73.9    8e-13   
gb|KDO83951.1|  hypothetical protein CISIN_1g019277mg                 73.9    2e-12   Citrus sinensis [apfelsine]
gb|KEH43588.1|  tyrosine phosphatase                                  72.8    4e-12   Medicago truncatula
gb|AEW08685.1|  hypothetical protein CL1189Contig1_03                 68.2    4e-12   Pinus radiata
gb|EEC67788.1|  hypothetical protein OsI_35345                        70.9    2e-11   Oryza sativa Indica Group [Indian rice]
gb|EEE51752.1|  hypothetical protein OsJ_33184                        70.5    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91789.2|  Protein-tyrosine phosphatase containing protein, ...  70.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AFG56005.1|  hypothetical protein CL1189Contig1_03                 65.5    5e-11   Pinus taeda
gb|EMS67302.1|  Tyrosine-protein phosphatase Lar-like protein         66.6    6e-10   Triticum urartu
ref|XP_002965416.1|  hypothetical protein SELMODRAFT_83906            59.7    2e-08   
ref|XP_005644093.1|  hypothetical protein COCSUDRAFT_67695            62.0    3e-08   Coccomyxa subellipsoidea C-169
ref|XP_002978222.1|  hypothetical protein SELMODRAFT_56201            61.2    4e-08   
ref|XP_002966338.1|  hypothetical protein SELMODRAFT_66231            61.2    4e-08   
ref|XP_002976024.1|  hypothetical protein SELMODRAFT_104243           58.2    1e-07   
ref|XP_004356068.1|  protein-tyrosine phosphatase 1                   58.2    7e-07   Cavenderia fasciculata
ref|XP_004358810.1|  protein tyrosine phosphatase                     56.2    2e-06   Cavenderia fasciculata
dbj|GAM25942.1|  hypothetical protein SAMD00019534_091170             56.2    2e-06   Acytostelium subglobosum LB1
gb|EFA76454.1|  protein-tyrosine phosphatase 1                        55.1    8e-06   Heterostelium album PN500
ref|XP_001696901.1|  protein tyrosine phosphatase 3                   53.9    1e-05   Chlamydomonas reinhardtii
ref|XP_002968574.1|  hypothetical protein SELMODRAFT_409515           53.5    1e-05   
ref|XP_002975907.1|  hypothetical protein SELMODRAFT_416055           53.9    1e-05   
ref|XP_002970174.1|  hypothetical protein SELMODRAFT_410976           53.5    2e-05   
ref|XP_002978341.1|  hypothetical protein SELMODRAFT_418145           53.5    2e-05   
gb|EIE81798.1|  hypothetical protein RO3G_06503                       53.5    3e-05   Rhizopus delemar RA 99-880
ref|XP_002603921.1|  hypothetical protein BRAFLDRAFT_248550           53.1    3e-05   Branchiostoma floridae
ref|XP_002603893.1|  hypothetical protein BRAFLDRAFT_102251           53.1    3e-05   Branchiostoma floridae
ref|XP_002603919.1|  hypothetical protein BRAFLDRAFT_248501           53.1    3e-05   Branchiostoma floridae
dbj|GAM18917.1|  hypothetical protein SAMD00019534_020920             52.8    5e-05   Acytostelium subglobosum LB1
ref|XP_005290630.1|  PREDICTED: tyrosine-protein phosphatase non-...  52.8    5e-05   Chrysemys picta bellii
dbj|BAC06422.1|  protein tyrosine phosphatase a                       48.9    5e-05   Oryzias latipes [Japanese rice fish]
ref|XP_002953490.1|  hypothetical protein VOLCADRAFT_82191            52.0    6e-05   Volvox carteri f. nagariensis
dbj|GAM20689.1|  hypothetical protein SAMD00019534_038640             52.0    6e-05   Acytostelium subglobosum LB1
gb|ACN32402.1|  protein tyrosine phosphatase receptor type A prec...  52.0    7e-05   Lethenteron camtschaticum [Japanese lamprey]
dbj|BAA95170.1|  amPTPR4b                                             52.0    7e-05   Branchiostoma belcheri
ref|XP_005140377.1|  PREDICTED: receptor-type tyrosine-protein ph...  48.9    8e-05   Melopsittacus undulatus
ref|XP_002601342.1|  hypothetical protein BRAFLDRAFT_59175            52.0    8e-05   Branchiostoma floridae
emb|CAA38662.1|  protein-tyrosine phosphatase                         51.6    1e-04   Homo sapiens [man]
ref|XP_009054725.1|  hypothetical protein LOTGIDRAFT_118033           51.2    1e-04   Lottia gigantea
emb|CEP18626.1|  hypothetical protein                                 51.6    1e-04   Parasitella parasitica
dbj|GAN11229.1|  protein-tyrosine-phosphatase                         51.2    1e-04   Mucor ambiguus
emb|CEI98699.1|  hypothetical protein RMCBS344292_12802               51.2    1e-04   Rhizopus microsporus
emb|CEG70495.1|  Putative Cell wall integrity protein scw1            51.2    1e-04   Rhizopus microsporus
ref|XP_001200450.2|  PREDICTED: uncharacterized protein LOC764213     51.2    2e-04   
ref|XP_010776349.1|  PREDICTED: tyrosine-protein phosphatase non-...  48.9    2e-04   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009505548.1|  PREDICTED: receptor-type tyrosine-protein ph...  49.3    2e-04   Phalacrocorax carbo [common cormorant]
ref|XP_005495051.1|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   
ref|XP_005427810.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  51.2    2e-04   Geospiza fortis
ref|XP_008932872.1|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   
ref|XP_005517998.1|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFO63865.1|  Receptor-type tyrosine-protein phosphatase alpha      51.2    2e-04   Corvus brachyrhynchos
gb|KFW76905.1|  Receptor-type tyrosine-protein phosphatase alpha      51.2    2e-04   Manacus vitellinus
emb|CDQ61969.1|  unnamed protein product                              51.2    2e-04   Oncorhynchus mykiss
ref|XP_009096382.1|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   Serinus canaria [canary]
ref|XP_008638088.1|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   Corvus brachyrhynchos
ref|XP_005045695.1|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   Ficedula albicollis
ref|XP_002189841.2|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   
ref|XP_010400530.1|  PREDICTED: receptor-type tyrosine-protein ph...  51.2    2e-04   
gb|AEO12553.1|  Lefftyrin                                             51.2    2e-04   Oscarella pearsei
ref|XP_010126949.1|  PREDICTED: receptor-type tyrosine-protein ph...  49.3    2e-04   Chlamydotis macqueenii
ref|XP_010879106.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|ELK34511.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Myotis davidii
gb|ADN07443.1|  protein tyrosine phosphatase, receptor type, A, 3...  50.8    2e-04   Microtus ochrogaster [prairie voles]
ref|XP_010809654.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Bos taurus [bovine]
ref|XP_005010179.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005808519.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|EMP28863.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Chelonia mydas [green seaturtle]
ref|XP_010879107.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_007654413.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006499053.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Mus musculus [mouse]
emb|CAF89865.1|  unnamed protein product                              50.8    2e-04   Tetraodon nigroviridis
dbj|BAD92939.1|  protein tyrosine phosphatase, receptor type, A i...  50.8    2e-04   Homo sapiens [man]
gb|KFP28921.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Colius striatus
ref|XP_010218041.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Tinamus guttatus
ref|XP_006732356.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Leptonychotes weddellii
ref|XP_007554383.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008046179.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|NP_001193429.1|  receptor-type tyrosine-protein phosphatase a...  50.8    2e-04   Bos taurus [bovine]
ref|XP_006874898.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Chrysochloris asiatica
ref|XP_005974816.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005365668.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Microtus ochrogaster [prairie voles]
ref|XP_005894004.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Bos mutus
ref|XP_004014426.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|ADN07436.1|  protein tyrosine phosphatase, receptor type, A        50.8    2e-04   Microtus ochrogaster [prairie voles]
ref|XP_008701513.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Ursus maritimus [white bear]
ref|XP_008525823.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Equus przewalskii [Przewalski horse]
ref|XP_008017381.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Chlorocebus sabaeus
ref|XP_007465457.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Lipotes vexillifer [baiji]
ref|XP_007195893.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Balaenoptera acutorostrata scammoni
ref|XP_007127201.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006984594.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Peromyscus maniculatus bairdii
ref|XP_006894254.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CAA37447.1|  tyrosine phosphatase precursor                       50.8    2e-04   Homo sapiens [man]
prf||1701300A  protein Tyr phosphatase                                50.8    2e-04
ref|XP_005068686.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004697933.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004661529.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Jaculus jaculus
ref|XP_004585722.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004433874.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004398218.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Odobenus rosmarus divergens
ref|XP_004383073.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004285367.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004061767.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|NP_543030.1|  receptor-type tyrosine-protein phosphatase alph...  50.8    2e-04   Homo sapiens [man]
ref|XP_008973009.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Pan paniscus [bonobo]
ref|XP_002918821.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Ailuropoda melanoleuca
ref|XP_002830151.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Pongo abelii [orang utan]
ref|XP_001158634.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Pan troglodytes
ref|XP_001114682.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004611014.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Sorex araneus [Eurasian shrew]
ref|XP_004398217.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Odobenus rosmarus divergens
ref|XP_008407732.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Poecilia reticulata
ref|XP_006096456.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Myotis lucifugus
ref|XP_006984593.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|KFW07653.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Eurypyga helias
gb|KFR04498.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Nipponia nippon
gb|KFP16551.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Egretta garzetta
gb|KFO80571.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Cuculus canorus
ref|XP_008852703.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Nannospalax galili
ref|XP_008046178.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Carlito syrichta
ref|NP_001231414.1|  receptor-type tyrosine-protein phosphatase a...  50.8    2e-04   Sus scrofa [pigs]
gb|KFP81881.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   Acanthisitta chloris
ref|NP_001193428.1|  receptor-type tyrosine-protein phosphatase a...  50.8    2e-04   Bos taurus [bovine]
ref|XP_006042789.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Bubalus bubalis [domestic water buffalo]
ref|XP_006164011.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005974815.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005894003.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Bos mutus
ref|XP_005688270.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005365667.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010019853.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Nestor notabilis
ref|XP_009231698.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008973007.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Pan paniscus [bonobo]
ref|XP_008701512.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Ursus maritimus [white bear]
ref|XP_008525821.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Equus przewalskii [Przewalski horse]
ref|XP_007958195.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Orycteropus afer afer
ref|XP_008017375.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Chlorocebus sabaeus
ref|XP_007636113.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_007635324.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_007465458.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Lipotes vexillifer [baiji]
ref|XP_007195892.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Balaenoptera acutorostrata scammoni
ref|XP_007127200.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006984592.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Peromyscus maniculatus bairdii
ref|XP_006894255.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006499052.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006187179.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_003433272.2|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Canis lupus familiaris [dogs]
ref|XP_005068685.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004697932.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004661528.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Jaculus jaculus
ref|XP_004433873.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004398216.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Odobenus rosmarus divergens
ref|XP_004383072.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   Trichechus manatus latirostris
ref|XP_004285366.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|NP_002827.1|  receptor-type tyrosine-protein phosphatase alph...  50.8    2e-04   Homo sapiens [man]
sp|P18433.2|PTPRA_HUMAN  RecName: Full=Receptor-type tyrosine-pro...  50.8    2e-04   
ref|XP_006929978.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005568551.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_003774550.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_003277995.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_002918820.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009434992.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009434991.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_003983768.2|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006164010.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005688269.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010809652.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004398215.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009906128.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|KFU87416.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
ref|XP_006235068.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010579065.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010152505.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010019854.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010019852.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009927643.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009811958.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009565156.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004469197.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|KFW72620.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
gb|KFV54694.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
gb|KFP97292.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
gb|KFM02647.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
gb|AAB04150.1|  protein tyrosine phosphatase                          50.8    2e-04   
ref|XP_005506484.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010708882.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010350094.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|KFR13955.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
ref|XP_006235067.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|NP_990485.1|  receptor-type tyrosine-protein phosphatase alph...  50.8    2e-04   
ref|XP_005672834.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|KFV74124.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
ref|XP_003774551.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009906127.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006874897.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005435376.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005230705.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010377293.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009074774.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008993899.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
dbj|BAH11790.1|  unnamed protein product                              50.8    2e-04   
ref|XP_007497010.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006042786.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_003983769.2|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005688268.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005320592.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005214531.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004398214.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_001158174.2|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_002830149.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_002798264.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009993008.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004469196.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004323700.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010377292.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008254463.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004585721.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005731290.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010377291.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010579063.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009936919.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009637842.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009469948.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004545319.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005506483.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_007497009.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005450375.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_003973603.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  50.8    2e-04   
ref|XP_006278011.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006020951.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
emb|CBN81106.1|  Protein tyrosine phosphatase a                       50.8    2e-04   
ref|XP_005731289.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005291552.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010377290.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006784648.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006096451.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005918755.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004545318.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006278010.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006020950.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|AAA39448.1|  leukocyte common antigen-related phosphatase          50.8    2e-04   
ref|NP_033006.2|  receptor-type tyrosine-protein phosphatase alph...  50.8    2e-04   
gb|ABG76787.1|  protein tyrosine phosphatase alpha                    50.8    2e-04   
ref|XP_007497008.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_004469195.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|NP_001098554.1|  receptor-type tyrosine-protein phosphatase a...  50.8    2e-04   
dbj|BAD02402.1|  protein tyrosine phosphatase a                       50.8    2e-04   
ref|NP_571963.1|  receptor-type tyrosine-protein phosphatase alph...  50.8    2e-04   
gb|AAI63526.1|  Ptpra protein                                         50.8    2e-04   
ref|XP_006812663.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    2e-04   
ref|XP_010579062.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009330134.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009288962.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|EDL28273.1|  protein tyrosine phosphatase, receptor type, A, i...  50.8    2e-04   
ref|XP_010741625.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006139274.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008319238.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008319237.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008278759.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008017373.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008017369.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008017364.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008017358.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008017354.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008568865.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008017344.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_007067206.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  50.8    2e-04   
ref|XP_005291551.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|EDL28274.1|  protein tyrosine phosphatase, receptor type, A, i...  50.8    2e-04   
ref|XP_008017332.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009680161.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  50.8    2e-04   
ref|NP_001157160.1|  receptor-type tyrosine-protein phosphatase a...  50.8    2e-04   
ref|XP_004772958.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009231697.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006042788.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|EHH19868.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
ref|XP_008568867.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008017328.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|ERE69806.1|  receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
gb|ERE69807.1|  receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
ref|XP_006139276.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_007256600.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005874777.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010377294.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
emb|CDS11091.1|  hypothetical protein LRAMOSA03355                    50.8    2e-04   
ref|XP_006096454.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_009708083.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    2e-04   
gb|ELK04018.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
gb|EGV92436.1|  Receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
ref|XP_007636115.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008568866.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006096455.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_010971078.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008852705.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_005568548.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_008315189.1|  PREDICTED: tyrosine-protein phosphatase non-...  50.8    2e-04   
gb|ERE69808.1|  receptor-type tyrosine-protein phosphatase alpha      50.8    2e-04   
ref|NP_036895.2|  receptor-type tyrosine-protein phosphatase alph...  50.8    2e-04   
ref|XP_009927651.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    2e-04   
ref|XP_005380827.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
gb|EOB08200.1|  Receptor-type tyrosine-protein phosphatase alpha      50.4    2e-04   
ref|XP_004772959.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_003788107.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    2e-04   
ref|XP_006758092.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    3e-04   
ref|XP_005568549.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.8    3e-04   
ref|XP_004687408.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_534366.2|  PREDICTED: receptor-type tyrosine-protein phosp...  50.4    3e-04   
ref|XP_003499086.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_005874776.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_006187178.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
gb|EPQ13003.1|  Receptor-type tyrosine-protein phosphatase alpha      50.4    3e-04   
ref|XP_006758093.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_008139243.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_004611015.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_007958196.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_006164012.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_006758094.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_006235070.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_004886779.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_004687409.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_005380829.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
tpg|DAA22995.1|  TPA: protein tyrosine phosphatase, receptor type...  50.4    3e-04   
ref|XP_008139242.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_005874774.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
gb|ERE69809.1|  receptor-type tyrosine-protein phosphatase alpha      50.4    3e-04   
ref|XP_006758089.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
gb|EPB91198.1|  hypothetical protein HMPREF1544_01903                 50.4    3e-04   
gb|EHB04286.1|  Receptor-type tyrosine-protein phosphatase alpha      50.4    3e-04   
ref|XP_004634305.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_004886780.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_004634306.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_005380828.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_009571270.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
emb|CEP11418.1|  hypothetical protein                                 50.4    3e-04   
ref|XP_009977925.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_009478012.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  50.4    3e-04   
gb|KFW00532.1|  Receptor-type tyrosine-protein phosphatase alpha      50.4    3e-04   
gb|KFQ59739.1|  Receptor-type tyrosine-protein phosphatase alpha      50.4    3e-04   
ref|XP_001637144.1|  predicted protein                                50.4    3e-04   
ref|XP_003788106.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_010589869.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_008852707.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_007127202.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_008315188.1|  PREDICTED: tyrosine-protein phosphatase non-...  50.4    3e-04   
ref|XP_010589870.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_789889.3|  PREDICTED: receptor-type tyrosine-protein phosp...  50.4    3e-04   
gb|KGL91234.1|  Receptor-type tyrosine-protein phosphatase alpha      50.4    3e-04   
ref|XP_010609317.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_010609315.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_006006071.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
emb|CDH58584.1|  protein tyrosine phosphatase                         50.4    3e-04   
ref|XP_002602522.1|  hypothetical protein BRAFLDRAFT_93828            50.4    3e-04   
ref|XP_004014427.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_002155297.2|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_003411663.2|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_011367829.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_006921716.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_009880799.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|NP_001089394.1|  protein tyrosine phosphatase, receptor type,...  50.4    3e-04   
ref|NP_001121422.1|  receptor-type tyrosine-protein phosphatase a...  50.4    3e-04   
ref|NP_001081056.1|  protein tyrosine phosphatase, receptor type,...  50.4    3e-04   
gb|AAH94405.1|  Ptpa-A-prov protein                                   50.4    3e-04   
ref|XP_010609319.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_010609318.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
dbj|BAH12641.1|  unnamed protein product                              50.4    3e-04   
ref|XP_008525825.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_003411662.2|  PREDICTED: receptor-type tyrosine-protein ph...  50.4    3e-04   
ref|XP_010792615.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.1    3e-04   
ref|XP_005437546.1|  PREDICTED: tyrosine-protein phosphatase non-...  50.1    3e-04   
ref|XP_007546861.1|  PREDICTED: tyrosine-protein phosphatase non-...  50.1    3e-04   
ref|XP_005815560.1|  PREDICTED: tyrosine-protein phosphatase non-...  50.1    3e-04   
ref|XP_005239499.1|  PREDICTED: tyrosine-protein phosphatase non-...  50.1    3e-04   
ref|XP_008409458.1|  PREDICTED: tyrosine-protein phosphatase non-...  50.1    3e-04   
ref|XP_008525824.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.1    3e-04   
ref|XP_010173414.1|  PREDICTED: receptor-type tyrosine-protein ph...  49.3    4e-04   
ref|XP_007432820.1|  PREDICTED: receptor-type tyrosine-protein ph...  50.1    4e-04   
ref|XP_007896212.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  50.1    4e-04   



