BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049P20

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097423.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    166   2e-45   Sesamum indicum [beniseed]
ref|XP_010248537.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    166   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010248538.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    166   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_011097422.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    166   5e-45   Sesamum indicum [beniseed]
ref|XP_007031533.1|  Isocitrate/isopropylmalate dehydrogenase fam...    166   8e-45   
ref|XP_008458785.1|  PREDICTED: isocitrate dehydrogenase [NADP]         165   9e-45   Cucumis melo [Oriental melon]
gb|KHG11175.1|  Isocitrate dehydrogenase [NADP]                         165   1e-44   Gossypium arboreum [tree cotton]
gb|EEC77605.1|  hypothetical protein OsI_16579                          164   2e-44   Oryza sativa Indica Group [Indian rice]
gb|KJB70908.1|  hypothetical protein B456_011G095400                    165   2e-44   Gossypium raimondii
gb|ABR25660.1|  isocitrate dehydrogenase                                156   2e-44   Oryza sativa Indica Group [Indian rice]
emb|CAE04728.1|  OSJNBa0043L24.16                                       164   2e-44   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67563.1|  OSIGBa0101P20.6                                        164   2e-44   Oryza sativa [red rice]
ref|XP_010033298.1|  PREDICTED: isocitrate dehydrogenase [NADP]         164   2e-44   Eucalyptus grandis [rose gum]
ref|NP_001053269.1|  Os04g0508200                                       164   2e-44   
ref|XP_004142794.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    164   2e-44   
ref|XP_004156686.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    164   2e-44   
ref|XP_010940160.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    164   3e-44   Elaeis guineensis
ref|XP_010940159.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    164   3e-44   Elaeis guineensis
tpg|DAA37007.1|  TPA: hypothetical protein ZEAMMB73_112049              159   8e-44   
ref|XP_008812172.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    162   1e-43   Phoenix dactylifera
ref|XP_003581407.1|  PREDICTED: isocitrate dehydrogenase [NADP]         162   1e-43   Brachypodium distachyon [annual false brome]
gb|KDO55215.1|  hypothetical protein CISIN_1g0090411mg                  160   1e-43   Citrus sinensis [apfelsine]
ref|XP_009390155.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    162   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008379224.1|  PREDICTED: isocitrate dehydrogenase [NADP]         162   2e-43   
ref|XP_009334109.1|  PREDICTED: isocitrate dehydrogenase [NADP]         162   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_002524672.1|  NADP-specific isocitrate dehydrogenase, puta...    161   2e-43   
ref|XP_003618179.1|  Isocitrate dehydrogenase-like protein              161   2e-43   Medicago truncatula
gb|KDP45313.1|  hypothetical protein JCGZ_09562                         161   3e-43   Jatropha curcas
ref|NP_001130558.1|  uncharacterized protein LOC100191657               160   3e-43   Zea mays [maize]
ref|XP_009375130.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    161   3e-43   Pyrus x bretschneideri [bai li]
gb|KDO55214.1|  hypothetical protein CISIN_1g0090411mg                  160   3e-43   Citrus sinensis [apfelsine]
ref|XP_003525669.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    160   4e-43   Glycine max [soybeans]
ref|XP_007151010.1|  hypothetical protein PHAVU_004G011200g             160   4e-43   Phaseolus vulgaris [French bean]
ref|XP_010688692.1|  PREDICTED: isocitrate dehydrogenase [NADP]         160   5e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002446765.1|  hypothetical protein SORBIDRAFT_06g022050          160   5e-43   Sorghum bicolor [broomcorn]
ref|XP_004976171.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    160   5e-43   Setaria italica
ref|XP_004489246.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    160   6e-43   
ref|XP_006470285.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    161   7e-43   Citrus sinensis [apfelsine]
ref|XP_006653587.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    160   7e-43   Oryza brachyantha
ref|XP_009377196.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    160   8e-43   Pyrus x bretschneideri [bai li]
gb|EYU34732.1|  hypothetical protein MIMGU_mgv1a005695mg                160   9e-43   Erythranthe guttata [common monkey flower]
ref|XP_006841065.1|  hypothetical protein AMTR_s00085p00178400          160   1e-42   Amborella trichopoda
ref|XP_010108798.1|  Isocitrate dehydrogenase [NADP]                    159   1e-42   Morus notabilis
dbj|BAC77065.1|  NADP-specific isocitrate dehydrogenase                 159   2e-42   Lupinus albus
ref|XP_004306353.2|  PREDICTED: isocitrate dehydrogenase [NADP]         159   3e-42   Fragaria vesca subsp. vesca
emb|CDX78585.1|  BnaA03g04970D                                          158   4e-42   
emb|CBX54595.1|  putative isocitrate dehydrogenase                      148   4e-42   Quercus pubescens
emb|CBX54593.1|  putative isocitrate dehydrogenase                      148   4e-42   Quercus robur [English oak]
emb|CCI55358.1|  PH01B035L11.3                                          157   5e-42   Phyllostachys edulis [kikko-chiku]
ref|XP_008230571.1|  PREDICTED: isocitrate dehydrogenase [NADP]         157   6e-42   Prunus mume [ume]
ref|XP_007215326.1|  hypothetical protein PRUPE_ppa005200mg             157   6e-42   
gb|AFK44087.1|  unknown                                                 149   7e-42   Medicago truncatula
emb|CDX70573.1|  BnaC03g06570D                                          157   1e-41   
ref|NP_001042583.1|  Os01g0248400                                       155   2e-41   
gb|EEC70311.1|  hypothetical protein OsI_01162                          155   3e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_004232313.1|  PREDICTED: isocitrate dehydrogenase [NADP]         156   3e-41   Solanum lycopersicum
emb|CDP01688.1|  unnamed protein product                                154   3e-41   Coffea canephora [robusta coffee]
ref|XP_009131418.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    155   4e-41   Brassica rapa
ref|XP_008798438.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    154   6e-41   Phoenix dactylifera
ref|XP_006399971.1|  hypothetical protein EUTSA_v10013384mg             155   7e-41   
ref|XP_009625432.1|  PREDICTED: isocitrate dehydrogenase [NADP]         154   9e-41   Nicotiana tomentosiformis
ref|XP_009768205.1|  PREDICTED: isocitrate dehydrogenase [NADP]         154   1e-40   Nicotiana sylvestris
emb|CAA65773.1|  isocitrate dehydrogenase (NADP+)                       148   1e-40   Eucalyptus globulus subsp. bicostata
ref|XP_011047331.1|  PREDICTED: isocitrate dehydrogenase [NADP]         154   1e-40   Populus euphratica
ref|XP_006643991.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    153   1e-40   Oryza brachyantha
ref|XP_002298528.2|  hypothetical protein POPTR_0001s35080g             154   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010551913.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_006287601.1|  hypothetical protein CARUB_v10000812mg             154   2e-40   Capsella rubella
ref|XP_002873679.1|  hypothetical protein ARALYDRAFT_488300             154   2e-40   
emb|CAB87626.1|  isocitrate dehydrogenase-like protein                  153   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24873.1|  unknown                                                 153   2e-40   Picea sitchensis
ref|XP_011086318.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    151   3e-40   
ref|NP_196963.2|  isocitrate dehydrogenase                              153   3e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01228.1|  predicted protein                                      149   4e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA65504.1|  isocitrate dehydrogenase (NADP+)                       152   5e-40   Nicotiana tabacum [American tobacco]
emb|CAA65503.1|  isocitrate dehydrogenase (NADP+)                       152   5e-40   Nicotiana tabacum [American tobacco]
ref|XP_011086317.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    151   7e-40   Sesamum indicum [beniseed]
gb|KHG29051.1|  Isocitrate dehydrogenase [NADP], chloroplastic          152   8e-40   Gossypium arboreum [tree cotton]
gb|AIZ74341.1|  isocitrate dehydrogenase                                152   8e-40   Pinus massoniana [Chinese red pine]
ref|XP_010092444.1|  Isocitrate dehydrogenase [NADP]                    150   1e-39   
emb|CDY68004.1|  BnaAnng25850D                                          144   1e-39   Brassica napus [oilseed rape]
gb|KJB33783.1|  hypothetical protein B456_006G032000                    151   1e-39   Gossypium raimondii
emb|CDP02088.1|  unnamed protein product                                151   2e-39   Coffea canephora [robusta coffee]
gb|KHN21348.1|  Isocitrate dehydrogenase [NADP], chloroplastic          150   2e-39   Glycine soja [wild soybean]
gb|ACU21054.1|  unknown                                                 150   2e-39   Glycine max [soybeans]
ref|XP_010420101.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    151   2e-39   Camelina sativa [gold-of-pleasure]
gb|EMT15852.1|  Isocitrate dehydrogenase (NADP)                         149   2e-39   
ref|XP_010453584.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    150   2e-39   Camelina sativa [gold-of-pleasure]
gb|EMS45309.1|  Isocitrate dehydrogenase [NADP]                         149   3e-39   Triticum urartu
ref|XP_010553875.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    149   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_010693737.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    149   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008227912.1|  PREDICTED: isocitrate dehydrogenase [NADP]         149   4e-39   Prunus mume [ume]
ref|XP_010492268.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    150   5e-39   Camelina sativa [gold-of-pleasure]
dbj|BAJ89315.1|  predicted protein                                      149   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004293807.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    149   5e-39   Fragaria vesca subsp. vesca
emb|CAN83081.1|  hypothetical protein VITISV_001328                     148   5e-39   Vitis vinifera
ref|XP_007211789.1|  hypothetical protein PRUPE_ppa006334mg             149   5e-39   Prunus persica
ref|XP_003616186.1|  Isocitrate dehydrogenase                           149   5e-39   Medicago truncatula
emb|CDM82394.1|  unnamed protein product                                149   6e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002268982.1|  PREDICTED: isocitrate dehydrogenase [NADP]         148   6e-39   Vitis vinifera
ref|NP_001236203.1|  NADP-dependent isocitrate dehydrogenase            148   7e-39   
ref|XP_010924867.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    148   7e-39   
gb|KJB78117.1|  hypothetical protein B456_012G179300                    146   8e-39   Gossypium raimondii
ref|XP_010260857.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    148   8e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006598235.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    147   9e-39   Glycine max [soybeans]
ref|XP_010260858.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    148   9e-39   
ref|XP_010924866.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    148   9e-39   Elaeis guineensis
gb|KHF98695.1|  Isocitrate dehydrogenase [NADP]                         148   9e-39   Gossypium arboreum [tree cotton]
gb|ACJ11744.1|  Isocitrate dehydrogenase                                148   9e-39   Gossypium hirsutum [American cotton]
ref|XP_008225974.1|  PREDICTED: isocitrate dehydrogenase [NADP]         148   1e-38   Prunus mume [ume]
ref|XP_009127460.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    148   1e-38   Brassica rapa
emb|CDY60868.1|  BnaCnng36970D                                          148   1e-38   Brassica napus [oilseed rape]
ref|XP_009105173.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    148   1e-38   Brassica rapa
emb|CDY07472.1|  BnaA07g25510D                                          148   1e-38   Brassica napus [oilseed rape]
ref|XP_011038411.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    148   1e-38   Populus euphratica
ref|XP_010230691.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    147   1e-38   Brachypodium distachyon [annual false brome]
gb|AAL11503.1|AF367443_1  NADP-dependent isocitrate dehydrogenase       147   1e-38   Prunus persica
emb|CDY39261.1|  BnaC06g27300D                                          147   1e-38   Brassica napus [oilseed rape]
sp|Q40345.1|IDHP_MEDSA  RecName: Full=Isocitrate dehydrogenase [N...    148   1e-38   Medicago sativa [alfalfa]
gb|KFK25699.1|  hypothetical protein AALP_AA8G147500                    149   1e-38   Arabis alpina [alpine rockcress]
ref|XP_008371955.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    148   1e-38   
gb|AGV54452.1|  NADPH-specific isocitrate dehydrogenase                 147   1e-38   Phaseolus vulgaris [French bean]
ref|XP_007217240.1|  hypothetical protein PRUPE_ppa006356mg             147   1e-38   
ref|XP_008371954.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    148   1e-38   
gb|AAB39248.1|  NADP-isocitrate dehydrogenase                           147   1e-38   Eucalyptus globulus [blue gum]
ref|XP_006391329.1|  hypothetical protein EUTSA_v10018635mg             147   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_007141953.1|  hypothetical protein PHAVU_008G239900g             147   2e-38   Phaseolus vulgaris [French bean]
gb|KJB43198.1|  hypothetical protein B456_007G188300                    146   2e-38   Gossypium raimondii
ref|XP_003546847.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    147   2e-38   Glycine max [soybeans]
ref|XP_007141952.1|  hypothetical protein PHAVU_008G239900g             147   2e-38   Phaseolus vulgaris [French bean]
ref|XP_006302327.1|  hypothetical protein CARUB_v10020383mg             147   2e-38   Capsella rubella
ref|XP_010415139.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    147   2e-38   Camelina sativa [gold-of-pleasure]
gb|KDO46549.1|  hypothetical protein CISIN_1g015012mg                   147   2e-38   Citrus sinensis [apfelsine]
ref|XP_009409414.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO46543.1|  hypothetical protein CISIN_1g015012mg                   147   2e-38   Citrus sinensis [apfelsine]
ref|XP_004490788.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    147   2e-38   Cicer arietinum [garbanzo]
dbj|BAE48792.1|  NADP-isocitrate dehydrogenase                          147   2e-38   Codonopsis lanceolata
gb|KDO46544.1|  hypothetical protein CISIN_1g015012mg                   147   2e-38   Citrus sinensis [apfelsine]
ref|XP_009363306.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    147   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_002276200.2|  PREDICTED: isocitrate dehydrogenase [NADP]         148   2e-38   Vitis vinifera
ref|XP_006432387.1|  hypothetical protein CICLE_v10001314mg             147   2e-38   
ref|XP_006432389.1|  hypothetical protein CICLE_v10001314mg             147   2e-38   
gb|KCW69443.1|  hypothetical protein EUGRSUZ_F02901                     147   2e-38   Eucalyptus grandis [rose gum]
gb|KJB43199.1|  hypothetical protein B456_007G188300                    146   2e-38   Gossypium raimondii
ref|XP_010062317.1|  PREDICTED: isocitrate dehydrogenase [NADP]         147   3e-38   Eucalyptus grandis [rose gum]
ref|XP_010101074.1|  Isocitrate dehydrogenase [NADP]                    147   3e-38   Morus notabilis
emb|CBI34891.3|  unnamed protein product                                148   3e-38   Vitis vinifera
ref|XP_010511516.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    146   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002886987.1|  hypothetical protein ARALYDRAFT_475696             146   3e-38   
gb|EPS58684.1|  hypothetical protein M569_16128                         146   3e-38   Genlisea aurea
gb|KJB43203.1|  hypothetical protein B456_007G188300                    146   3e-38   Gossypium raimondii
gb|AAD51361.1|AF176669_1  NADP-isocitrate dehydrogenase                 146   4e-38   Citrus limon [lemon]
gb|KJB43194.1|  hypothetical protein B456_007G188300                    146   4e-38   Gossypium raimondii
gb|KJB43202.1|  hypothetical protein B456_007G188300                    146   4e-38   Gossypium raimondii
ref|XP_003595878.1|  Isocitrate dehydrogenase                           146   4e-38   Medicago truncatula
ref|XP_006494575.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    146   4e-38   Citrus sinensis [apfelsine]
dbj|BAD94180.1|  NADP specific isocitrate dehydrogenase like protein    137   4e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74293.1|  hypothetical protein VITISV_015982                     147   4e-38   Vitis vinifera
ref|XP_007149133.1|  hypothetical protein PHAVU_005G043900g             146   5e-38   Phaseolus vulgaris [French bean]
gb|KDP35739.1|  hypothetical protein JCGZ_10511                         146   5e-38   Jatropha curcas
ref|XP_001778590.1|  predicted protein                                  146   5e-38   
ref|XP_002270617.1|  PREDICTED: isocitrate dehydrogenase [NADP]         146   5e-38   Vitis vinifera
ref|XP_011038412.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    146   5e-38   Populus euphratica
ref|XP_002305928.1|  isocitrate dehydrogenase family protein            146   5e-38   
emb|CAD24782.1|  isocitrate dehydrogenase                               145   6e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AFF18784.1|  NADP-dependent isocitrate dehydrogenase                 137   7e-38   Dimocarpus longan [longan]
ref|NP_176768.1|  NADP+-dependent isocitrate dehydrogenase              145   7e-38   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC77063.1|  NADP-specific isocitrate dehydrogenase                 145   7e-38   Lupinus albus
ref|XP_004488601.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    145   8e-38   Cicer arietinum [garbanzo]
gb|EYU33810.1|  hypothetical protein MIMGU_mgv1a007171mg                145   9e-38   Erythranthe guttata [common monkey flower]
gb|KDP39826.1|  hypothetical protein JCGZ_04236                         145   1e-37   Jatropha curcas
gb|AFW83444.1|  hypothetical protein ZEAMMB73_038317                    145   1e-37   
ref|NP_001142417.1|  uncharacterized protein LOC100274592               145   1e-37   Zea mays [maize]
gb|KHN39494.1|  Isocitrate dehydrogenase [NADP]                         143   1e-37   Glycine soja [wild soybean]
gb|KGN50927.1|  hypothetical protein Csa_5G346550                       144   1e-37   Cucumis sativus [cucumbers]
ref|XP_007022795.1|  Isocitrate dehydrogenase (NADP) isoform 1          145   1e-37   
ref|XP_006574402.1|  PREDICTED: uncharacterized protein LOC100786...    144   1e-37   
ref|XP_008463133.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    145   1e-37   Cucumis melo [Oriental melon]
ref|XP_008463131.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    145   2e-37   Cucumis melo [Oriental melon]
ref|XP_004309437.1|  PREDICTED: isocitrate dehydrogenase [NADP]         145   2e-37   Fragaria vesca subsp. vesca
ref|XP_008463132.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    144   2e-37   Cucumis melo [Oriental melon]
ref|XP_006574401.1|  PREDICTED: uncharacterized protein LOC100786...    144   2e-37   
ref|XP_010470469.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    144   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006372414.1|  isocitrate dehydrogenase family protein            144   2e-37   
gb|AAM13090.1|  similar to NADP-specific isocitrate dehydrogenase       144   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241237.1|  uncharacterized protein LOC100786103               144   2e-37   Glycine max [soybeans]
ref|XP_010551544.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    144   2e-37   Tarenaya hassleriana [spider flower]
gb|ABA18651.1|  cytosolic NADP+-isocitrate dehydrogenase                144   2e-37   Populus tremula x Populus alba [gray poplar]
ref|XP_009395062.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    144   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004157023.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    144   2e-37   
ref|XP_006354121.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    144   2e-37   Solanum tuberosum [potatoes]
ref|XP_010915645.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    144   2e-37   
ref|XP_004150540.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    144   2e-37   
gb|AEZ00844.1|  putative isocitrate dehydrogenase protein               144   2e-37   Elaeis guineensis
ref|XP_011005927.1|  PREDICTED: isocitrate dehydrogenase [NADP]         144   2e-37   Populus euphratica
ref|XP_010915644.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    144   2e-37   Elaeis guineensis
dbj|BAC77064.1|  NADP-specific isocitrate dehydrogenase                 144   2e-37   Lupinus albus
ref|XP_002527208.1|  NADP-specific isocitrate dehydrogenase, puta...    144   3e-37   Ricinus communis
dbj|BAG84436.1|  NADP-dependent isocitrate dehydrogenase                144   3e-37   Passiflora edulis [passion fruit]
gb|KFK35526.1|  hypothetical protein AALP_AA4G002200                    144   3e-37   Arabis alpina [alpine rockcress]
gb|KJB81473.1|  hypothetical protein B456_013G147100                    143   4e-37   Gossypium raimondii
ref|XP_010669953.1|  PREDICTED: isocitrate dehydrogenase [NADP]         143   4e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006596496.1|  PREDICTED: isocitrate dehydrogenase [NADP]         143   5e-37   
dbj|BAA34112.1|  NADP specific isocitrate dehydrogenase                 143   5e-37   Daucus carota [carrots]
gb|AAM65674.1|  isocitrate dehydrogenase, putative                      143   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001136968.1|  seed maturation protein PM41                       143   5e-37   Zea mays [maize]
emb|CDY46358.1|  BnaAnng08060D                                          142   5e-37   Brassica napus [oilseed rape]
ref|XP_009124160.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    143   5e-37   
ref|XP_002528517.1|  NADP-specific isocitrate dehydrogenase, puta...    143   5e-37   Ricinus communis
ref|XP_008783873.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    143   6e-37   Phoenix dactylifera
pir||S33612  isocitrate dehydrogenase (NADP) (EC 1.1.1.42) - soybean    144   6e-37
gb|AAA33978.1|  NADPH-specific isocitrate dehydrogenase                 143   6e-37   Glycine max [soybeans]
ref|XP_008381384.1|  PREDICTED: isocitrate dehydrogenase [NADP]         143   6e-37   
ref|NP_001056381.1|  Os05g0573200                                       143   6e-37   
ref|XP_006422322.1|  hypothetical protein CICLE_v10005058mg             143   6e-37   Citrus clementina [clementine]
ref|XP_009624622.1|  PREDICTED: isocitrate dehydrogenase [NADP]         143   6e-37   Nicotiana tomentosiformis
gb|KHN41035.1|  Isocitrate dehydrogenase [NADP]                         143   6e-37   Glycine soja [wild soybean]
sp|P50218.1|IDHC_TOBAC  RecName: Full=Isocitrate dehydrogenase [N...    143   6e-37   Nicotiana tabacum [American tobacco]
ref|XP_011014473.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    143   7e-37   Populus euphratica
ref|XP_004961158.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    143   7e-37   Setaria italica
ref|XP_010913457.1|  PREDICTED: isocitrate dehydrogenase [NADP]         143   7e-37   Elaeis guineensis
ref|XP_009785664.1|  PREDICTED: isocitrate dehydrogenase [NADP]         143   7e-37   Nicotiana sylvestris