>ref|XP_009796944.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Nicotiana 
sylvestris]
Length=337

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRI++GDMSALDLVNTIT+FRSQRIGMVQT+EQYLFCYDAII+ELED+I
Sbjct  269  TGTYCAIHNTIQRIMVGDMSALDLVNTITVFRSQRIGMVQTMEQYLFCYDAIIDELEDLI  328

Query  385  KESTGQPSS  359
             ++  + SS
Sbjct  329  SDTNAEESS  337



>ref|XP_009609766.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Nicotiana 
tomentosiformis]
Length=337

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQ+I++GDMSALDL+NTIT+FRSQRIGMVQT+EQYLFCYDAII+ELED+I
Sbjct  269  TGTYCAIHNTIQKIMVGDMSALDLINTITVFRSQRIGMVQTMEQYLFCYDAIIDELEDLI  328

Query  385  KESTGQPSS  359
             ++  + SS
Sbjct  329  SDTNAEESS  337



>emb|CDP18155.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC I NTIQRIL+GDMSALDLV TIT+FRSQRIGMVQTLEQYLFCYDAI++ELED+I
Sbjct  276  TGTYCTIQNTIQRILVGDMSALDLVKTITLFRSQRIGMVQTLEQYLFCYDAIVDELEDLI  335

Query  385  KESTGQPSS  359
             +S+GQ SS
Sbjct  336  SDSSGQRSS  344



>ref|XP_006353707.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum tuberosum]
Length=355

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GD SALDLVNTITIFRSQRIGMVQT+EQYLFCYDAII+ELED+I
Sbjct  292  TGTYCAIHNTIQRILVGDKSALDLVNTITIFRSQRIGMVQTMEQYLFCYDAIIDELEDLI  351

Query  385  KES  377
             +S
Sbjct  352  SDS  354



>ref|XP_004241817.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum lycopersicum]
 ref|XP_010322753.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum lycopersicum]
Length=328

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL GD SALDLVNTITIFRSQRIGMVQT+EQYLFCYDA+I+ELED+I
Sbjct  265  TGTYCAIHNTIQRILGGDKSALDLVNTITIFRSQRIGMVQTMEQYLFCYDAVIDELEDLI  324

Query  385  KES  377
             +S
Sbjct  325  SDS  327



>ref|XP_010256308.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Nelumbo nucifera]
Length=344

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHN IQRIL+GDMSALDLVNTITIFRSQR+GMVQTLEQ+LFCYDAI++ELE+++
Sbjct  279  TGTYCTIHNAIQRILIGDMSALDLVNTITIFRSQRVGMVQTLEQFLFCYDAILDELEELV  338

Query  385  KESTGQ  368
             ES  Q
Sbjct  339  SESNHQ  344



>ref|XP_004250366.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Solanum lycopersicum]
Length=349

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELED+I
Sbjct  281  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEDLI  340

Query  385  KESTGQ  368
             +  G+
Sbjct  341  SDDNGE  346



>ref|XP_009348840.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348841.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348842.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=339

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL GDMSALDLV+TIT FRSQRIGMVQTLEQY FCY AI++ELED+I
Sbjct  270  TGTYCTIHNTVQRILAGDMSALDLVDTITTFRSQRIGMVQTLEQYFFCYSAIVDELEDLI  329

Query  385  KESTGQPSS  359
             +  G+ SS
Sbjct  330  SDLNGETSS  338



>ref|XP_009339078.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009339079.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009339080.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=339

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL GDMSALDLV+TIT FRSQRIGMVQTLEQY FCY AI++ELED+I
Sbjct  270  TGTYCTIHNTVQRILAGDMSALDLVDTITTFRSQRIGMVQTLEQYFFCYSAIVDELEDLI  329

Query  385  KESTGQPSS  359
             +  G+ SS
Sbjct  330  SDLNGETSS  338



>ref|XP_009624650.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X4 
[Nicotiana tomentosiformis]
Length=305

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELE +I
Sbjct  237  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEHLI  296

Query  385  KESTGQ  368
             +  G+
Sbjct  297  SDDNGE  302



>ref|XP_009765732.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Nicotiana sylvestris]
Length=305

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELE +I
Sbjct  237  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEHLI  296

Query  385  KESTGQ  368
             +  G+
Sbjct  297  SDDNGE  302



>ref|XP_009624649.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Nicotiana tomentosiformis]
Length=313

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELE +I
Sbjct  245  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEHLI  304

Query  385  KESTGQ  368
             +  G+
Sbjct  305  SDDNGE  310



>gb|EYU23943.1| hypothetical protein MIMGU_mgv1a010376mg [Erythranthe guttata]
Length=314

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQR+L GDM+ALDLVNT++ FRSQRIGMVQTLEQY+FCYDAI++ELE++I
Sbjct  246  TGTYCVIHNTIQRVLTGDMTALDLVNTVSTFRSQRIGMVQTLEQYIFCYDAIVDELENLI  305

Query  385  KESTGQ  368
             +S  Q
Sbjct  306  SDSNNQ  311



>ref|XP_010063788.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063789.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063790.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063791.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 gb|KCW71044.1| hypothetical protein EUGRSUZ_F04145 [Eucalyptus grandis]
Length=340

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL+GDMS+LDLVNTITIFRSQRIGMVQTLEQY+FCY AI++ELED+I
Sbjct  280  TGTYCTIHNTVQRILVGDMSSLDLVNTITIFRSQRIGMVQTLEQYVFCYQAIVDELEDLI  339



>ref|XP_009765731.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Nicotiana sylvestris]
Length=350