gb|KJB81468.1|  hypothetical protein B456_013G147100                    143   7e-37   Gossypium raimondii
ref|XP_011014465.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    143   7e-37   Populus euphratica
gb|KHG15210.1|  Isocitrate dehydrogenase [NADP]                         143   8e-37   Gossypium arboreum [tree cotton]
ref|XP_006858533.1|  hypothetical protein AMTR_s00071p00157830          143   8e-37   Amborella trichopoda
ref|XP_009124158.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    143   8e-37   Brassica rapa
gb|KDO61504.1|  hypothetical protein CISIN_1g040623mg                   143   8e-37   Citrus sinensis [apfelsine]
ref|XP_002315093.2|  NADP-dependent isocitrate dehydrogenase fami...    143   9e-37   
ref|XP_001778805.1|  predicted protein                                  142   1e-36   
emb|CDY20354.1|  BnaC02g24620D                                          142   1e-36   Brassica napus [oilseed rape]
ref|XP_006392554.1|  hypothetical protein EUTSA_v10012325mg             143   1e-36   
ref|XP_010480188.1|  PREDICTED: peroxisomal isocitrate dehydrogen...    142   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002891883.1|  hypothetical protein ARALYDRAFT_474695             142   1e-36   
ref|XP_009370567.1|  PREDICTED: isocitrate dehydrogenase [NADP]         142   1e-36   Pyrus x bretschneideri [bai li]
gb|ADU20197.1|  NADP-dependent isocitric acid dehydrogenase             142   1e-36   Pyrus pyrifolia [sha li]
ref|XP_002312216.2|  NADP-dependent isocitrate dehydrogenase fami...    142   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009367131.1|  PREDICTED: isocitrate dehydrogenase [NADP]         142   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_009384960.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    142   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011012227.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    141   2e-36   Populus euphratica
gb|ACN32072.1|  unknown                                                 142   2e-36   Zea mays [maize]
ref|NP_001140324.1|  isocitrate dehydrogenase2                          141   2e-36   
gb|ABK25438.1|  unknown                                                 141   3e-36   Picea sitchensis
gb|ACN40177.1|  unknown                                                 141   3e-36   Picea sitchensis
ref|NP_001275253.1|  isocitrate dehydrogenase [NADP], chloroplast...    142   3e-36   Solanum tuberosum [potatoes]
emb|CAA73139.1|  isocitrate dehydrogenase (NADP+)                       141   3e-36   Apium graveolens
ref|XP_009104137.1|  PREDICTED: peroxisomal isocitrate dehydrogen...    141   4e-36   Brassica rapa
gb|EMT15199.1|  putative Isocitrate dehydrogenase (NADP), chlorop...    140   4e-36   
gb|AFL48182.1|  isocitrate dehydrogenase                                141   4e-36   Capsicum annuum
ref|XP_011012153.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    141   4e-36   Populus euphratica
ref|NP_001043749.1|  Os01g0654500                                       140   5e-36   
ref|XP_009631362.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    140   5e-36   Nicotiana tomentosiformis
ref|XP_006644455.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    140   6e-36   Oryza brachyantha
ref|XP_004228607.1|  PREDICTED: isocitrate dehydrogenase [NADP]         140   7e-36   Solanum lycopersicum
ref|XP_007031321.1|  Cytosolic NADP+-dependent isocitrate dehydro...    140   7e-36   
ref|XP_010528595.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    140   7e-36   Tarenaya hassleriana [spider flower]
ref|XP_009780821.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    140   8e-36   Nicotiana sylvestris
gb|EMS50043.1|  Isocitrate dehydrogenase [NADP], chloroplastic          140   8e-36   Triticum urartu
emb|CDX67740.1|  BnaA07g17800D                                          140   9e-36   
ref|XP_006654817.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    140   9e-36   Oryza brachyantha
emb|CAD24779.1|  isocitrate dehydrogenase                               140   9e-36   Cucumis sativus [cucumbers]
gb|EAY99113.1|  hypothetical protein OsI_21072                          140   9e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_002969739.1|  hypothetical protein SELMODRAFT_267315             140   1e-35   Selaginella moellendorffii
ref|XP_002966002.1|  hypothetical protein SELMODRAFT_84397              140   1e-35   
ref|XP_006352387.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    140   1e-35   Solanum tuberosum [potatoes]
ref|XP_009631360.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    140   1e-35   
ref|XP_009631361.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    140   1e-35   
sp|P50217.1|IDHC_SOLTU  RecName: Full=Isocitrate dehydrogenase [N...    140   1e-35   Solanum tuberosum [potatoes]
dbj|BAJ85136.1|  predicted protein                                      139   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002981348.1|  hypothetical protein SELMODRAFT_268459             139   1e-35   Selaginella moellendorffii
dbj|BAJ90352.1|  predicted protein                                      139   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAS49171.1|  NADP-dependent isocitrate dehydrogenase                 139   1e-35   Pisum sativum [garden pea]
emb|CAA53300.1|  isocitrate dehydrogenase (NADP+)                       139   2e-35   Solanum tuberosum [potatoes]
ref|XP_009780819.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    140   2e-35   Nicotiana sylvestris
ref|XP_009780820.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    140   2e-35   Nicotiana sylvestris
ref|XP_004969349.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    139   2e-35   Setaria italica
ref|XP_011085932.1|  PREDICTED: isocitrate dehydrogenase [NADP]         139   2e-35   Sesamum indicum [beniseed]
gb|EYU41406.1|  hypothetical protein MIMGU_mgv1a005492mg                139   2e-35   Erythranthe guttata [common monkey flower]
gb|EYU41407.1|  hypothetical protein MIMGU_mgv1a005492mg                139   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_002989225.1|  hypothetical protein SELMODRAFT_129507             139   3e-35   
gb|ABR16155.1|  unknown                                                 139   3e-35   
gb|AAR05796.1|  NADP+-isocitrate dehydrogenase                          138   4e-35   
ref|XP_010312730.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    137   8e-35   
ref|XP_004250239.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    137   9e-35   
ref|XP_004250238.2|  PREDICTED: isocitrate dehydrogenase [NADP] i...    137   9e-35   
ref|XP_008365983.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    135   1e-34   
ref|NP_175836.1|  isocitrate dehydrogenase                              137   1e-34   
dbj|BAA34113.1|  NADP specific isocitrate dehydrogenase                 136   2e-34   
ref|XP_009776479.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    135   3e-34   
ref|XP_003569476.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    135   3e-34   
emb|CAJ00340.1|  putative isocitrate dehydrogenase                      127   2e-33   
gb|EPS68007.1|  hypothetical protein M569_06765                         132   5e-33   
ref|WP_006843862.1|  isocitrate dehydrogenase                           131   1e-32   
emb|CEA16418.1|  Isocitrate dehydrogenase [NADP]                        131   1e-32   
ref|WP_029906946.1|  isocitrate dehydrogenase                           131   2e-32   
emb|CDW92172.1|  putative isocitrate dehydrogenase                      124   2e-32   
ref|XP_008358224.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    130   4e-32   
ref|XP_008381521.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    130   4e-32   
ref|WP_008866791.1|  Isocitrate dehydrogenase (NADP(+))                 119   2e-30   
ref|WP_039128711.1|  isocitrate dehydrogenase                           125   2e-30   
ref|WP_006801662.1|  isocitrate dehydrogenase                           125   2e-30   
ref|XP_002997021.1|  isocitrate dehydrogenase, putative                 124   3e-30   
ref|XP_008890008.1|  isocitrate dehydrogenase [NADP], mitochondrial     124   3e-30   
gb|KFP85186.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   4e-30   
gb|KFQ02889.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   4e-30   
ref|XP_009077700.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-30   
ref|XP_009948676.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-30   
ref|XP_010082631.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    122   6e-30   
ref|XP_001427867.1|  hypothetical protein                               124   8e-30   
gb|KFV16046.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   8e-30   
gb|KFP59639.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             123   8e-30   
ref|XP_009702706.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    123   9e-30   
ref|XP_009839581.1|  isocitrate dehydrogenase, NADP-dependent           123   9e-30   
ref|XP_007031536.1|  Isocitrate/isopropylmalate dehydrogenase fam...    123   1e-29   
gb|KDO30666.1|  isocitrate dehydrogenase                                122   2e-29   
ref|XP_008613001.1|  isocitrate dehydrogenase [NADP]                    122   2e-29   
gb|KJB70909.1|  hypothetical protein B456_011G095400                    122   2e-29   
ref|WP_026769996.1|  isocitrate dehydrogenase                           122   2e-29   
gb|ETE62592.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             122   2e-29   
ref|XP_006636355.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    122   3e-29   
gb|KFU88624.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             122   3e-29   
ref|XP_009994499.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    122   3e-29   
ref|WP_026326986.1|  isocitrate dehydrogenase                           122   3e-29   
ref|WP_014955765.1|  isocitrate dehydrogenase                           122   3e-29   
ref|XP_008929326.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    122   3e-29   
ref|XP_006108582.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   4e-29   
ref|WP_039144702.1|  isocitrate dehydrogenase                           122   4e-29   
gb|KFW86942.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   4e-29   
ref|XP_005519921.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   4e-29   
gb|ACO14957.1|  Isocitrate dehydrogenase cytoplasmic                    121   4e-29   
ref|XP_005152614.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   4e-29   
ref|XP_004176783.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    121   5e-29   
ref|XP_009582725.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_009505024.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
gb|KFR05578.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|AFG67555.1|  hypothetical protein CL212Contig1_02                    114   5e-29   
ref|XP_010167000.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_010126802.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_010011328.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_009944157.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
gb|KFZ62409.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFW92138.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
ref|WP_028789122.1|  isocitrate dehydrogenase                           121   5e-29   
ref|XP_009809753.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_009558046.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_009460589.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_010282000.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_010188605.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_009888516.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_009484554.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
gb|KFV95317.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFP27927.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
ref|XP_009635785.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_009287789.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_008947966.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
gb|KFQ27854.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFV53161.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFP52161.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
ref|XP_009963540.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
gb|KFO04937.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KGL97447.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFQ94852.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFQ72066.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
ref|XP_010300945.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
ref|XP_010201084.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   5e-29   
gb|KFQ84401.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFQ48129.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFP37530.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|ETP26929.1|  isocitrate dehydrogenase [NADP], mitochondrial          121   5e-29   
gb|KFZ58951.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFQ24203.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFO75295.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
gb|KFP14850.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   5e-29   
ref|XP_005415960.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   6e-29   
gb|KFV48923.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   6e-29   
gb|KFM00485.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   6e-29   
gb|ETK96950.1|  isocitrate dehydrogenase [NADP], mitochondrial          121   6e-29   
gb|KFQ62921.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   6e-29   
ref|XP_009086294.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   6e-29   
gb|ADD38146.1|  Isocitrate dehydrogenase cytoplasmic                    121   6e-29   
gb|KFH65990.1|  isocitrate dehydrogenase [NADP] cytoplasmic             121   6e-29   
ref|XP_008632926.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   6e-29   
ref|XP_005237071.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   6e-29   
ref|XP_002433964.1|  NADP-dependent isocitrate dehydrogenase, put...    121   7e-29   
ref|WP_028524010.1|  isocitrate dehydrogenase                           120   7e-29   
gb|EOB03274.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             121   7e-29   
ref|XP_005016877.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    121   7e-29   
gb|ABU41004.1|  isocitrate dehydrogenase 1                              120   7e-29   
ref|XP_005049177.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   8e-29   
ref|XP_005504078.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   8e-29   
ref|XP_004351430.1|  isocitrate dehydrogenase                           121   8e-29   
ref|XP_005484191.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   9e-29   
gb|KFP94924.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             120   9e-29   
ref|XP_009922779.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   9e-29   
ref|XP_005049173.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   1e-28   
ref|XP_008880386.1|  isocitrate dehydrogenase, NADP-dependent           120   1e-28   
ref|XP_009897369.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   1e-28   
ref|WP_026773331.1|  isocitrate dehydrogenase                           120   1e-28   
gb|KFW06494.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             120   1e-28   
ref|XP_421965.3|  PREDICTED: isocitrate dehydrogenase [NADP] cyto...    120   1e-28   
ref|XP_010151237.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   1e-28   
ref|XP_007456450.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-28   
ref|XP_007421336.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   1e-28   
ref|XP_004942739.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   2e-28   
dbj|GAC76242.1|  NADP-dependent isocitrate dehydrogenase                114   2e-28   
ref|XP_004942738.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   2e-28   
ref|XP_002736618.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   2e-28   
ref|XP_006818812.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    120   2e-28   
gb|KFU98737.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             119   2e-28   
ref|XP_009989725.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   2e-28   
gb|KFV88359.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             119   2e-28   
gb|KFP90502.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             119   2e-28   
ref|XP_009870997.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   2e-28   
ref|XP_009686932.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   2e-28   
gb|ETO19466.1|  isocitrate dehydrogenase                                114   2e-28   
dbj|GAM18756.1|  hypothetical protein SAMD00019534_019310               119   2e-28   
gb|ACO11830.1|  Isocitrate dehydrogenase cytoplasmic                    119   2e-28   
ref|WP_038559471.1|  isocitrate dehydrogenase                           119   2e-28   
ref|WP_015469184.1|  hypothetical protein                               119   3e-28   
ref|XP_001365492.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   3e-28   
gb|KFH70937.1|  isocitrate dehydrogenase [NADP] cytoplasmic             119   3e-28   
ref|WP_013926832.1|  isocitrate dehydrogenase                           119   3e-28   
ref|XP_007117771.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    118   3e-28   
ref|XP_006272824.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   3e-28   
ref|XP_006029194.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   3e-28   
ref|XP_006272825.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   4e-28   
ref|XP_006029195.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    119   4e-28   
gb|KDO55216.1|  hypothetical protein CISIN_1g0090411mg                  119   4e-28   
gb|EFA85228.1|  isocitrate dehydrogenase                                119   4e-28   
ref|XP_004322140.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   4e-28   
gb|KFM80125.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             118   5e-28   
gb|KJF42679.1|  isocitrate dehydrogenase                                118   5e-28   
ref|WP_041693481.1|  isocitrate dehydrogenase                           118   5e-28   
gb|AFK03111.1|  isocitrate dehydrogenase, NADP-dependent                118   5e-28   
ref|XP_002673333.1|  isocitrate dehydrogenase NADP-dependent            117   6e-28   
dbj|GAA52499.1|  isocitrate dehydrogenase                               117   6e-28   
ref|WP_028664060.1|  isocitrate dehydrogenase                           118   6e-28   
ref|XP_003220054.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    118   7e-28   
ref|XP_007117770.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    118   7e-28   
ref|XP_010711822.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    118   7e-28   
gb|EMS48807.1|  Isocitrate dehydrogenase [NADP]                         117   7e-28   
ref|XP_010218700.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-27   
ref|XP_004674398.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-27   
gb|ABB45713.1|  cytosolic NADP-isocitrate dehydrongenase                111   1e-27   
gb|KGL81300.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             117   1e-27   
ref|XP_010745050.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-27   
ref|XP_008060598.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-27   
ref|XP_008488722.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-27   
ref|XP_004262832.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-27   
gb|KFO98338.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             117   1e-27   
ref|XP_010132869.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   1e-27   
ref|XP_006675744.1|  hypothetical protein BATDEDRAFT_34075              117   2e-27   
ref|XP_006446549.1|  hypothetical protein CICLE_v100148162mg            111   2e-27   
ref|WP_018628095.1|  isocitrate dehydrogenase                           117   2e-27   
ref|XP_003766019.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    117   2e-27   
ref|WP_039449099.1|  isocitrate dehydrogenase                           117   2e-27   
ref|XP_005803853.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   2e-27   
ref|XP_006921466.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   2e-27   
ref|XP_007578753.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   2e-27   
ref|XP_002712664.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
emb|CDJ05678.1|  NADP dependent isocitrate dehydrogenase                116   3e-27   
gb|EUB60072.1|  Isocitrate dehydrogenase [NADP]                         116   3e-27   
emb|CDS17905.1|  NADP dependent isocitrate dehydrogenase                116   3e-27   
ref|WP_014678688.1|  isocitrate dehydrogenase                           116   3e-27   
ref|XP_008143447.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
ref|XP_003474240.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
ref|XP_005874270.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
ref|WP_026902885.1|  isocitrate dehydrogenase                           116   3e-27   
ref|XP_006759501.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
ref|XP_003785037.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
ref|XP_002108603.1|  conserved hypothetical protein                     116   3e-27   
ref|XP_008297349.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
ref|XP_001511049.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    116   3e-27   
ref|XP_008326084.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    115   3e-27   
emb|CDW90541.1|  isocitrate dehydrogenase                               116   3e-27   
gb|ELK33536.1|  Isocitrate dehydrogenase [NADP] cytoplasmic             116   4e-27   
ref|WP_014220542.1|  isocitrate dehydrogenase                           116   4e-27   
ref|XP_001633903.1|  predicted protein                                  115   4e-27   
emb|CCF49059.1|  probable IDP2-isocitrate dehydrogenase, cytosolic      115   5e-27   
ref|XP_006182182.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    115   5e-27   
ref|XP_010958389.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    115   5e-27   
ref|XP_006205300.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    115   5e-27   
ref|WP_044014391.1|  isocitrate dehydrogenase                           115   6e-27   
emb|CAJ00339.1|  putative isocitrate dehydrogenase                      110   6e-27   
ref|XP_009494816.1|  isocitrate dehydrogenase [NADP] cytoplasmic        115   6e-27   
emb|CCF49058.1|  probable IDP1-isocitrate dehydrogenase (NADP+), ...    116   6e-27   
gb|KJB78118.1|  hypothetical protein B456_012G179300                    114   6e-27   
ref|XP_009051647.1|  hypothetical protein LOTGIDRAFT_208961             115   6e-27   
ref|XP_001017274.1|  isocitrate dehydrogenase, NADP-dependent fam...    115   6e-27   
ref|XP_007932852.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    115   6e-27   
gb|KIZ06725.1|  isocitrate dehydrogenase                                114   7e-27   
ref|XP_008435822.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    115   7e-27   
gb|EHH21627.1|  hypothetical protein EGK_04742                          115   7e-27   
ref|WP_036251468.1|  isocitrate dehydrogenase                           115   7e-27   
gb|EHH55120.1|  hypothetical protein EGM_04263                          115   7e-27   
ref|NP_001252708.1|  isocitrate dehydrogenase [NADP] cytoplasmic        115   7e-27   
emb|CEF71066.1|  Isocitrate dehydrogenase [NADP]                        115   7e-27   
ref|XP_007964258.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    115   7e-27   
ref|WP_026631906.1|  isocitrate dehydrogenase                           115   7e-27   
ref|XP_011367940.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    115   8e-27   