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELE +I
Sbjct  282  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEHLI  341

Query  385  KESTGQ  368
             +  G+
Sbjct  342  SDDNGE  347



>ref|XP_009624648.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Nicotiana tomentosiformis]
Length=350

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELE +I
Sbjct  282  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEHLI  341

Query  385  KESTGQ  368
             +  G+
Sbjct  342  SDDNGE  347



>ref|XP_009765726.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765727.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765728.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765729.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
Length=358

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELE +I
Sbjct  290  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEHLI  349

Query  385  KESTGQ  368
             +  G+
Sbjct  350  SDDNGE  355



>ref|XP_009624646.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009624647.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana tomentosiformis]
Length=358

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLFCYDAII+ELE +I
Sbjct  290  TGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLFCYDAIIDELEHLI  349

Query  385  KESTGQ  368
             +  G+
Sbjct  350  SDDNGE  355



>ref|XP_002267287.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X4 [Vitis 
vinifera]
Length=339

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQRIGMVQT+EQ+LFCY+AI++ELED+I
Sbjct  272  TGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQRIGMVQTMEQFLFCYNAIVDELEDLI  331



>ref|XP_010665011.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Vitis 
vinifera]
Length=347

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQRIGMVQT+EQ+LFCY+AI++ELED+I
Sbjct  280  TGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQRIGMVQTMEQFLFCYNAIVDELEDLI  339



>ref|XP_006351174.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Solanum tuberosum]
Length=344

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+V+T+ IFRSQRIGMVQT +QYLFCYDAII+ELED+I
Sbjct  276  TGTYCTIHNTIQRILGGDMSALDIVDTVAIFRSQRIGMVQTKDQYLFCYDAIIDELEDLI  335

Query  385  KESTGQPS  362
             +  G+ S
Sbjct  336  SDDNGEKS  343



>ref|XP_006351173.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Solanum tuberosum]
Length=349

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALD+V+T+ IFRSQRIGMVQT +QYLFCYDAII+ELED+I
Sbjct  281  TGTYCTIHNTIQRILGGDMSALDIVDTVAIFRSQRIGMVQTKDQYLFCYDAIIDELEDLI  340

Query  385  KESTGQPS  362
             +  G+ S
Sbjct  341  SDDNGEKS  348



>ref|XP_010665012.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X3 [Vitis 
vinifera]
 emb|CBI18544.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQRIGMVQT+EQ+LFCY+AI++ELED+I
Sbjct  272  TGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQRIGMVQTMEQFLFCYNAIVDELEDLI  331



>ref|XP_010665010.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Vitis 
vinifera]
Length=350

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQRIGMVQT+EQ+LFCY+AI++ELED+I
Sbjct  280  TGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQRIGMVQTMEQFLFCYNAIVDELEDLI  339



>ref|XP_011074916.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Sesamum indicum]
Length=345

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIH+TIQRIL+GDM+ALDLVNTIT FRSQRIGMVQTL+QYLFCYDAII+ELE +I
Sbjct  276  TGTYCAIHDTIQRILIGDMTALDLVNTITTFRSQRIGMVQTLDQYLFCYDAIIDELESLI  335

Query  385  KESTG  371
             +S  
Sbjct  336  LDSNS  340



>ref|XP_011074915.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Sesamum indicum]
Length=346

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIH+TIQRIL+GDM+ALDLVNTIT FRSQRIGMVQTL+QYLFCYDAII+ELE +I
Sbjct  277  TGTYCAIHDTIQRILIGDMTALDLVNTITTFRSQRIGMVQTLDQYLFCYDAIIDELESLI  336

Query  385  KESTG  371
             +S  
Sbjct  337  LDSNS  341



>ref|XP_011097272.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Sesamum indicum]
Length=341

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQR+L+GDM+ALDLV TIT FRSQRIGMVQT+EQYLFCYDAI++ELED+I
Sbjct  272  TGTYCLIHNTIQRVLIGDMTALDLVTTITTFRSQRIGMVQTMEQYLFCYDAIVDELEDLI  331

Query  385  KESTGQPSS  359
              S     S
Sbjct  332  SVSNSHGGS  340



>ref|XP_011097280.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Sesamum indicum]
Length=340

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQR+L+GDM+ALDLV TIT FRSQRIGMVQT+EQYLFCYDAI++ELED+I
Sbjct  271  TGTYCLIHNTIQRVLIGDMTALDLVTTITTFRSQRIGMVQTMEQYLFCYDAIVDELEDLI  330

Query  385  KESTGQPSS  359
              S     S
Sbjct  331  SVSNSHGGS  339



>ref|XP_006376320.1| TYROSINE PHOSPHATASE 1 family protein [Populus trichocarpa]
 gb|ERP54117.1| TYROSINE PHOSPHATASE 1 family protein [Populus trichocarpa]
Length=339

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL+GDMSALD+ NT+T FRSQRIGMVQT+EQY FCY+AII ELED+I
Sbjct  275  TGTYCTIHNTVQRILVGDMSALDIANTVTTFRSQRIGMVQTMEQYFFCYEAIIHELEDLI  334

Query  385  KE  380
             E
Sbjct  335  SE  336



>ref|XP_007020249.1| Tyrosine phosphatase 1 isoform 1 [Theobroma cacao]
 gb|EOY17474.1| Tyrosine phosphatase 1 isoform 1 [Theobroma cacao]
Length=343

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDL NT++ FRSQRIGMVQT++QY+FCY AI++EL+D++
Sbjct  273  TGTYCAIHNTIQRILVGDMSALDLANTVSTFRSQRIGMVQTMDQYIFCYKAIVDELKDLV  332

Query  385  KESTGQPSS  359
             E + + SS
Sbjct  333  SEFSSEYSS  341



>gb|KJB35868.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=300

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY FCY AI++EL+++I
Sbjct  230  TGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQYFFCYKAIVDELKELI  289

Query  385  KESTGQPSS  359
             + + + SS
Sbjct  290  SDFSSEHSS  298



>ref|XP_002534020.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis]
 gb|EEF28361.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis]
Length=332

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDL NT+ IFRSQR+GMVQT++QY FCY AII+ELED+I
Sbjct  266  TGTYCAIHNTIQRILVGDMSALDLANTVAIFRSQRVGMVQTMDQYFFCYKAIIDELEDLI  325



>gb|KJB35867.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=249

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY FCY AI++EL+++I
Sbjct  179  TGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQYFFCYKAIVDELKELI  238

Query  385  KESTGQPSS  359
             + + + SS
Sbjct  239  SDFSSEHSS  247



>gb|KGN44428.1| hypothetical protein Csa_7G290510 [Cucumis sativus]
Length=150

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY FCY  I++ELED+I
Sbjct  87   TGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQYFFCYRTIVDELEDLI  146



>ref|XP_011038164.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Populus euphratica]
Length=337

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL+GDMSALD+ NT+  FRSQRIGMVQT+EQY+FCY+AII+ELED+I
Sbjct  275  TGTYCTIHNTVQRILVGDMSALDIANTVATFRSQRIGMVQTMEQYIFCYEAIIDELEDLI  334

Query  385  KE  380
             E
Sbjct  335  SE  336



>gb|KJB35871.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=350

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY FCY AI++EL+++I
Sbjct  275  TGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQYFFCYKAIVDELKELI  334

Query  385  KESTGQPSS  359
             + + + SS
Sbjct  335  SDFSSEHSS  343



>gb|KJB35872.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=345

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY FCY AI++EL+++I
Sbjct  275  TGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQYFFCYKAIVDELKELI  334

Query  385  KESTGQPSS  359
             + + + SS
Sbjct  335  SDFSSEHSS  343



>gb|KHG30608.1| Tyrosine-protein phosphatase non-receptor type 20 [Gossypium 
arboreum]
Length=345

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY FCY AI++EL+++I
Sbjct  275  TGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQYFFCYKAIVDELKELI  334

Query  385  KESTGQPSS  359
             + + + SS
Sbjct  335  SDFSSEHSS  343



>ref|XP_004290440.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALDL NTIT FR++RIGMVQTLEQY FCY AII+ELED++
Sbjct  261  TGTYCTIHNTIQRILSGDMSALDLANTITTFRTERIGMVQTLEQYFFCYSAIIDELEDLM  320

Query  385  KESTGQPS  362
                G+ S
Sbjct  321  ANLNGERS  328



>ref|XP_011458440.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSALDL NTIT FR++RIGMVQTLEQY FCY AII+ELED++
Sbjct  261  TGTYCTIHNTIQRILSGDMSALDLANTITTFRTERIGMVQTLEQYFFCYSAIIDELEDLM  320

Query  385  KESTGQPS  362
                G+ S
Sbjct  321  ANLNGERS  328



>ref|XP_008237328.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X3 [Prunus 
mume]
Length=336

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL GDMSALD+V+T+T FRSQRIGMVQTLEQY FCY AI++ELED++
Sbjct  270  TGTYCTIHNTVQRILAGDMSALDVVDTVTTFRSQRIGMVQTLEQYFFCYSAIVDELEDLV  329

Query  385  KE  380
             +
Sbjct  330  SD  331



>gb|AAG52227.1|AC021665_10 protein tyrosine phosphatase, 5'-partial; 235-1013 [Arabidopsis 
thaliana]
Length=169

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL GDMSALDL  T+ +FR QRIGMVQT++QY FCY+AI++ELED+ 
Sbjct  101  TGTYCAIHNTIQRILAGDMSALDLAKTVALFRKQRIGMVQTMDQYFFCYNAIVDELEDLT  160

Query  385  KESTGQPSS  359
              +    SS
Sbjct  161  AGTNAGTSS  169



>ref|XP_008237326.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Prunus 
mume]
Length=368

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL GDMSALD+V+T+T FRSQRIGMVQTLEQY FCY AI++ELED++
Sbjct  270  TGTYCTIHNTVQRILAGDMSALDVVDTVTTFRSQRIGMVQTLEQYFFCYSAIVDELEDLV  329

Query  385  KE  380
             +
Sbjct  330  SD  331



>ref|XP_010094850.1| Tyrosine-protein phosphatase non-receptor type 20 [Morus notabilis]
 gb|EXB57379.1| Tyrosine-protein phosphatase non-receptor type 20 [Morus notabilis]
Length=357

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GD SALDL  TIT+FRSQRIGMVQTLEQY FCY AI++ELED+I
Sbjct  265  TGTYCTIHNTIQRILAGDTSALDLAKTITMFRSQRIGMVQTLEQYHFCYLAIVDELEDLI  324

Query  385  KESTGQPSS  359
                G+ SS
Sbjct  325  SGPNGENSS  333



>ref|XP_008454599.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454600.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454601.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454603.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
Length=333

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY FCY  I++ELED+I
Sbjct  270  TGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQYFFCYRTIVDELEDLI  329

Query  385  KES  377
              S
Sbjct  330  AVS  332



>ref|XP_008461477.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
Length=388

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY FCY  I++ELED+I
Sbjct  325  TGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQYFFCYRTIVDELEDLI  384

Query  385  KES  377
              S
Sbjct  385  AVS  387



>ref|XP_006434638.1| hypothetical protein CICLE_v10001727mg [Citrus clementina]
 gb|ESR47878.1| hypothetical protein CICLE_v10001727mg [Citrus clementina]
Length=343

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNT+QRIL+GDMSALDL NTI +FRSQRIGMVQT+EQY+FC+ AI++ELED+I
Sbjct  273  TGAYCTIHNTVQRILVGDMSALDLANTIKVFRSQRIGMVQTMEQYIFCHQAIVDELEDLI  332



>ref|XP_007201518.1| hypothetical protein PRUPE_ppa015486mg, partial [Prunus persica]
 gb|EMJ02717.1| hypothetical protein PRUPE_ppa015486mg, partial [Prunus persica]
Length=335

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QRIL GDMSALDLV+T+T FRSQRIGMVQT EQY FCY AI++ELED++
Sbjct  270  TGTYCTIHNTVQRILAGDMSALDLVDTVTTFRSQRIGMVQTREQYFFCYSAIVDELEDLV  329



>gb|KDO83952.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=343

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNT+QRIL+GDMSALDL NT+ +FRSQRIGMVQT+EQY+FC+ AI++ELED+I
Sbjct  273  TGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTMEQYIFCHQAIVDELEDLI  332



>ref|XP_004165623.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Cucumis sativus]
Length=377

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY FCY  I++ELED+I
Sbjct  314  TGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQYFFCYRTIVDELEDLI  373



>ref|XP_004139702.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Cucumis sativus]
Length=377

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY FCY  I++ELED+I
Sbjct  314  TGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQYFFCYRTIVDELEDLI  373



>ref|XP_006473220.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Citrus sinensis]
Length=343

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNT+QRIL+GDMSALDL NT+ +FRSQRIGMVQT+EQY+FC+ AI++ELED+I
Sbjct  273  TGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTMEQYIFCHQAIVDELEDLI  332



>gb|KDP30279.1| hypothetical protein JCGZ_17149 [Jatropha curcas]
Length=339

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL+GDMSALD+ NT+  FRSQR+GMVQT++QY FCY AII+ELED+I
Sbjct  275  TGTYCTIHNTIQRILVGDMSALDIANTVATFRSQRVGMVQTMDQYFFCYKAIIDELEDLI  334



>emb|CAA06615.1| protein tyrosine phosphatase [Pisum sativum]
Length=332

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSA+D+ NT+++FRSQRIGMVQT +QY+FCY+AII+ELED++
Sbjct  270  TGTYCTIHNTIQRILAGDMSAIDIANTVSVFRSQRIGMVQTQDQYIFCYEAIIDELEDLV  329

Query  385  KE  380
             +
Sbjct  330  SQ  331



>ref|XP_004496384.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cicer arietinum]
 ref|XP_004496385.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Cicer arietinum]
Length=331

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSA+D+ NTI++FRSQRIGMVQT +QY+FCY AII+ELED++
Sbjct  269  TGTYCTIHNTIQRILAGDMSAVDIANTISVFRSQRIGMVQTQDQYIFCYQAIIDELEDLV  328

Query  385  KE  380
             +
Sbjct  329  SQ  330



>ref|XP_006390734.1| hypothetical protein EUTSA_v10018624mg [Eutrema salsugineum]
 gb|ESQ28020.1| hypothetical protein EUTSA_v10018624mg [Eutrema salsugineum]
Length=414

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  389
            TGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT++QY FCY+AI++ELED+
Sbjct  346  TGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTMDQYFFCYNAIVDELEDL  404



>gb|AAC68859.1| protein tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=340

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL GDMSALDL  T+ +FR QRIGMVQT++QY FCY+AI++ELED+ 
Sbjct  272  TGTYCAIHNTIQRILAGDMSALDLAKTVALFRKQRIGMVQTMDQYFFCYNAIVDELEDLT  331

Query  385  KESTGQPSS  359
              +    SS
Sbjct  332  AGTNAGTSS  340



>ref|NP_177331.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 ref|NP_001031266.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 sp|O82656.1|PTP1_ARATH RecName: Full=Protein-tyrosine-phosphatase PTP1; AltName: Full=Protein 
tyrosine phosphatase 1; Short=AtPTP1 [Arabidopsis 
thaliana]
 gb|AAF43239.1|AC012654_23 Strong similarity to the tyrosine phosphatase from Arabidopsis 
thaliana gb|AJ006309. EST gb|AA042465 comes from this gene 
[Arabidopsis thaliana]
 emb|CAA06978.1| protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AAL49899.1| putative protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AAM51315.1| putative protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AEE35242.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 gb|AEE35243.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=340

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL GDMSALDL  T+ +FR QRIGMVQT++QY FCY+AI++ELED+ 
Sbjct  272  TGTYCAIHNTIQRILAGDMSALDLAKTVALFRKQRIGMVQTMDQYFFCYNAIVDELEDLT  331

Query  385  KESTGQPSS  359
              +    SS
Sbjct  332  AGTNAGTSS  340



>ref|XP_010415897.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Camelina sativa]
 ref|XP_010415898.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Camelina sativa]
Length=328

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  389
            TGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT++QYLFCY AI++ELED+
Sbjct  269  TGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTMDQYLFCYTAIVDELEDL  327



>gb|AAT35563.1| protein tyrosine phosphatase [Phaseolus vulgaris]
Length=333

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSA+D+ NT+++FR+QRIGMVQT +QY+FCY AII+ELED++
Sbjct  271  TGTYCTIHNTIQRILAGDMSAVDIANTVSVFRAQRIGMVQTQDQYIFCYKAIIDELEDLV  330

Query  385  KE  380
             +
Sbjct  331  SQ  332



>emb|CAJ77612.1| protein tyrosine phosphatase [Fagus sylvatica]
Length=330

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSAL+LVNTI++FRSQRIGMVQT +Q+ FC+ AII+ELED+I
Sbjct  261  TGTYCTIHNTIQRILAGDMSALNLVNTISMFRSQRIGMVQTPDQFRFCFKAIIDELEDLI  320

Query  385  KESTGQPSS  359
             +   + SS
Sbjct  321  SDFNTERSS  329



>ref|XP_008365849.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Malus domestica]
Length=339

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC+IHN +QRIL GDMSAL+LV+TIT FRSQRIGMVQTLEQY+FCY AI++ELE+++
Sbjct  270  TGTYCSIHNAVQRILAGDMSALNLVDTITTFRSQRIGMVQTLEQYIFCYSAIVDELEELM  329



>ref|XP_009375252.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009375253.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348386.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348387.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=390

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHN +QRIL GDMSAL+LV+TIT FRSQRIGMVQTLEQY+FCY AI++ELE+++
Sbjct  321  TGTYCTIHNAVQRILAGDMSALNLVDTITTFRSQRIGMVQTLEQYIFCYSAIVDELEELM  380

Query  385  KE  380
             +
Sbjct  381  SD  382



>ref|XP_002887394.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63653.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  389
            TGTYCAIHNTIQRIL GDMSALDL  T+ IFRSQRIGMVQT++QY FCY  I++ELED+
Sbjct  274  TGTYCAIHNTIQRILAGDMSALDLAKTVAIFRSQRIGMVQTMDQYFFCYTTIVDELEDL  332



>ref|XP_010521123.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521124.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521125.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521126.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
Length=340

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL GDMSA D+  T+ IFRSQRIGMVQT++QY FCY AI++ELED+ 
Sbjct  272  TGTYCAIHNTIQRILAGDMSATDIGKTVAIFRSQRIGMVQTMDQYFFCYRAIVDELEDLT  331

Query  385  KESTGQPSS  359
             E+    SS
Sbjct  332  AEARSGRSS  340



>ref|XP_010471199.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Camelina sativa]
 ref|XP_010471200.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Camelina sativa]
Length=337

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT++QY FCY AI++ELED+ 
Sbjct  269  TGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTMDQYFFCYTAIVDELEDLT  328

Query  385  KESTGQPSS  359
              +    SS
Sbjct  329  GGTNAGTSS  337



>ref|XP_008381997.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Malus domestica]
Length=339

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHN +QRIL GDMSAL+LV+TIT FRSQRIGMVQTLEQY+FCY AI++ELE+++
Sbjct  270  TGTYCXIHNAVQRILAGDMSALNLVDTITTFRSQRIGMVQTLEQYIFCYSAIVDELEELM  329



>gb|EYU22866.1| hypothetical protein MIMGU_mgv1a009565mg [Erythranthe guttata]
Length=338

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQR+L GDMSALDLVNT+T FRSQR+GMVQTLEQY FC+ AI +EL+++I
Sbjct  272  TGTYCLIHNTIQRVLNGDMSALDLVNTVTTFRSQRLGMVQTLEQYQFCHKAIADELQNLI  331

Query  385  KESTGQ  368
             +S   
Sbjct  332  SDSKAH  337



>emb|CDX72837.1| BnaC06g32850D [Brassica napus]
Length=337

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDL  T+T FR QRIGMVQT++QY FCY+AI++EL D+ 
Sbjct  269  TGTYCAIHNTIQRILVGDMSALDLAKTVTTFRRQRIGMVQTMDQYFFCYNAIVDELGDLT  328

Query  385  KESTGQPSS  359
              +    SS
Sbjct  329  AGTNAGTSS  337



>ref|XP_009404327.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Musa acuminata 
subsp. malaccensis]
Length=335

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNT+QR+L+GDMS+LDL  TI+ FRSQR+GMVQT+EQY FCYDAI++ELE+++
Sbjct  271  TGTYCTIHNTLQRVLIGDMSSLDLKKTISEFRSQRLGMVQTMEQYFFCYDAIVDELEELL  330

Query  385  KES  377
              S
Sbjct  331  SRS  333



>ref|XP_007143629.1| hypothetical protein PHAVU_007G087900g [Phaseolus vulgaris]
 gb|ESW15623.1| hypothetical protein PHAVU_007G087900g [Phaseolus vulgaris]
Length=343

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL GDMSA+D+ NT+ +FR+QRIGMVQT +QY+FCY AII+ELED++
Sbjct  281  TGTYCTIHNTIQRILAGDMSAVDIANTVAVFRAQRIGMVQTQDQYIFCYKAIIDELEDLV  340

Query  385  KE  380
             +
Sbjct  341  SQ  342



>ref|XP_007227330.1| hypothetical protein PRUPE_ppa016082mg [Prunus persica]
 gb|EMJ28529.1| hypothetical protein PRUPE_ppa016082mg [Prunus persica]
Length=361

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IH+T+QRI+ GDMSALDLVNTIT FRSQR GMVQ  EQY FCYDAII+ELED+I
Sbjct  297  TGTYCTIHDTLQRIISGDMSALDLVNTITRFRSQRDGMVQKPEQYCFCYDAIIDELEDLI  356

Query  385  KES  377
             + 
Sbjct  357  SDP  359



>ref|XP_010428033.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Camelina sativa]
Length=342

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQR+L GDMSALDL  T+  FRSQRIGMVQT++QY FCY AI++ELED+ 
Sbjct  274  TGTYCAIHNTIQRVLAGDMSALDLAKTVAKFRSQRIGMVQTMDQYFFCYTAIVDELEDLT  333

Query  385  KESTGQPSS  359
              +    SS
Sbjct  334  GGTNAGTSS  342



>ref|XP_006301380.1| hypothetical protein CARUB_v10021792mg, partial [Capsella rubella]
 gb|EOA34278.1| hypothetical protein CARUB_v10021792mg, partial [Capsella rubella]
Length=383

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  389
            TGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT++QY FCY AI++ELED+
Sbjct  315  TGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTMDQYFFCYTAIVDELEDL  373



>ref|XP_010930782.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Elaeis guineensis]
Length=347

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GD+S+LDLV T+  FRSQRIGMVQT+EQ+ FCY AI++ELE+++
Sbjct  283  TGTYCAIHNTIQRILIGDISSLDLVKTVADFRSQRIGMVQTMEQFFFCYAAIVDELEELV  342

Query  385  KEST  374
             +S 
Sbjct  343  LKSN  346



>ref|XP_009105847.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Brassica rapa]
Length=343

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDL  T+T+FR QR GMVQT++QY FCY+AI++EL D+ 
Sbjct  275  TGTYCAIHNTIQRILVGDMSALDLAKTVTMFRRQRNGMVQTMDQYFFCYNAIVDELGDLT  334

Query  385  KESTGQPSS  359
              +    SS
Sbjct  335  AGTNAGTSS  343



>emb|CDX96354.1| BnaA07g29650D [Brassica napus]
Length=343

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNTIQRIL+GDMSALDL  T+T+FR QR GMVQT++QY FCY+AI++EL D+ 
Sbjct  275  TGTYCAIHNTIQRILVGDMSALDLAKTVTMFRRQRNGMVQTMDQYFFCYNAIVDELGDLT  334

Query  385  KESTGQPSS  359
              +    SS
Sbjct  335  AGTNAGTSS  343



>ref|XP_009390761.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=336

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNTIQR+L+GDMS+LDLV T+  FRSQRIGMVQT+EQY FCY AI++ELE+++
Sbjct  272  TGAYCTIHNTIQRVLVGDMSSLDLVRTVAEFRSQRIGMVQTVEQYFFCYAAIVDELEELV  331

Query  385  KES  377
             +S
Sbjct  332  SKS  334



>ref|NP_001237920.1| tyrosine phosphatase 1 [Glycine max]
 emb|CAA06975.1| tyrosine phosphatase 1 [Glycine max]
 gb|KHN17072.1| Tyrosine-protein phosphatase non-receptor type 6 [Glycine soja]
Length=338

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRI+ GDMSA+D+  TI +FRSQRIGMVQT +QY+FCY+AII+ELED++
Sbjct  273  TGTYCTIHNTIQRIVAGDMSAVDIAKTIAMFRSQRIGMVQTQDQYIFCYNAIIDELEDLV  332