>ref|XP_011097423.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
isoform X2 [Sesamum indicum]
Length=396

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LDEN+ L+DF QKLEAACIETVESGKMTKDLA
Sbjct  300  LHQKGQETSTNSIASIFAWTRGLEHRAKLDENQKLLDFAQKLEAACIETVESGKMTKDLA  359

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            +L HGPKV RE YL+TEEFIDAVAQNL +K+ SPA
Sbjct  360  ILIHGPKVLREFYLSTEEFIDAVAQNLATKLHSPA  394



>ref|XP_010248537.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV KLE ACIETVE+GKMTKDLA
Sbjct  382  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNNKLLDFVSKLETACIETVETGKMTKDLA  441

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            LL HGPKVSRELYLNTEEF+DAVAQNL  K+  PAL 
Sbjct  442  LLIHGPKVSRELYLNTEEFVDAVAQNLEEKLRVPALV  478



>ref|XP_010248538.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] isoform 
X2 [Nelumbo nucifera]
Length=475

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV KLE ACIETVE+GKMTKDLA
Sbjct  379  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNNKLLDFVSKLETACIETVETGKMTKDLA  438

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            LL HGPKVSRELYLNTEEF+DAVAQNL  K+  PAL 
Sbjct  439  LLIHGPKVSRELYLNTEEFVDAVAQNLEEKLRVPALV  475



>ref|XP_011097422.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Sesamum 
indicum]
Length=483

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LDEN+ L+DF QKLEAACIETVESGKMTKDLA
Sbjct  387  LHQKGQETSTNSIASIFAWTRGLEHRAKLDENQKLLDFAQKLEAACIETVESGKMTKDLA  446

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            +L HGPKV RE YL+TEEFIDAVAQNL +K+ SPA
Sbjct  447  ILIHGPKVLREFYLSTEEFIDAVAQNLATKLHSPA  481



>ref|XP_007031533.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY02459.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
1 [Theobroma cacao]
Length=494

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LDEN+ L+DFV KLEAACIETVE+GKMTKDLA
Sbjct  397  LHQKGQETSTNSIASIFAWTRGLEHRAKLDENERLLDFVHKLEAACIETVEAGKMTKDLA  456

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKVSRE YLNTEEFIDAVA NL SK+  PAL 
Sbjct  457  ILIHGPKVSRESYLNTEEFIDAVAINLESKLWEPALC  493



>ref|XP_008458785.1| PREDICTED: isocitrate dehydrogenase [NADP] [Cucumis melo]
Length=479

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFVQKLEA+CIETVESGKMTKDLA
Sbjct  381  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNHRLLDFVQKLEASCIETVESGKMTKDLA  440

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA*N  283
            LL HGPKVSRE YLNTEEFIDAVAQNL  K+  P +  N
Sbjct  441  LLIHGPKVSREFYLNTEEFIDAVAQNLVVKLQLPPVTVN  479



>gb|KHG11175.1| Isocitrate dehydrogenase [NADP] [Gossypium arboreum]
Length=489

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DFVQKLEAACIETVE+GKMTKDLA
Sbjct  392  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNERLLDFVQKLEAACIETVEAGKMTKDLA  451

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKV+RE YLNTEEFIDAVA NL  K+  PAL 
Sbjct  452  ILTHGPKVTREFYLNTEEFIDAVAVNLDLKLREPALC  488



>gb|EEC77605.1| hypothetical protein OsI_16579 [Oryza sativa Indica Group]
Length=468

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLE+ACIETVESGKMTKDLA
Sbjct  372  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFTKKLESACIETVESGKMTKDLA  431

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPKV+RE YLNTEEFIDAVAQ LR KI  PA+
Sbjct  432  LLIHGPKVTREFYLNTEEFIDAVAQQLREKIQIPAV  467



>gb|KJB70908.1| hypothetical protein B456_011G095400 [Gossypium raimondii]
 gb|KJB70910.1| hypothetical protein B456_011G095400 [Gossypium raimondii]
Length=489

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DFVQKLEAACIETVE+GKMTKDLA
Sbjct  392  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNERLLDFVQKLEAACIETVEAGKMTKDLA  451

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKV+RE YLNTEEFIDAVA NL  K+  PAL 
Sbjct  452  ILTHGPKVTREFYLNTEEFIDAVAVNLDLKLQEPALC  488



>gb|ABR25660.1| isocitrate dehydrogenase [Oryza sativa Indica Group]
Length=154

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWT GLGHRA+LD+NK L+DFVQKLEAAC+ TVESGKMTKDLA
Sbjct  58   VHQKGGETSTNSIASIFAWTTGLGHRAKLDDNKRLLDFVQKLEAACVGTVESGKMTKDLA  117

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP VSR+ YLNT EFIDAVA++LR+++
Sbjct  118  LLVHGPNVSRDKYLNTVEFIDAVAEDLRTRL  148



>emb|CAE04728.1| OSJNBa0043L24.16 [Oryza sativa Japonica Group]
 gb|EEE61309.1| hypothetical protein OsJ_15408 [Oryza sativa Japonica Group]
Length=468

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLE+ACIETVESGKMTKDLA
Sbjct  372  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFTKKLESACIETVESGKMTKDLA  431

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPKV+RE YLNTEEFIDAVAQ LR KI  PA+
Sbjct  432  LLIHGPKVTREFYLNTEEFIDAVAQQLREKIQIPAV  467



>emb|CAH67563.1| OSIGBa0101P20.6 [Oryza sativa Indica Group]
Length=468

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLE+ACIETVESGKMTKDLA
Sbjct  372  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFTKKLESACIETVESGKMTKDLA  431

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPKV+RE YLNTEEFIDAVAQ LR KI  PA+
Sbjct  432  LLIHGPKVTREFYLNTEEFIDAVAQQLREKIQIPAV  467



>ref|XP_010033298.1| PREDICTED: isocitrate dehydrogenase [NADP] [Eucalyptus grandis]
 gb|KCW52907.1| hypothetical protein EUGRSUZ_J02223 [Eucalyptus grandis]
Length=490

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD N  L+DFV KLEAACIETVE+GKMTKDLA
Sbjct  394  LHQKGQETSTNSIASIFAWTRGLQHRAKLDNNDKLIDFVHKLEAACIETVEAGKMTKDLA  453

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGPKV+RE YLNTEEFIDAVAQNL +K+  PA+
Sbjct  454  ILIHGPKVTREFYLNTEEFIDAVAQNLETKLRKPAV  489



>ref|NP_001053269.1| Os04g0508200 [Oryza sativa Japonica Group]
 dbj|BAF15183.1| Os04g0508200 [Oryza sativa Japonica Group]
 dbj|BAG91739.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLE+ACIETVESGKMTKDLA
Sbjct  382  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFTKKLESACIETVESGKMTKDLA  441

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            LL HGPKV+RE YLNTEEFIDAVAQ LR KI  PA+ 
Sbjct  442  LLIHGPKVTREFYLNTEEFIDAVAQQLREKIQIPAVV  478



>ref|XP_004142794.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cucumis sativus]
Length=480

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFVQKLEA+CIETVESGKMTKDLA
Sbjct  382  LHQKGQETSTNSIASIFAWTRGLEHRAKLDQNHRLLDFVQKLEASCIETVESGKMTKDLA  441

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA*N  283
            LL HGPKVSRE YLNTEEFIDAVA NL  K+  P +  N
Sbjct  442  LLIHGPKVSREFYLNTEEFIDAVAHNLVVKLQRPPVTAN  480



>ref|XP_004156686.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cucumis sativus]
 gb|KGN51373.1| hypothetical protein Csa_5G523180 [Cucumis sativus]
Length=481

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFVQKLEA+CIETVESGKMTKDLA
Sbjct  383  LHQKGQETSTNSIASIFAWTRGLEHRAKLDQNHRLLDFVQKLEASCIETVESGKMTKDLA  442