Query  385  KE  380
             +
Sbjct  333  SQ  334



>gb|KEH43589.1| tyrosine phosphatase [Medicago truncatula]
Length=331

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IH+TIQRIL GD+SA+D+ NT+++FRSQRIGMVQT +QY+FCY+AII+ELED++
Sbjct  269  TGTYCTIHSTIQRILAGDISAIDIANTVSVFRSQRIGMVQTQDQYIFCYEAIIDELEDLV  328

Query  385  KE  380
             +
Sbjct  329  SQ  330



>ref|XP_006588511.1| PREDICTED: tyrosine phosphatase 1 isoform X1 [Glycine max]
Length=336

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRI+ GDMSA+D+  TI +FRSQRIGMVQT +QY+FCY+AII+ELED++
Sbjct  273  TGTYCTIHNTIQRIVAGDMSAVDIAKTIAMFRSQRIGMVQTQDQYIFCYNAIIDELEDLV  332

Query  385  KE  380
             +
Sbjct  333  SQ  334



>ref|XP_008781548.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Phoenix 
dactylifera]
Length=347

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL+GDMS+LDL+ T+  FRSQRIGMVQT+EQ+ FCY AI++ELE+++
Sbjct  283  TGTYCTIHNTIQRILIGDMSSLDLLKTVADFRSQRIGMVQTMEQFFFCYAAIVDELEELV  342

Query  385  KEST  374
             +S 
Sbjct  343  LKSN  346



>gb|EPS63074.1| hypothetical protein M569_11713, partial [Genlisea aurea]
Length=124

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYCAIHNT++RIL+GD +ALDL +TIT FRSQR+ MV+T EQYL CYDA+I+ELED+I
Sbjct  56   TGTYCAIHNTLERILMGDSTALDLGDTITNFRSQRMRMVETGEQYLLCYDAVIDELEDVI  115

Query  385  KESTGQPS  362
              S  +PS
Sbjct  116  S-SAQRPS  122



>ref|XP_008781549.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008781550.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Phoenix 
dactylifera]
Length=278

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQRIL+GDMS+LDL+ T+  FRSQRIGMVQT+EQ+ FCY AI++ELE+++
Sbjct  214  TGTYCTIHNTIQRILIGDMSSLDLLKTVADFRSQRIGMVQTMEQFFFCYAAIVDELEELV  273

Query  385  KEST  374
             +S 
Sbjct  274  LKSN  277



>gb|KHN00785.1| Tyrosine-protein phosphatase non-receptor type 20 [Glycine soja]
Length=333

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNTIQRIL GDMSA+ + NTI +FRSQRIGMVQT +QY+FCY+AII+ELED++
Sbjct  270  TGAYCTIHNTIQRILAGDMSAVRIANTIAMFRSQRIGMVQTQDQYIFCYNAIIDELEDLV  329

Query  385  KE  380
             +
Sbjct  330  SQ  331



>ref|XP_006606202.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Glycine max]
Length=326

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNTIQRIL GDMSA+ + NTI +FRSQRIGMVQT +QY+FCY+AII+ELED++
Sbjct  263  TGAYCTIHNTIQRILAGDMSAVRIANTIAMFRSQRIGMVQTQDQYIFCYNAIIDELEDLV  322

Query  385  KE  380
             +
Sbjct  323  SQ  324



>ref|XP_003556188.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Glycine max]
 ref|XP_006606201.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Glycine max]
Length=338

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNTIQRIL GDMSA+ + NTI +FRSQRIGMVQT +QY+FCY+AII+ELED++
Sbjct  275  TGAYCTIHNTIQRILAGDMSAVRIANTIAMFRSQRIGMVQTQDQYIFCYNAIIDELEDLV  334

Query  385  KE  380
             +
Sbjct  335  SQ  336



>ref|XP_010674720.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Beta vulgaris 
subsp. vulgaris]
Length=325

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IH++IQRIL GDMSALD  NT+ +FR QR+GMVQTL+QY FCY  +++ELE++I
Sbjct  257  TGTYCIIHDSIQRILAGDMSALDFANTVHVFRPQRVGMVQTLDQYYFCYKTVVDELEELI  316

Query  385  KESTGQPSS  359
                 + S+
Sbjct  317  SRYNPEKSA  325



>ref|XP_008358192.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Malus domestica]
Length=374

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IH+T+QRIL GD SALDLV TIT FRSQR GMVQ  EQY FCYDAII+ELE++I
Sbjct  307  TGTYCTIHDTLQRILSGDXSALDLVKTITTFRSQRDGMVQKPEQYRFCYDAIIDELEELI  366



>ref|XP_010674811.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010674859.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Beta vulgaris subsp. 
vulgaris]
Length=340

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IH++IQRIL GDMSALD  +T+ +FRSQR+GMVQTL+QY FCY  +++ELE++I
Sbjct  272  TGTYCTIHDSIQRILAGDMSALDFASTVHVFRSQRVGMVQTLDQYYFCYKTVVDELEELI  331

Query  385  KESTGQPSS  359
                 + S+
Sbjct  332  SRYNPEKSA  340



>ref|XP_004299356.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Fragaria vesca 
subsp. vesca]
 ref|XP_004299357.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Fragaria vesca 
subsp. vesca]
Length=356

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IH+T++RIL GDMSALDLV TI  FRSQR GMV+TL+QY FCY AI++ELED+I
Sbjct  290  TGTYCTIHDTMKRILSGDMSALDLVGTIATFRSQRDGMVETLKQYQFCYSAIVDELEDLI  349



>gb|ACY78390.1| protein tyrosine phosphatase 1 [Phalaenopsis amabilis]
Length=346

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IHNTIQR+L+GDMS+LDL  T+  FRSQR+GMVQTLEQ+ FCY A+++ELE ++
Sbjct  282  TGTYCVIHNTIQRVLIGDMSSLDLAKTVLDFRSQRMGMVQTLEQFKFCYVAVVDELEGLV  341

Query  385  KEST  374
             ++ 
Sbjct  342  SKAN  345



>ref|NP_001065893.2| Os11g0180200 [Oryza sativa Japonica Group]
 dbj|BAF27738.2| Os11g0180200 [Oryza sativa Japonica Group]
Length=72

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT +QY FCY AI+ EL D++
Sbjct  8    TGAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEDQYKFCYMAIVSELNDLL  67

Query  385  KES  377
              S
Sbjct  68   SNS  70



>ref|XP_008343293.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Malus domestica]
Length=171

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC IH+T+QRIL G+M  LDLV TIT FR QR GMVQ  EQY  CYDA+++ELED I
Sbjct  101  TGTYCTIHDTLQRILSGNMPGLDLVKTITTFRFQRDGMVQKPEQYRLCYDALVDELEDHI  160

Query  385  KESTGQP  365
              S G P
Sbjct  161  --SDGSP  165



>ref|XP_006662780.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Oryza brachyantha]
Length=239

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RIL GDMSALDL  T+T FRSQR GMVQT +QY FCY AI++EL D++
Sbjct  175  TGAYITIHNTIERILSGDMSALDLSETVTKFRSQRPGMVQTEDQYKFCYTAIVDELNDLL  234

Query  385  KES  377
              S
Sbjct  235  PNS  237



>gb|AAX96301.1| Protein-tyrosine phosphatase [Oryza sativa Japonica Group]
Length=237

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT +QY FCY AI+ EL D++
Sbjct  173  TGAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEDQYKFCYMAIVSELNDLL  232

Query  385  KES  377
              S
Sbjct  233  SNS  235



>ref|XP_006662779.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Oryza brachyantha]
Length=289

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RIL GDMSALDL  T+T FRSQR GMVQT +QY FCY AI++EL D++
Sbjct  225  TGAYITIHNTIERILSGDMSALDLSETVTKFRSQRPGMVQTEDQYKFCYTAIVDELNDLL  284

Query  385  KES  377
              S
Sbjct  285  PNS  287



>ref|XP_006829464.1| hypothetical protein AMTR_s00247p00015290 [Amborella trichopoda]
 gb|ERM96880.1| hypothetical protein AMTR_s00247p00015290 [Amborella trichopoda]
Length=345

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG +C I++TIQRIL+GDMSA+DL  TI+ FR +RIGMVQT EQ+LFCY  I++ELED+I
Sbjct  280  TGAFCTIYHTIQRILVGDMSAVDLHVTISNFRDERIGMVQTREQFLFCYSVIMDELEDLI  339

Query  385  KESTGQ  368
              S  Q
Sbjct  340  SGSGEQ  345



>ref|NP_001149088.1| receptor-type tyrosine-protein phosphatase S [Zea mays]
 gb|ACG34138.1| receptor-type tyrosine-protein phosphatase S precursor [Zea mays]
Length=351

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTY  IH TI+RILLGD S+ DL  T+  FRSQR GMVQT EQY FCY AI++EL+D++
Sbjct  288  TGTYITIHTTIERILLGDKSSYDLAKTVKNFRSQRPGMVQTEEQYKFCYRAIVDELKDLL  347



>dbj|BAK00963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNT++RIL GD +A +LV T+  FRSQR G+VQT EQY FCY AI++EL+D+I
Sbjct  305  TGAYITIHNTVERILRGDQAATNLVETVGKFRSQRPGIVQTEEQYKFCYHAIVDELKDLI  364

Query  385  KES  377
            + S
Sbjct  365  RNS  367



>gb|ACF86150.1| unknown [Zea mays]
 tpg|DAA55534.1| TPA: receptor-type tyrosine-protein phosphatase S [Zea mays]
Length=351

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTY  IH TI+RILLGD S+ DL  T+  FRSQR GMVQT EQY FCY AI +EL+D++
Sbjct  288  TGTYITIHTTIERILLGDKSSYDLAKTVKNFRSQRPGMVQTEEQYKFCYRAIADELKDLL  347



>ref|XP_010238660.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Brachypodium distachyon]
Length=262

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IH+TI+RILLGD S+ DLV T+  FRSQR GMVQT +QY+FC+ AI++EL+D++
Sbjct  199  TGAYITIHSTIERILLGDTSSYDLVETVKKFRSQRNGMVQTEDQYMFCFRAIVDELKDLL  258

Query  385  KES  377
            K +
Sbjct  259  KSN  261



>ref|NP_001169094.1| uncharacterized protein LOC100382937 [Zea mays]
 gb|ACN31241.1| unknown [Zea mays]
 gb|ACN31635.1| unknown [Zea mays]
Length=186

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RILLG+  A DLV T+  FRSQR GMVQT EQY  C+ AI +ELED++
Sbjct  115  TGAYTTIHNTIERILLGEQGAADLVETVKKFRSQRPGMVQTEEQYKCCHHAIRDELEDLV  174

Query  385  KESTGQPSS  359
              S  +P S
Sbjct  175  SSSKIEPLS  183



>ref|XP_002442903.1| hypothetical protein SORBIDRAFT_08g004710 [Sorghum bicolor]
 gb|EES16741.1| hypothetical protein SORBIDRAFT_08g004710 [Sorghum bicolor]
Length=335

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IH TI+RILLGD S+ DLV T+  FRSQR GMVQT EQY FCY AI +EL+D++
Sbjct  272  TGAYITIHTTIERILLGDKSSYDLVETVKNFRSQRTGMVQTEEQYKFCYQAIADELKDLL  331



>gb|ABK26026.1| unknown [Picea sitchensis]
Length=358

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG +C I +TI RIL GD+SALDL  TI  FR+QRIGMVQT +QY+FCY A++ ELED++
Sbjct  293  TGAFCTISHTIHRILEGDVSALDLSTTIRQFRNQRIGMVQTQDQYIFCYAAVVHELEDLV  352



>dbj|BAJ94079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IH++I+RILLGD+++ DLV T+  FRSQR GMVQT +QY+FCY AI +EL+D++
Sbjct  314  TGAYITIHSSIERILLGDINSYDLVETVKKFRSQRTGMVQTEQQYMFCYRAIADELKDLL  373

Query  385  KES  377
            + S
Sbjct  374  RSS  376



>dbj|BAJ98480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IH++I+RILLGD+++ DLV T+  FRSQR GMVQT +QY+FCY AI +EL+D++
Sbjct  327  TGAYITIHSSIERILLGDINSYDLVETVKKFRSQRTGMVQTEQQYMFCYRAIADELKDLL  386

Query  385  KES  377
            + S
Sbjct  387  RSS  389



>gb|EMT13080.1| Tyrosine-protein phosphatase non-receptor type 20 [Aegilops tauschii]
Length=296

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNT++RIL G+ +A +LV T+  FRSQR GMVQT EQY FCY AI +EL+D+I
Sbjct  232  TGAYITIHNTVERILRGEQAATNLVETVGKFRSQRPGMVQTEEQYKFCYHAIADELKDLI  291

Query  385  KES  377
            + S
Sbjct  292  RNS  294



>ref|XP_010237888.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like, partial [Brachypodium 
distachyon]
Length=440

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RILLG+ +A+DL  T+  FRSQR GMVQT +Q+ FCY A+++EL+D++
Sbjct  378  TGAYITIHNTIERILLGEQTAMDLAETVRNFRSQRPGMVQTEDQFKFCYHAVVDELKDLV  437



>ref|XP_010239266.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Brachypodium 
distachyon]
Length=592

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RILLG+  ALD+V T+  FRSQR G+VQT EQ +FCY AI++EL++++
Sbjct  518  TGAYITIHNTIERILLGEQDALDVVETVRKFRSQRAGVVQTEEQLMFCYKAIVDELKELV  577

Query  385  KESTGQPSS  359
            + S    SS
Sbjct  578  QNSPVPSSS  586



>gb|KJB35865.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=323

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  440
            TGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT+
Sbjct  275  TGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTM  316



>ref|XP_007020250.1| Tyrosine phosphatase 1 isoform 2 [Theobroma cacao]
 gb|EOY17475.1| Tyrosine phosphatase 1 isoform 2 [Theobroma cacao]
Length=340

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEE  401
            TGTYCAIHNTIQRIL+GDMSALDL NT++ FRSQRIGMVQT+   L  Y   ++E
Sbjct  273  TGTYCAIHNTIQRILVGDMSALDLANTVSTFRSQRIGMVQTM---LLGYSEFLKE  324



>ref|XP_004978858.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Setaria italica]
Length=289

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHN I RILLGD  A++L  T+  FRS+R GMVQT EQ+ FC+ AI +EL+D+I
Sbjct  225  TGAYITIHNAIDRILLGDQGAVNLAETLKKFRSERPGMVQTEEQFKFCHQAIADELKDLI  284

Query  385  KES  377
              S
Sbjct  285  SNS  287



>ref|XP_004978856.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Setaria italica]
 ref|XP_004978857.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Setaria italica]
Length=290

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHN I RILLGD  A++L  T+  FRS+R GMVQT EQ+ FC+ AI +EL+D+I
Sbjct  226  TGAYITIHNAIDRILLGDQGAVNLAETLKKFRSERPGMVQTEEQFKFCHQAIADELKDLI  285

Query  385  KES  377
              S
Sbjct  286  SNS  288



>ref|XP_001774836.1| predicted protein [Physcomitrella patens]
 gb|EDQ60377.1| predicted protein [Physcomitrella patens]
Length=272

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGTYC I +T++RI+ GD+ A+D+ NT+  FRSQR GMVQT +QY FCY+ +I+ELE  +
Sbjct  207  TGTYCTIDHTLRRIMEGDLEAVDIGNTVRNFRSQRHGMVQTRDQYRFCYEVVIKELESYV  266



>ref|XP_002450425.1| hypothetical protein SORBIDRAFT_05g005210 [Sorghum bicolor]
 gb|EES09413.1| hypothetical protein SORBIDRAFT_05g005210 [Sorghum bicolor]
Length=526

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IHNTI+RIL G+  A+DLV T+  FRSQR GMVQT EQY  C+ AI +EL+D++
Sbjct  462  TGAYITIHNTIERILRGEQEAVDLVETVKKFRSQRPGMVQTEEQYKCCHQAIRDELKDLV  521

Query  385  KES  377
              S
Sbjct  522  SSS  524



>ref|XP_006664386.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like, partial [Oryza 
brachyantha]
Length=284

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IH+TI+R+LLGD S+ +L  T+   R+QR+GMVQT +QY+FCY AI +EL+D++
Sbjct  221  TGAYIIIHSTIERVLLGDKSSYNLDETVKHLRTQRVGMVQTEQQYMFCYRAIADELKDLL  280

Query  385  KES  377
            + +
Sbjct  281  RSN  283



>gb|KDO83953.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
 gb|KDO83954.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=339

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  440
            TG YC IHNT+QRIL+GDMSALDL NT+ +FRSQRIGMVQT+
Sbjct  273  TGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTM  314



>ref|XP_008237327.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Prunus 
mume]
Length=346

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  440
            TGTYC IHNT+QRIL GDMSALD+V+T+T FRSQRIGMVQTL
Sbjct  270  TGTYCTIHNTVQRILAGDMSALDVVDTVTTFRSQRIGMVQTL  311



>ref|XP_001751306.1| predicted protein [Physcomitrella patens]
 gb|EDQ83623.1| predicted protein [Physcomitrella patens]
Length=405

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGT+C I +T++RIL GD+ A+D+ +T+  FRSQR GMVQT +QY FCY A+ +ELED +
Sbjct  342  TGTFCVIDHTLRRILGGDLEAVDIKSTVRNFRSQRDGMVQTRDQYQFCYQAVEKELEDYV  401

Query  385  K  383
            +
Sbjct  402  R  402



>ref|XP_009390760.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=337

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 5/54 (9%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY-----LFCY  419
            TG YC IHNTIQR+L+GDMS+LDLV T+  FRSQRIGMVQT+  Y     LFCY
Sbjct  272  TGAYCTIHNTIQRVLVGDMSSLDLVRTVAEFRSQRIGMVQTVVSYLSFFLLFCY  325



>ref|NP_001066289.1| Os12g0174800 [Oryza sativa Japonica Group]
 gb|ABA96591.1| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA96592.1| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29308.1| Os12g0174800 [Oryza sativa Japonica Group]
 gb|EAZ19814.1| hypothetical protein OsJ_35396 [Oryza sativa Japonica Group]
 dbj|BAG89053.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IH+TI+R+LLGD S+  L  T+   R+QR+GMVQT +QY+FCY AI +EL+D++
Sbjct  265  TGAYITIHSTIERLLLGDKSSYHLDETVKTLRTQRVGMVQTEKQYMFCYRAIADELKDLL  324

Query  385  KES  377
            + +
Sbjct  325  ESN  327



>gb|EAY82439.1| hypothetical protein OsI_37652 [Oryza sativa Indica Group]
Length=328

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG Y  IH+TI+R+LLGD S+  L  T+   R+QR+GMVQT +QY+FCY AI +EL+D++
Sbjct  265  TGAYITIHSTIERLLLGDKSSYHLDETVKTLRTQRVGMVQTEKQYMFCYRAIADELKDLL  324

Query  385  KES  377
            + +
Sbjct  325  ESN  327



>ref|XP_004977238.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Setaria italica]
Length=259

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGTY  IH  I+RILLGD  + D+V T+  FRSQR GMVQT +QY FCY  I +EL+
Sbjct  196  TGTYITIHTAIERILLGDKRSYDIVKTVKNFRSQRPGMVQTEQQYKFCYQVIADELK  252



>gb|KHN00786.1| hypothetical protein glysoja_000454 [Glycine soja]
Length=149

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  562  GTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  404
              YC IHNTIQ IL GDMSA+++ + +  FR+QR+ MVQT  QY FCY AIIE
Sbjct  97   PPYCTIHNTIQTILAGDMSAVNIADAVATFRTQRLRMVQTQAQYNFCYKAIIE  149



>gb|EMT05398.1| Tyrosine-protein phosphatase Lar-like protein [Aegilops tauschii]
Length=245

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 10/73 (14%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQT----------LEQYLFCYD  416
            TG Y  IH++I+RILLGD S+ DLV T+   RSQR GMVQT           +QY+FCY 
Sbjct  171  TGAYITIHSSIERILLGDTSSYDLVETVKKSRSQRTGMVQTEMLYWHIFAFQQQYMFCYR  230

Query  415  AIIEELEDIIKES  377
            AI +EL+D++  S
Sbjct  231  AIADELKDLLSSS  243



>gb|KDO83951.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=330

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 13/60 (22%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TG YC IHNT+QRIL+GDMSALDL NT+              EQY+FC+ AI++ELED+I
Sbjct  273  TGAYCTIHNTVQRILVGDMSALDLANTVK-------------EQYIFCHQAIVDELEDLI  319



>gb|KEH43588.1| tyrosine phosphatase [Medicago truncatula]
Length=321

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQT  443
            TGTYC IH+TIQRIL GD+SA+D+ NT+++FRSQRIGMVQT
Sbjct  269  TGTYCTIHSTIQRILAGDISAIDIANTVSVFRSQRIGMVQT  309



>gb|AEW08685.1| hypothetical protein CL1189Contig1_03, partial [Pinus radiata]
 gb|AFG56004.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56006.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56007.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56008.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56009.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56010.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56011.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56012.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56013.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56014.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56015.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56016.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56017.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
 gb|AFG56018.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
Length=50

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  517  GDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKEST  374
            GD+SALD+  TI  FR+QR+GMVQT +QY+FCYDA++ ELED+I +  
Sbjct  1    GDVSALDISATIRQFRNQRLGMVQTQDQYIFCYDAVVHELEDLISQQN  48



>gb|EEC67788.1| hypothetical protein OsI_35345 [Oryza sativa Indica Group]
Length=305

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  434
            TG Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT EQ
Sbjct  244  TGAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEEQ  287



>gb|EEE51752.1| hypothetical protein OsJ_33184 [Oryza sativa Japonica Group]
Length=342

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  434
            TG Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT EQ
Sbjct  281  TGAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEEQ  324



>gb|ABA91789.2| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
Length=387

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  434
            TG Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT EQ
Sbjct  326  TGAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEEQ  369



>gb|AFG56005.1| hypothetical protein CL1189Contig1_03, partial [Pinus taeda]
Length=50

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  517  GDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKE  380
            GD+SALD+  TI  FR+QR+GMVQT +QY+F YDA++ ELED+I +
Sbjct  1    GDVSALDISATIRQFRNQRLGMVQTQDQYIFSYDAVVHELEDLISQ  46



>gb|EMS67302.1| Tyrosine-protein phosphatase Lar-like protein [Triticum urartu]
Length=328

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 47/95 (49%), Gaps = 32/95 (34%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQT-------------------  443
            TG Y  IHNT++RIL G+ +A +L  T+  FRSQR GMVQT                   
Sbjct  232  TGAYITIHNTVERILRGEQAATNLAETVGKFRSQRPGMVQTEVRLFYLFISVCKSVIGSS  291

Query  442  -------------LEQYLFCYDAIIEELEDIIKES  377
                          EQY FCY AI +EL+D+I+ S
Sbjct  292  QVMDLDPQQDDCSREQYKFCYHAIADELKDLIRNS  326



>ref|XP_002965416.1| hypothetical protein SELMODRAFT_83906, partial [Selaginella moellendorffii]
 gb|EFJ32836.1| hypothetical protein SELMODRAFT_83906, partial [Selaginella moellendorffii]
Length=155

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            +GT+  I + ++RIL GD+SA+++ + +   R QR G+V+T EQY FC+ AII+ LE
Sbjct  93   SGTFITIDHILRRILSGDLSAVNVADVVQYLRQQRGGLVETNEQYWFCFRAIIKHLE  149



>ref|XP_005644093.1| hypothetical protein COCSUDRAFT_67695 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19549.1| hypothetical protein COCSUDRAFT_67695 [Coccomyxa subellipsoidea 
C-169]
Length=360

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGD----MSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  398
            TGT+CA+   +QR+  GD    +SA +L   +   R QR GMVQT EQYLFCY A+ +E+
Sbjct  294  TGTFCAVDVALQRLRSGDYGIAVSAAELKPVVAELRRQRSGMVQTAEQYLFCYRAVKDEV  353

Query  397  EDII  386
            +  +
Sbjct  354  DKEV  357



>ref|XP_002978222.1| hypothetical protein SELMODRAFT_56201, partial [Selaginella moellendorffii]
 gb|EFJ20879.1| hypothetical protein SELMODRAFT_56201, partial [Selaginella moellendorffii]
Length=299

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  389
            +G Y  I  T++RIL GD++A++L +T+   R  R GMVQT  QY F Y A+++EL+D+
Sbjct  241  SGAYIGIDQTLRRILKGDLTAVNLQDTVMRLRDHRYGMVQTKAQYHFIYAAVLDELQDL  299



>ref|XP_002966338.1| hypothetical protein SELMODRAFT_66231, partial [Selaginella moellendorffii]
 gb|EFJ32365.1| hypothetical protein SELMODRAFT_66231, partial [Selaginella moellendorffii]
Length=299