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA*N  283
            LL HGPKVSRE YLNTEEFIDAVA NL  K+  P +  N
Sbjct  443  LLIHGPKVSREFYLNTEEFIDAVAHNLVVKLQRPPVTAN  481



>ref|XP_010940160.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X2 [Elaeis 
guineensis]
Length=487

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQETSTNSIASIFAWTRGL HRA+LD++  L+DFVQKLE+AC+ETVESGKMTKDLA
Sbjct  391  LYQKGQETSTNSIASIFAWTRGLAHRAKLDKHDRLLDFVQKLESACVETVESGKMTKDLA  450

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPK+SRELYLNTEEF+DAVAQNL+ KI S A+
Sbjct  451  LLIHGPKLSRELYLNTEEFLDAVAQNLKEKIQSAAV  486



>ref|XP_010940159.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Elaeis 
guineensis]
Length=489

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQETSTNSIASIFAWTRGL HRA+LD++  L+DFVQKLE+AC+ETVESGKMTKDLA
Sbjct  393  LYQKGQETSTNSIASIFAWTRGLAHRAKLDKHDRLLDFVQKLESACVETVESGKMTKDLA  452

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPK+SRELYLNTEEF+DAVAQNL+ KI S A+
Sbjct  453  LLIHGPKLSRELYLNTEEFLDAVAQNLKEKIQSAAV  488



>tpg|DAA37007.1| TPA: hypothetical protein ZEAMMB73_112049 [Zea mays]
Length=322

 Score =   159 bits (403),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N +L+DF  KLE+AC+ETVESGKMTKDLA
Sbjct  226  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDSLLDFTHKLESACVETVESGKMTKDLA  285

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSP  298
            LL HGPKV+RE YL+TEEFIDAVAQ LR KI  P
Sbjct  286  LLIHGPKVTREFYLSTEEFIDAVAQQLRGKIQLP  319



>ref|XP_008812172.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Phoenix dactylifera]
Length=493

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQETSTNSIASIFAWTRGL HRA+LD++  L+DFVQKLE+ACIETVESGKMTKDLA
Sbjct  394  LYQKGQETSTNSIASIFAWTRGLAHRAKLDKHDRLLDFVQKLESACIETVESGKMTKDLA  453

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPK+SRELYLNTEEF+DAVAQNL+ KI
Sbjct  454  LLVHGPKLSRELYLNTEEFLDAVAQNLKEKI  484



>ref|XP_003581407.1| PREDICTED: isocitrate dehydrogenase [NADP] [Brachypodium distachyon]
Length=481

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLE+AC+ETVESGKMTKDLA
Sbjct  385  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFTQKLESACVETVESGKMTKDLA  444

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL+HGPKV+RE YL+TEEFIDAVAQ L+ KI  PA
Sbjct  445  LLSHGPKVTREFYLSTEEFIDAVAQQLQEKIKLPA  479



>gb|KDO55215.1| hypothetical protein CISIN_1g0090411mg, partial [Citrus sinensis]
Length=398

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+ FVQKLEAACIE VE+GKMTKDLA
Sbjct  302  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNERLLHFVQKLEAACIEAVETGKMTKDLA  361

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKVSRE YLNTEEFIDAVA NL +K+  PA+ 
Sbjct  362  ILVHGPKVSREFYLNTEEFIDAVATNLGAKLREPAMV  398



>ref|XP_009390155.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=502

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQ+GQETSTNSIASIFAWTRGL HRAELD+++ L DFVQKLE+ACIETVESGKMTKDLA
Sbjct  406  LHQRGQETSTNSIASIFAWTRGLEHRAELDKHEKLQDFVQKLESACIETVESGKMTKDLA  465

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP+VSRE YLNTEEF+DAVAQNL+ KI
Sbjct  466  LLIHGPRVSREFYLNTEEFVDAVAQNLKEKI  496



>ref|XP_008379224.1| PREDICTED: isocitrate dehydrogenase [NADP] [Malus domestica]
Length=484

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAACIETVE GKMTKDLA
Sbjct  388  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFVRKLEAACIETVEGGKMTKDLA  447

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSRE YLNTEEFIDAVA+N+  K+  PA
Sbjct  448  LLIHGPKVSREYYLNTEEFIDAVAKNVEEKLLEPA  482



>ref|XP_009334109.1| PREDICTED: isocitrate dehydrogenase [NADP] [Pyrus x bretschneideri]
Length=484

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAACIETVE GKMTKDLA
Sbjct  388  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFVRKLEAACIETVEGGKMTKDLA  447

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSRE YLNTEEFIDAVA+N+  K+  PA
Sbjct  448  LLIHGPKVSREYYLNTEEFIDAVAKNVEEKLLEPA  482



>ref|XP_002524672.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
 gb|EEF37691.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
Length=470

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            + QKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV KLE +CIETVE+GKMTKDLA
Sbjct  374  LFQKGQETSTNSIASIFAWTRGLEHRAKLDKNEGLLDFVHKLEGSCIETVEAGKMTKDLA  433

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKVSRE YLNTEEFIDAVAQNL SK+  PA+ 
Sbjct  434  ILIHGPKVSREFYLNTEEFIDAVAQNLESKLREPAVV  470



>ref|XP_003618179.1| Isocitrate dehydrogenase-like protein [Medicago truncatula]
 gb|AES74397.1| NADP-dependent isocitrate dehydrogenase [Medicago truncatula]
Length=482

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DF  KLEAAC+ETVESGKMTKDLAL
Sbjct  387  HQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLLDFADKLEAACVETVESGKMTKDLAL  446

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L HGPKVSRE YLNTEEFIDAVA NL  K+  PA
Sbjct  447  LIHGPKVSREFYLNTEEFIDAVASNLERKLREPA  480



>gb|KDP45313.1| hypothetical protein JCGZ_09562 [Jatropha curcas]
Length=476

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV KLEA+CIETVE GKMTKDLA
Sbjct  380  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNERLLDFVHKLEASCIETVEGGKMTKDLA  439

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKVSRE YLNTE+FIDAV QNL +K+  PA+ 
Sbjct  440  ILIHGPKVSREFYLNTEDFIDAVEQNLDAKLKEPAVV  476



>ref|NP_001130558.1| uncharacterized protein LOC100191657 [Zea mays]
 gb|ACF78822.1| unknown [Zea mays]
Length=400

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N +L+DF  KLE+AC+ETVESGKMTKDLA
Sbjct  304  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDSLLDFTHKLESACVETVESGKMTKDLA  363

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSP  298
            LL HGPKV+RE YL+TEEFIDAVAQ LR KI  P
Sbjct  364  LLIHGPKVTREFYLSTEEFIDAVAQQLRGKIQLP  397



>ref|XP_009375130.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Pyrus x bretschneideri]
Length=483

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAACIETVE GKMTKDLA
Sbjct  387  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFVRKLEAACIETVEGGKMTKDLA  446

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSRE YLNTEEFIDAVA+N++ K+  P 
Sbjct  447  LLIHGPKVSREYYLNTEEFIDAVAKNVKKKLLEPV  481



>gb|KDO55214.1| hypothetical protein CISIN_1g0090411mg, partial [Citrus sinensis]
Length=453

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+ FVQKLEAACIE VE+GKMTKDLA
Sbjct  302  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNERLLHFVQKLEAACIEAVETGKMTKDLA  361

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKVSRE YLNTEEFIDAVA NL +K+  PA+ 
Sbjct  362  ILVHGPKVSREFYLNTEEFIDAVATNLGAKLREPAMV  398



>ref|XP_003525669.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Glycine max]
Length=470

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            HQKGQETSTNSIASIFAWTRGL HRA+LD N+ L DF Q LEAAC+ETVESGKMTKDLA+
Sbjct  375  HQKGQETSTNSIASIFAWTRGLEHRAKLDNNEKLRDFTQNLEAACVETVESGKMTKDLAI  434

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            L HGPKVSRE YLNTEEFIDAVA NL+ K+  PA+ 
Sbjct  435  LIHGPKVSREFYLNTEEFIDAVAHNLQKKLREPAVV  470



>ref|XP_007151010.1| hypothetical protein PHAVU_004G011200g [Phaseolus vulgaris]
 gb|ESW23004.1| hypothetical protein PHAVU_004G011200g [Phaseolus vulgaris]
Length=475

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASI+AWTRGL HRA+LD N+ L+DF +KLEAAC+ETVESGKMTKDLA
Sbjct  379  LHQKGQETSTNSIASIYAWTRGLEHRAKLDNNEKLLDFTKKLEAACVETVESGKMTKDLA  438

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGPKVSRE YLNTEEFIDAVA NL +K+  P +
Sbjct  439  ILVHGPKVSREFYLNTEEFIDAVAHNLETKLQDPVV  474



>ref|XP_010688692.1| PREDICTED: isocitrate dehydrogenase [NADP] [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            HQKGQETSTNSIASIFAWTRGL HRA+LDEN++L+DFVQKLE+ACI+TVESGKMTKDLAL
Sbjct  371  HQKGQETSTNSIASIFAWTRGLEHRAKLDENQSLLDFVQKLESACIDTVESGKMTKDLAL  430

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L HGPKV+RE YLNTE+FIDAVA NL + I  P+
Sbjct  431  LVHGPKVTREQYLNTEDFIDAVANNLIANIRVPS  464



>ref|XP_002446765.1| hypothetical protein SORBIDRAFT_06g022050 [Sorghum bicolor]
 gb|EES11093.1| hypothetical protein SORBIDRAFT_06g022050 [Sorghum bicolor]
Length=487

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N +L+DF  KLE+AC+ETVESGKMTKDLA
Sbjct  391  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDSLLDFTHKLESACVETVESGKMTKDLA  450

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            LL HGPKV+RE YL+TEEFIDAVAQ LR KI  P + 
Sbjct  451  LLIHGPKVTREFYLSTEEFIDAVAQQLRGKIQLPTMV  487