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  389
            +G Y  I  T++RIL GD++A++L +T+   R  R GMVQT  QY F Y A+++EL+D+
Sbjct  241  SGAYIGIDQTLRRILKGDLTAVNLQDTVMRLRDHRYGMVQTKAQYHFIYAAVLDELQDL  299



>ref|XP_002976024.1| hypothetical protein SELMODRAFT_104243, partial [Selaginella 
moellendorffii]
 gb|EFJ22929.1| hypothetical protein SELMODRAFT_104243, partial [Selaginella 
moellendorffii]
Length=155

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            +GT+  I + ++RI  GD+SA+ + + +   R QR G+V+T EQY FC+ AII++LE
Sbjct  93   SGTFITIDHILRRIQSGDLSAVSVADVVQYLRQQRGGLVETSEQYWFCFRAIIKQLE  149



>ref|XP_004356068.1| protein-tyrosine phosphatase 1 [Dictyostelium fasciculatum]
 gb|EGG17584.1| protein-tyrosine phosphatase 1 [Dictyostelium fasciculatum]
Length=400

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVN-----TITIFRSQRIGMVQTLEQYLFCYDAIIEE  401
            TGT+C +H  + RI   D S LD V+      +   R QR GMVQ LEQYLFCY+AI +E
Sbjct  337  TGTFCTVHIMMSRI---DNSPLDKVDFNLYSVVNNLRKQRPGMVQQLEQYLFCYEAIEDE  393

Query  400  LED  392
            L +
Sbjct  394  LRE  396



>ref|XP_004358810.1| protein tyrosine phosphatase [Dictyostelium fasciculatum]
 gb|EGG20960.1| protein tyrosine phosphatase [Dictyostelium fasciculatum]
Length=310

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = -1

Query  565  TGTYCAIHNTI---QRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  404
            +GT+C IH+ +   +  L  +   L++   IT FR+QR GMVQT EQY FCY AI E
Sbjct  233  SGTFCVIHSVVTNYKNELKNEQYTLNIPKIITNFRTQRPGMVQTKEQYRFCYSAIAE  289



>dbj|GAM25942.1| hypothetical protein SAMD00019534_091170, partial [Acytostelium 
subglobosum LB1]
Length=315

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 3/61 (5%)
 Frame = -1

Query  565  TGTYCAIHNTIQRI---LLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+C +H  + RI   + G     ++ N +   R QR GMVQ LEQYLFCY  I +EL 
Sbjct  207  TGTFCTVHMMMSRIDNTVPGHRIDFNIFNIVKNLRKQRPGMVQQLEQYLFCYATIADELR  266

Query  394  D  392
            +
Sbjct  267  E  267



>gb|EFA76454.1| protein-tyrosine phosphatase 1 [Polysphondylium pallidum PN500]
Length=489

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSA---LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+C +H  I RI     ++    ++ + +   R QR GMVQ LEQYLFCY  I +EL+
Sbjct  422  TGTFCTVHTLISRIDNAKPNSKIDFNIYSIVNNLRKQRPGMVQQLEQYLFCYATIADELK  481

Query  394  D  392
            +
Sbjct  482  E  482



>ref|XP_001696901.1| protein tyrosine phosphatase 3 [Chlamydomonas reinhardtii]
 gb|EDP00593.1| protein tyrosine phosphatase 3, partial [Chlamydomonas reinhardtii]
Length=271

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  508  SALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  392
            +A+DL   +   R QR GMVQTLEQY FCY+A+++E+ED
Sbjct  233  TAVDLPAVVHTLRRQRKGMVQTLEQYFFCYEALLQEMED  271



>ref|XP_002968574.1| hypothetical protein SELMODRAFT_409515 [Selaginella moellendorffii]
 gb|EFJ30828.1| hypothetical protein SELMODRAFT_409515 [Selaginella moellendorffii]
Length=249

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
             GT+  + + ++ IL GD+S +++  T+   R QR G+V+T EQY FC+ A+I+ LE
Sbjct  170  AGTFVTLDHVLRSILSGDLSVVNISRTVARLRQQRRGLVETDEQYWFCFRAVIKILE  226



>ref|XP_002975907.1| hypothetical protein SELMODRAFT_416055 [Selaginella moellendorffii]
 gb|EFJ22812.1| hypothetical protein SELMODRAFT_416055 [Selaginella moellendorffii]
Length=283

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
             GT+  + + ++ IL GD+S +++ +T+   R QR G+V+T EQY FC+ A+I+ LE
Sbjct  204  AGTFVTLDHVLRSILSGDLSVVNISHTVARLRQQRRGLVETDEQYWFCFRAVIKILE  260



>ref|XP_002970174.1| hypothetical protein SELMODRAFT_410976 [Selaginella moellendorffii]
 gb|EFJ28304.1| hypothetical protein SELMODRAFT_410976 [Selaginella moellendorffii]
Length=268

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
             GT+  I + ++ IL G++S +++  T+   R QR G+V+T +QY FC+ A+I+ELE
Sbjct  190  AGTFITIDHVLRCILGGNLSVVNISETVARLREQRRGLVETHDQYWFCFKAVIKELE  246



>ref|XP_002978341.1| hypothetical protein SELMODRAFT_418145 [Selaginella moellendorffii]
 gb|EFJ20327.1| hypothetical protein SELMODRAFT_418145 [Selaginella moellendorffii]
Length=288

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
             GT+  I + ++ IL G++S +++  T+   R QR G+V+T +QY FC+ A+I+ELE
Sbjct  210  AGTFITIDHVLRCILGGNLSVVNISETVARLREQRRGLVETHDQYWFCFKAVIKELE  266



>gb|EIE81798.1| hypothetical protein RO3G_06503 [Rhizopus delemar RA 99-880]
Length=757

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALD--LVNTITIFRSQRIGMVQTLEQYLFCYDAI  410
            +G +CAI  T+ R+   D       L+ TI+ FR QR+ MVQTL Q++FCY+AI
Sbjct  678  SGAFCAIDTTLYRLSHTDCGTKSDVLLETISRFREQRLSMVQTLRQFVFCYEAI  731



>ref|XP_002603921.1| hypothetical protein BRAFLDRAFT_248550 [Branchiostoma floridae]
 gb|EEN59932.1| hypothetical protein BRAFLDRAFT_248550 [Branchiostoma floridae]
Length=587

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CAI   ++R+    +   D+   +   R QR  MVQTL+QY FCY A++E L+
Sbjct  524  TGTFCAISTVLERVKAEGIC--DVFQVVKALRQQRPHMVQTLDQYQFCYQAVVEYLD  578



>ref|XP_002603893.1| hypothetical protein BRAFLDRAFT_102251 [Branchiostoma floridae]
 gb|EEN59904.1| hypothetical protein BRAFLDRAFT_102251 [Branchiostoma floridae]
Length=597

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CAI   ++R+    +   D+   +   R QR  MVQTL+QY FCY A++E L+
Sbjct  534  TGTFCAISTVLERVKAEGIC--DVFQVVKALRQQRPHMVQTLDQYQFCYQAVVEYLD  588



>ref|XP_002603919.1| hypothetical protein BRAFLDRAFT_248501 [Branchiostoma floridae]
 gb|EEN59930.1| hypothetical protein BRAFLDRAFT_248501, partial [Branchiostoma 
floridae]
Length=610

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CAI   ++R+    +   D+   +   R QR  MVQTL+QY FCY A++E L+
Sbjct  547  TGTFCAISTVLERVKAEGIC--DVFQVVKALRQQRPHMVQTLDQYQFCYQAVVEYLD  601



>dbj|GAM18917.1| hypothetical protein SAMD00019534_020920 [Acytostelium subglobosum 
LB1]
Length=425

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 3/60 (5%)
 Frame = -1

Query  565  TGTYCAIHNTIQRI---LLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+C +H  + RI      D    ++ + +   R QR GMVQ LEQYLFCY  I +EL+
Sbjct  358  TGTFCTVHIVMSRIDNAAENDRINFNIYSIVDNLRKQRPGMVQQLEQYLFCYATIADELK  417



>ref|XP_005290630.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X1 [Chrysemys picta bellii]
Length=584

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   + +  L DM  L++  T+   R+QR   +QT EQY FCY AIIE ++
Sbjct  513  TGTFCALDICLSQ--LQDMGTLNVYQTVMRMRTQRAFSIQTPEQYYFCYTAIIEHVQ  567



>dbj|BAC06422.1| protein tyrosine phosphatase a [Oryzias latipes]
Length=69

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  404
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E
Sbjct  6    TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQE  57



>ref|XP_002953490.1| hypothetical protein VOLCADRAFT_82191 [Volvox carteri f. nagariensis]
 gb|EFJ45463.1| hypothetical protein VOLCADRAFT_82191 [Volvox carteri f. nagariensis]
Length=358

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 15/86 (17%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILL----------GDMS-ALDLVNTITIFRSQRIGMVQTLEQYLFCY  419
            TGT  AI   ++R+             D+S A+DL   +   R QR GMVQT+EQY FCY
Sbjct  268  TGTLMAIDVILRRLWAMAEQGLPSGPADVSTAVDLPAVVHSLRRQRKGMVQTMEQYYFCY  327

Query  418  DAIIEELEDIIKESTGQPSS*SIETT  341
            +A++ E++    E+TG+ S  S+   
Sbjct  328  EAVLHEMQ----EATGRSSRESVHAN  349



>dbj|GAM20689.1| hypothetical protein SAMD00019534_038640, partial [Acytostelium 
subglobosum LB1]
Length=393

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLG-----DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  404
            +GT+C IH+ +   + G     ++  L++   I  FRSQR GMVQ  EQY FCY AI E
Sbjct  315  SGTFCVIHSVVTNSISGGGADSNVVTLNIPKIIANFRSQRPGMVQNKEQYRFCYLAIAE  373



>gb|ACN32402.1| protein tyrosine phosphatase receptor type A precursor [Lethenteron 
camtschaticum]
Length=656

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R+QR  MVQTLEQY FCY  + E +E
Sbjct  593  TGTFCALCTILERVKTEGI--LDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYIE  647



>dbj|BAA95170.1| amPTPR4b [Branchiostoma belcheri]
Length=469

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CAI   ++R+        D+  T+   R QR  MVQT++QY FCY A++E L+
Sbjct  406  TGTFCAISTVLERVKT--EGNCDVFQTVKALRQQRPHMVQTIDQYQFCYQAVVEYLD  460



>ref|XP_005140377.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like 
[Melopsittacus undulatus]
Length=94

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  31   TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  85



>ref|XP_002601342.1| hypothetical protein BRAFLDRAFT_59175 [Branchiostoma floridae]
 gb|EEN57354.1| hypothetical protein BRAFLDRAFT_59175 [Branchiostoma floridae]
Length=663

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CAI   ++R+        D+  T+   R QR  MVQ ++QY FCY A++E L+
Sbjct  600  TGTFCAISTVLERV--KTEGNCDVFQTVKALRQQRPHMVQNIDQYQFCYQAVVEYLD  654



>emb|CAA38662.1| protein-tyrosine phosphatase [Homo sapiens]
Length=793

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY+ + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYEVVQEYID  784



>ref|XP_009054725.1| hypothetical protein LOTGIDRAFT_118033 [Lottia gigantea]
 gb|ESO94440.1| hypothetical protein LOTGIDRAFT_118033 [Lottia gigantea]
Length=364

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  398
            TGTY ++ + ++R  L  +  +D+ N + + R+QR+ MVQTLEQY+F YD ++E L
Sbjct  268  TGTYISVDSQLERAKLEGI--IDVHNFVQLMRTQRVNMVQTLEQYIFVYDCLLEAL  321



>emb|CEP18626.1| hypothetical protein [Parasitella parasitica]
Length=713

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALD--LVNTITIFRSQRIGMVQTLEQYLFCYDAI  410
            +G +CAI   + R+   + ++    L+ TI+ FR QR+ MVQTL Q++FCY+A+
Sbjct  638  SGAFCAIDTVLYRLRHAESTSSHDILLQTISRFREQRVSMVQTLRQFVFCYEAV  691



>dbj|GAN11229.1| protein-tyrosine-phosphatase [Mucor ambiguus]
Length=690

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query  565  TGTYCAIHNTIQRI--LLGDMSALD-LVNTITIFRSQRIGMVQTLEQYLFCYDAI  410
            +G +CAI   + R+  +  + S  D L+ TI+ FR QR+ MVQTL Q++FCY+AI
Sbjct  613  SGAFCAIDTVLYRLQNMRSNSSDHDILLQTISRFREQRLSMVQTLRQFVFCYEAI  667