>ref|XP_004976171.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Setaria italica]
Length=493

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +H+KGQETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLE+ACIETVESGKMTKDLA
Sbjct  395  LHEKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFTQKLESACIETVESGKMTKDLA  454

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+RE YL+TEEFI+AVAQ LR KI  PA
Sbjct  455  LLIHGPKVTREFYLSTEEFINAVAQQLRGKIQEPA  489



>ref|XP_004489246.1| PREDICTED: LOW QUALITY PROTEIN: isocitrate dehydrogenase [NADP], 
chloroplastic/mitochondrial-like [Cicer arietinum]
Length=471

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            HQKGQETSTNSIASIFAWTRGL HRA+LD N+ L DF  KLEAAC+ETVESGKMTKDLA+
Sbjct  376  HQKGQETSTNSIASIFAWTRGLEHRAKLDNNEKLQDFAHKLEAACVETVESGKMTKDLAI  435

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            L HGPKVSRE YLNTEEFIDAVA NL+ K+  PA+ 
Sbjct  436  LVHGPKVSREFYLNTEEFIDAVAGNLQRKLQXPAMV  471



>ref|XP_006470285.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=533

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+ FVQKLEAACIE VE+GKMTKDLA
Sbjct  395  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNERLLHFVQKLEAACIEAVETGKMTKDLA  454

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGPKVSRE YLNTEEFIDAVA NL +K+  PA+
Sbjct  455  ILVHGPKVSREFYLNTEEFIDAVATNLGAKLREPAM  490



>ref|XP_006653587.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Oryza brachyantha]
Length=476

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLE+ACIETVESGKMTKDLA
Sbjct  380  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFTKKLESACIETVESGKMTKDLA  439

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R+ YL+TEEFIDAVAQ LR KI  PA
Sbjct  440  LLIHGPKVTRDYYLSTEEFIDAVAQQLREKIQIPA  474



>ref|XP_009377196.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Pyrus x bretschneideri]
Length=483

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAACIETVE GKMTKDLA
Sbjct  387  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFVRKLEAACIETVEGGKMTKDLA  446

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSRE YLNTEEFIDAVA+N+  K+  P 
Sbjct  447  LLIHGPKVSREYYLNTEEFIDAVAKNVEKKLLEPV  481



>gb|EYU34732.1| hypothetical protein MIMGU_mgv1a005695mg [Erythranthe guttata]
Length=474

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            H+KGQETSTNSIASIFAWTRGL HRA+LD N+ L++F  KLEAAC+ETVESGKMTKDLA+
Sbjct  379  HEKGQETSTNSIASIFAWTRGLEHRAKLDGNEKLLEFAHKLEAACMETVESGKMTKDLAI  438

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            L HGPKVSRE YLNTEEFIDAVA NL SK+ +PAL
Sbjct  439  LIHGPKVSREFYLNTEEFIDAVASNLESKLVAPAL  473



>ref|XP_006841065.1| hypothetical protein AMTR_s00085p00178400 [Amborella trichopoda]
 gb|ERN02740.1| hypothetical protein AMTR_s00085p00178400 [Amborella trichopoda]
Length=500

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQ+GQETSTNSIASIFAWTRGL HRA+LD+N  L+ F  KLEAACIETVESGKMTKDLA
Sbjct  404  LHQRGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLGFAHKLEAACIETVESGKMTKDLA  463

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL+HGPKVS E YLNTEEFIDAVAQ+L+S+I  PA+
Sbjct  464  LLSHGPKVSGEFYLNTEEFIDAVAQSLQSRISIPAV  499



>ref|XP_010108798.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
 gb|EXC20313.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
Length=484

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV KLEA+CIETVE+GKMTKDLA
Sbjct  388  LHQKGQETSTNSIASIFAWTRGLEHRAKLDQNDRLLDFVHKLEASCIETVETGKMTKDLA  447

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HG KV+RE YLNT+EFIDAVAQNL +K+  PA+A
Sbjct  448  ILIHGSKVTREFYLNTQEFIDAVAQNLIAKLLEPAVA  484



>dbj|BAC77065.1| NADP-specific isocitrate dehydrogenase [Lupinus albus]
Length=485

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD N+ L DF  KLEAAC+ETVESGKMTKDLA
Sbjct  388  LHQKGQETSTNSIASIFAWTRGLEHRAKLDNNEKLRDFTYKLEAACVETVESGKMTKDLA  447

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIG-SPALA  289
            LL HGPKVSRE YLNTEEFIDAVA NL+ K+  +PAL 
Sbjct  448  LLIHGPKVSREYYLNTEEFIDAVAHNLKRKLQETPALV  485



>ref|XP_004306353.2| PREDICTED: isocitrate dehydrogenase [NADP] [Fragaria vesca subsp. 
vesca]
Length=482

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +H+KGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAACIETVE+G MTKDLA
Sbjct  386  LHEKGQETSTNSIASIFAWTRGLEHRAKLDKNDKLLDFVRKLEAACIETVEAGNMTKDLA  445

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPKVSRE YLNT+EFID VA+N+  K+  PAL
Sbjct  446  LLIHGPKVSREFYLNTQEFIDTVAKNVEQKLREPAL  481



>emb|CDX78585.1| BnaA03g04970D [Brassica napus]
Length=485

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  394  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  453

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR++YLNTEEFIDAVA NL+SK+
Sbjct  454  LLVHGPKVSRDVYLNTEEFIDAVASNLQSKL  484



>emb|CBX54595.1| putative isocitrate dehydrogenase [Quercus pubescens]
 emb|CBX54596.1| putative isocitrate dehydrogenase [Quercus frainetto]
Length=100

 Score =   148 bits (374),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  14   VHQKGGETSTNSIASIFAWTRGLAHRAKLDSNARLLDFTEKLEAACVGTVESGKMTKDLA  73

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNL  319
            LL HGPKV+R  YLNTEEFIDAVA+ L
Sbjct  74   LLIHGPKVTRSQYLNTEEFIDAVAEEL  100



>emb|CBX54593.1| putative isocitrate dehydrogenase [Quercus robur]
 emb|CBX54594.1| putative isocitrate dehydrogenase [Quercus petraea]
Length=103

 Score =   148 bits (374),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  17   VHQKGGETSTNSIASIFAWTRGLAHRAKLDSNARLLDFTEKLEAACVGTVESGKMTKDLA  76

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNL  319
            LL HGPKV+R  YLNTEEFIDAVA+ L
Sbjct  77   LLIHGPKVTRSQYLNTEEFIDAVAEEL  103



>emb|CCI55358.1| PH01B035L11.3 [Phyllostachys edulis]
Length=468

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD N  L+DF QKLE+AC+ETVESGKMTKDLA
Sbjct  372  LHQKGQETSTNSIASIFAWTRGLEHRAKLDNNGRLLDFTQKLESACVETVESGKMTKDLA  431

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV+RE YL+TE+FIDAVAQ LR KI
Sbjct  432  LLIHGPKVTREFYLSTEKFIDAVAQQLREKI  462



>ref|XP_008230571.1| PREDICTED: isocitrate dehydrogenase [NADP] [Prunus mume]
Length=482

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQ GQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAACIETVE+GKMTKDLA
Sbjct  386  LHQNGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFVRKLEAACIETVEAGKMTKDLA  445

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HG KVSRE YLNTEEFIDAVA+N+  K+  PA+ 
Sbjct  446  ILTHGSKVSREFYLNTEEFIDAVAKNVEQKLLEPAVV  482



>ref|XP_007215326.1| hypothetical protein PRUPE_ppa005200mg [Prunus persica]
 gb|EMJ16525.1| hypothetical protein PRUPE_ppa005200mg [Prunus persica]
Length=472

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQ GQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAACIETVE+GKMTKDLA
Sbjct  376  LHQNGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFVRKLEAACIETVEAGKMTKDLA  435

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HG KVSRE YLNTEEFIDAVA+N+  K+  PA+ 
Sbjct  436  ILTHGSKVSREFYLNTEEFIDAVAKNVEQKLLEPAVV  472



>gb|AFK44087.1| unknown [Medicago truncatula]
Length=157

 Score =   149 bits (377),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VESGKMTKDLA
Sbjct  65   VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNATLLDFTEKLEAACIGVVESGKMTKDLA  124

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SRE YLNTEEFIDAVA +L++KI
Sbjct  125  LILHGSKLSREHYLNTEEFIDAVAADLKTKI  155



>emb|CDX70573.1| BnaC03g06570D [Brassica napus]
Length=483

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  392  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  451

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR++YLNTEEFIDAVA NL+S++
Sbjct  452  LLVHGPKVSRDVYLNTEEFIDAVASNLQSQL  482



>ref|NP_001042583.1| Os01g0248400 [Oryza sativa Japonica Group]
 gb|AAD38292.1|AC007789_18 NADP-dependent isocitrate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAD81495.1| putative NADP-dependent isocitrate dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAF04497.1| Os01g0248400 [Oryza sativa Japonica Group]
 dbj|BAG93136.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWT GLGHRA+LD+NK L+DFVQKLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTTGLGHRAKLDDNKRLLDFVQKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP VSR+ YLNT EFIDAVA++LR+++
Sbjct  378  LLVHGPNVSRDKYLNTVEFIDAVAEDLRTRL  408



>gb|EEC70311.1| hypothetical protein OsI_01162 [Oryza sativa Indica Group]
 gb|EEE54232.1| hypothetical protein OsJ_01099 [Oryza sativa Japonica Group]
Length=439

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWT GLGHRA+LD+NK L+DFVQKLEAAC+ TVESGKMTKDLA
Sbjct  343  VHQKGGETSTNSIASIFAWTTGLGHRAKLDDNKRLLDFVQKLEAACVGTVESGKMTKDLA  402

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP VSR+ YLNT EFIDAVA++LR+++
Sbjct  403  LLVHGPNVSRDKYLNTVEFIDAVAEDLRTRL  433