>emb|CEI98699.1| hypothetical protein RMCBS344292_12802 [Rhizopus microsporus]
Length=762

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALD--LVNTITIFRSQRIGMVQTLEQYLFCYDAI  410
            +G +CAI   I R+   D +     L+ TI+ FR QR+ MVQTL Q +FCY+AI
Sbjct  689  SGAFCAIDTVIYRLCNTDCNPKSDILLETISRFREQRLSMVQTLRQLVFCYEAI  742



>emb|CEG70495.1| Putative Cell wall integrity protein scw1 [Rhizopus microsporus]
Length=800

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALD--LVNTITIFRSQRIGMVQTLEQYLFCYDAI  410
            +G +CAI   I R+   D +     L+ TI+ FR QR+ MVQTL Q +FCY+AI
Sbjct  727  SGAFCAIDTVIYRLCNTDCNPKSDILLETISRFREQRLSMVQTLRQLVFCYEAI  780



>ref|XP_001200450.2| PREDICTED: uncharacterized protein LOC764213 [Strongylocentrotus 
purpuratus]
Length=1283

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  565   TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  404
             TGT+C +  ++ R  L D++ +D+ NT+ + R+QR   +QT +QY FCY A++E
Sbjct  1206  TGTFCTLDISLAR--LEDVATIDVCNTVRLMRAQRAYSIQTPDQYEFCYFALVE  1257



>ref|XP_010776349.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like 
[Notothenia coriiceps]
Length=148

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
            TGT+C +   + R  L D+ ++D+  T+   R+QR   +QT +QY FCY A+IE  +   
Sbjct  74   TGTFCTLDICLSR--LEDIGSVDIRQTVRRMRTQRAFSIQTWDQYYFCYTAVIEYAQRNG  131

Query  385  KESTGQPSS*SIET  344
            K S  Q S   +ET
Sbjct  132  KLSPVQWSDSDLET  145



>ref|XP_009505548.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like, 
partial [Phalacrocorax carbo]
Length=162

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  404
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E
Sbjct  99   TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQE  150



>ref|XP_005495051.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Zonotrichia 
albicollis]
Length=771

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  708  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  762



>ref|XP_005427810.1| PREDICTED: LOW QUALITY PROTEIN: receptor-type tyrosine-protein 
phosphatase alpha [Geospiza fortis]
Length=805

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  742  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  796



>ref|XP_008932872.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Manacus 
vitellinus]
Length=807

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  744  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  798



>ref|XP_005517998.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Pseudopodoces 
humilis]
Length=807

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  744  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  798



>gb|KFO63865.1| Receptor-type tyrosine-protein phosphatase alpha [Corvus brachyrhynchos]
Length=808

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  745  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  799



>gb|KFW76905.1| Receptor-type tyrosine-protein phosphatase alpha [Manacus vitellinus]
Length=809

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  746  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  800



>emb|CDQ61969.1| unnamed protein product [Oncorhynchus mykiss]
Length=809

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  746  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  800



>ref|XP_009096382.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Serinus 
canaria]
Length=813

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  750  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  804



>ref|XP_008638088.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Corvus 
brachyrhynchos]
Length=813

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  750  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  804



>ref|XP_005045695.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like 
[Ficedula albicollis]
Length=813

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  750  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  804



>ref|XP_002189841.2| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Taeniopygia 
guttata]
Length=813

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  750  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  804



>ref|XP_010400530.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Corvus 
cornix cornix]
Length=832

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  769  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  823



>gb|AEO12553.1| Lefftyrin, partial [Oscarella carmela]
Length=14757

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = -1

Query  565    TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  386
              TGT+C +H+ ++    G  S LD+  T+   R+QR GMVQT EQ  FC+ A+ + L   I
Sbjct  13964  TGTFCTVHSILEGYERGQAS-LDVTETVKNLRAQRAGMVQTAEQLGFCHLAVSDALLQ-I  14021

Query  385    KESTGQ  368
               ++TG+
Sbjct  14022  PQTTGE  14027



>ref|XP_010126949.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like 
[Chlamydotis macqueenii]
Length=166

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  404
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E
Sbjct  103  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQE  154



>ref|XP_010879106.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Esox lucius]
Length=687

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  624  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  678



>gb|ELK34511.1| Receptor-type tyrosine-protein phosphatase alpha [Myotis davidii]
Length=947

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  758  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  812



>gb|ADN07443.1| protein tyrosine phosphatase, receptor type, A, 3 prime, partial 
[Microtus ochrogaster]
Length=626

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  563  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  617



>ref|XP_010809654.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X4 [Bos taurus]
Length=640

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  577  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  631



>ref|XP_005010179.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like 
[Anas platyrhynchos]
Length=651

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  588  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  642



>ref|XP_005808519.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like 
[Xiphophorus maculatus]
Length=654

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  591  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  645



>gb|EMP28863.1| Receptor-type tyrosine-protein phosphatase alpha [Chelonia mydas]
Length=674

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  611  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  665



>ref|XP_010879107.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Esox lucius]
Length=686

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+     + LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  623  TGTFCALSTVLERV--KAEAILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  677



>ref|XP_007654413.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha, 
partial [Ornithorhynchus anatinus]
Length=706

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  643  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  697



>ref|XP_006499053.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Mus musculus]
Length=706

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  643  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  697



>emb|CAF89865.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=709

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  646  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  700



>dbj|BAD92939.1| protein tyrosine phosphatase, receptor type, A isoform 2 precursor 
variant [Homo sapiens]
Length=651

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  588  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  642



>gb|KFP28921.1| Receptor-type tyrosine-protein phosphatase alpha, partial [Colius 
striatus]
 gb|KFP61829.1| Receptor-type tyrosine-protein phosphatase alpha, partial [Cariama 
cristata]
 gb|KFU97779.1| Receptor-type tyrosine-protein phosphatase alpha, partial [Pterocles 
gutturalis]
Length=602

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  539  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  593



>ref|XP_010218041.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Tinamus 
guttatus]
Length=756

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  693  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  747



>ref|XP_006732356.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Leptonychotes 
weddellii]
Length=769

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  706  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  760



>ref|XP_007554383.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Poecilia 
formosa]
Length=780

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  717  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  771



>ref|XP_008046179.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Tarsius syrichta]
Length=791

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  728  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  782



>ref|NP_001193429.1| receptor-type tyrosine-protein phosphatase alpha isoform 2 precursor 
[Bos taurus]
Length=792

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  729  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  783



>ref|XP_006874898.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Chrysochloris asiatica]
Length=792

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  729  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  783



>ref|XP_005974816.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Pantholops hodgsonii]
Length=792

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  729  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  783



>ref|XP_005365668.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Microtus ochrogaster]
Length=792

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  729  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  783



>ref|XP_005894004.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Bos mutus]
 gb|ELR57627.1| Receptor-type tyrosine-protein phosphatase alpha [Bos mutus]
Length=792

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  729  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  783



>ref|XP_004014426.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
1 [Ovis aries]
Length=792

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  729  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  783



>gb|ADN07436.1| protein tyrosine phosphatase, receptor type, A [Microtus ochrogaster]
Length=792

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  729  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  783



>ref|XP_008701513.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Ursus maritimus]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_008525823.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X3 [Equus przewalskii]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_008017381.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X10 [Chlorocebus sabaeus]
 ref|XP_008017386.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X10 [Chlorocebus sabaeus]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_007465457.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Lipotes vexillifer]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_007195893.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Balaenoptera acutorostrata scammoni]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_007127201.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Physeter catodon]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_006984594.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X3 [Peromyscus maniculatus bairdii]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_006894254.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Elephantulus edwardii]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>emb|CAA37447.1| tyrosine phosphatase precursor [Homo sapiens]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>prf||1701300A protein Tyr phosphatase
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_005068686.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Mesocricetus auratus]
 ref|XP_005068687.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X3 [Mesocricetus auratus]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004697933.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Echinops telfairi]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004661529.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Jaculus jaculus]
 ref|XP_004661530.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X3 [Jaculus jaculus]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004585722.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Ochotona princeps]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004433874.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
2 [Ceratotherium simum simum]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004398218.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
5 [Odobenus rosmarus divergens]
 ref|XP_004398219.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
6 [Odobenus rosmarus divergens]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004383073.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
2 [Trichechus manatus latirostris]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004285367.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
2 [Orcinus orca]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004061767.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Gorilla 
gorilla gorilla]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|NP_543030.1| receptor-type tyrosine-protein phosphatase alpha isoform 2 precursor 
[Homo sapiens]
 ref|NP_543031.1| receptor-type tyrosine-protein phosphatase alpha isoform 2 precursor 
[Homo sapiens]
 emb|CAA38065.1| protein-tyrosine phosphatase [Homo sapiens]
 gb|AAH27308.1| Protein tyrosine phosphatase, receptor type, A [Homo sapiens]
 emb|CAE11878.1| hypothetical protein [Homo sapiens]
 gb|EAX10562.1| hCG2020289, isoform CRA_b [Homo sapiens]
 gb|EAX10563.1| hCG2020289, isoform CRA_b [Homo sapiens]
 gb|ABM82081.1| protein tyrosine phosphatase, receptor type, A [synthetic construct]
 gb|ABM85260.1| protein tyrosine phosphatase, receptor type, A [synthetic construct]
 dbj|BAF82922.1| unnamed protein product [Homo sapiens]
 gb|AIC54991.1| PTPRA, partial [synthetic construct]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_008973009.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Pan paniscus]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_002918821.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Ailuropoda melanoleuca]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_002830151.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X4 [Pongo abelii]
 ref|XP_009231700.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X4 [Pongo abelii]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_001158634.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X4 [Pan troglodytes]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_001114682.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
1 [Macaca mulatta]
 ref|XP_002798265.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
3 [Macaca mulatta]
 ref|XP_009214736.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Papio anubis]
Length=793

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  730  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  784



>ref|XP_004611014.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Sorex araneus]
Length=796

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  733  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  787



>ref|XP_004398217.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
4 [Odobenus rosmarus divergens]
Length=796

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  733  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  787



>ref|XP_008407732.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha [Poecilia 
reticulata]
Length=797

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  734  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  788



>ref|XP_006096456.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X6 [Myotis lucifugus]
 ref|XP_006096457.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X7 [Myotis lucifugus]
Length=797

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  734  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  788



>ref|XP_006984593.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Peromyscus maniculatus bairdii]
Length=798

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  735  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  789



>gb|KFW07653.1| Receptor-type tyrosine-protein phosphatase alpha [Eurypyga helias]
Length=800

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  737  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  791



>gb|KFR04498.1| Receptor-type tyrosine-protein phosphatase alpha [Nipponia nippon]
Length=800

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  737  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  791



>gb|KFP16551.1| Receptor-type tyrosine-protein phosphatase alpha [Egretta garzetta]
Length=800

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  737  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  791



>gb|KFO80571.1| Receptor-type tyrosine-protein phosphatase alpha [Cuculus canorus]
Length=800

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  737  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  791



>ref|XP_008852703.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Nannospalax galili]
 ref|XP_008852704.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Nannospalax galili]
Length=800

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  737  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  791



>ref|XP_008046178.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Tarsius syrichta]
Length=800

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  737  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  791



>ref|NP_001231414.1| receptor-type tyrosine-protein phosphatase alpha precursor [Sus 
scrofa]
Length=800

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  737  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  791



>gb|KFP81881.1| Receptor-type tyrosine-protein phosphatase alpha [Acanthisitta 
chloris]
Length=801

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  738  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  792



>ref|NP_001193428.1| receptor-type tyrosine-protein phosphatase alpha isoform 1 precursor 
[Bos taurus]
 ref|XP_010809653.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Bos taurus]
 tpg|DAA22996.1| TPA: protein tyrosine phosphatase, receptor type, A isoform 2 
[Bos taurus]
Length=801

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  738  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  792



>ref|XP_006042789.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X4 [Bubalus bubalis]
 ref|XP_006042790.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X5 [Bubalus bubalis]
Length=801

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  738  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  792



>ref|XP_006164011.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X2 [Tupaia chinensis]
Length=801

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  738  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  792



>ref|XP_005974815.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha isoform 
X1 [Pantholops hodgsonii]
Length=801

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  565  TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELE  395
            TGT+CA+   ++R+    +  LD+  T+   R QR  MVQTLEQY FCY  + E ++
Sbjct  738  TGTFCALSTVLERVKAEGI--LDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID  792



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920