>ref|XP_004232313.1| PREDICTED: isocitrate dehydrogenase [NADP] [Solanum lycopersicum]
Length=483

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNS+ASIFAWTRGLGHRA+LD N+ L++FV  LEA+CI T+ESGKMTKDLA
Sbjct  387  LHQKGQETSTNSVASIFAWTRGLGHRAQLDGNQKLLEFVHTLEASCIGTIESGKMTKDLA  446

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            +L HGPKVSRE YLNTEEFIDAVAQ L+ K+ + A
Sbjct  447  ILAHGPKVSREFYLNTEEFIDAVAQKLQEKLHASA  481



>emb|CDP01688.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPRLLDFTEKLEAACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HGPK+SRE YLNTEEFIDAVA +LR+++   A
Sbjct  380  LIIHGPKLSRERYLNTEEFIDAVADDLRARLSCKA  414



>ref|XP_009131418.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
[Brassica rapa]
Length=483

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKG+ETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  392  LHQKGEETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  451

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR++YLNTEEFIDAVA NL+S++
Sbjct  452  LLVHGPKVSRDVYLNTEEFIDAVASNLQSQL  482



>ref|XP_008798438.1| PREDICTED: LOW QUALITY PROTEIN: isocitrate dehydrogenase [NADP]-like 
[Phoenix dactylifera]
Length=411

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LDEN  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDENARLLDFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            +LNHGPKV+R+ +LNTEEFIDAVA+ LR+++
Sbjct  378  ILNHGPKVTRDHWLNTEEFIDAVAEELRARL  408



>ref|XP_006399971.1| hypothetical protein EUTSA_v10013384mg [Eutrema salsugineum]
 gb|ESQ41424.1| hypothetical protein EUTSA_v10013384mg [Eutrema salsugineum]
Length=488

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV+KLE++C+ TVE+GKMTKDLA
Sbjct  397  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLLDFVKKLESSCVNTVETGKMTKDLA  456

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR+ YLNTEEFID+VA NLRS++
Sbjct  457  LLVHGPKVSRDSYLNTEEFIDSVASNLRSQL  487



>ref|XP_009625432.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana tomentosiformis]
Length=482

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNS+ASIFAW RGLGHRA+LD N+ L +FV  LEAAC+ T+ESGKMTKDLA
Sbjct  386  LHQKGQETSTNSVASIFAWARGLGHRAQLDGNQKLSEFVHSLEAACVGTIESGKMTKDLA  445

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGPKVSRE YLNTEEFIDAVAQ L+ K+G+ A+
Sbjct  446  ILVHGPKVSREHYLNTEEFIDAVAQKLQEKLGACAV  481



>ref|XP_009768205.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana sylvestris]
Length=482

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNS+ASIFAWTRGLGHRA+LD N+ L +FV  LEAAC+ T+ESGKMTKDLA
Sbjct  386  LHQKGQETSTNSVASIFAWTRGLGHRAQLDGNQKLTEFVHALEAACVGTIESGKMTKDLA  445

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGPKVSRE YLNTEEFIDAVA  L+ K+G+ A+
Sbjct  446  ILVHGPKVSREHYLNTEEFIDAVALKLQEKLGASAI  481



>emb|CAA65773.1| isocitrate dehydrogenase (NADP+) [Eucalyptus globulus subsp. 
bicostata]
Length=219

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  123  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNAKLLDFAEKLEAACIGTVESGKMTKDLA  182

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPK +R+ YLNTEEFIDAVA  L++++   +L
Sbjct  183  LLIHGPKFTRDQYLNTEEFIDAVAVELKARLSCQSL  218



>ref|XP_011047331.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
Length=504

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQETSTNSIASIFAWTRGL HRA+LD N+ L+DFV KLEA+CI TVE+G MTKDLA
Sbjct  408  LNQKGQETSTNSIASIFAWTRGLEHRAKLDNNERLLDFVLKLEASCIGTVEAGAMTKDLA  467

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGP+VSRE YLNTEEFIDAVA+NL +K+  PA+
Sbjct  468  ILTHGPRVSREFYLNTEEFIDAVARNLETKLQEPAV  503



>ref|XP_006643991.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Oryza brachyantha]
Length=414

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWT GL HRA+LD+NK L+DFVQKLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTTGLAHRAKLDDNKRLLDFVQKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP VSR+ YLNT EFIDAVA++LR+++
Sbjct  378  LLVHGPNVSRDKYLNTVEFIDAVAEDLRTRL  408



>ref|XP_002298528.2| hypothetical protein POPTR_0001s35080g [Populus trichocarpa]
 gb|EEE83333.2| hypothetical protein POPTR_0001s35080g [Populus trichocarpa]
Length=503

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQETSTNSIASIFAWTRGL HRA+LD N+ L+DF  KLEA+CI TVE+G+MTKDLA
Sbjct  407  LYQKGQETSTNSIASIFAWTRGLEHRAKLDNNERLLDFALKLEASCIGTVEAGEMTKDLA  466

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGP+VSRE YLNTEEFIDAVA+NL +K+  PA+
Sbjct  467  ILTHGPRVSREFYLNTEEFIDAVARNLETKLQEPAV  502



>ref|XP_010551913.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=488

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L DFV+KLE +CI+TVE+GKMTKDLA
Sbjct  392  LHQKGQETSTNSIASIFAWTRGLAHRAKLDKNEKLHDFVRKLETSCIDTVEAGKMTKDLA  451

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            +L HGPKV+R+LY NTEEFIDAVA NL+ K+
Sbjct  452  ILVHGPKVTRDLYFNTEEFIDAVASNLQGKL  482



>ref|XP_006287601.1| hypothetical protein CARUB_v10000812mg [Capsella rubella]
 gb|EOA20499.1| hypothetical protein CARUB_v10000812mg [Capsella rubella]
Length=492

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  396  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  455

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR+L+LNTEEFIDAVA  L++++
Sbjct  456  LLVHGPKVSRDLFLNTEEFIDAVASKLKTQL  486



>ref|XP_002873679.1| hypothetical protein ARALYDRAFT_488300 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49938.1| hypothetical protein ARALYDRAFT_488300 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  396  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  455

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR+L+LNTEEFIDAVA  L++++
Sbjct  456  LLIHGPKVSRDLFLNTEEFIDAVASKLKTQL  486



>emb|CAB87626.1| isocitrate dehydrogenase-like protein [Arabidopsis thaliana]
Length=465

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  369  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  428

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR+L+LNTEEFIDAVA  L+++ 
Sbjct  429  LLIHGPKVSRDLFLNTEEFIDAVASKLKTQF  459



>gb|ABK24873.1| unknown [Picea sitchensis]
Length=490

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VH+KG ETSTNSIASIFAWTRGL HRA+LD N+ L+DFV K+E+AC+ETVESGKMTKDLA
Sbjct  392  VHEKGGETSTNSIASIFAWTRGLEHRAKLDNNEKLLDFVHKMESACVETVESGKMTKDLA  451

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            +L HG KVSR LYLNTEEFIDAVA+NL SKI S
Sbjct  452  ILVHGAKVSRNLYLNTEEFIDAVAENLYSKILS  484



>ref|XP_011086318.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X2 [Sesamum 
indicum]
Length=352

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI +VESGKMTKDLA
Sbjct  256  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNSRLLDFTEKLEAACIASVESGKMTKDLA  315

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSR+ YLNTEEFIDAVA+ LR ++   A
Sbjct  316  LLIHGPKVSRDQYLNTEEFIDAVAEELRGRLPKKA  350



>ref|NP_196963.2| isocitrate dehydrogenase [Arabidopsis thaliana]
 sp|Q8LPJ5.1|ICDHP_ARATH RecName: Full=Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20534.1| isocitrate dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AAN15595.1| isocitrate dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AED92051.1| isocitrate dehydrogenase [Arabidopsis thaliana]
Length=485

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  389  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  448

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR+L+LNTEEFIDAVA  L+++ 
Sbjct  449  LLIHGPKVSRDLFLNTEEFIDAVASKLKTQF  479



>dbj|BAK01228.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=296

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+ GL HRA+LD+NK L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  200  VHQKGGETSTNSIASIFAWSTGLAHRAKLDDNKRLLDFTQKLEAACVGTVESGKMTKDLA  259

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGP VSR+ YLNT EFIDAVA+ LR+++ + +
Sbjct  260  LLIHGPTVSRDKYLNTMEFIDAVAEELRTRLSAKS  294



>emb|CAA65504.1| isocitrate dehydrogenase (NADP+) [Nicotiana tabacum]
Length=470

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNS+ASIFAW RGLGHRA+LD N+ L +FV  LEAAC+ T+ESGKMTKDLA
Sbjct  374  LHQKGQETSTNSVASIFAWARGLGHRAQLDGNQKLSEFVHALEAACVGTIESGKMTKDLA  433

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGPKVSRE YLNTEEFID VAQ L+ K+G+ A+
Sbjct  434  ILVHGPKVSREHYLNTEEFIDPVAQKLQEKLGACAV  469



>emb|CAA65503.1| isocitrate dehydrogenase (NADP+) [Nicotiana tabacum]
Length=482

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNS+ASIFAW RGLGHRA+LD N+ L +FV  LEAAC+ T+ESGKMTKDLA
Sbjct  386  LHQKGQETSTNSVASIFAWARGLGHRAQLDGNQKLSEFVHALEAACVGTIESGKMTKDLA  445

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            +L HGPKVSRE YLNTEEFID VAQ L+ K+G+ A+
Sbjct  446  ILVHGPKVSREHYLNTEEFIDPVAQKLQEKLGACAV  481



>ref|XP_011086317.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Sesamum 
indicum]
Length=416

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI +VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNSRLLDFTEKLEAACIASVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSR+ YLNTEEFIDAVA+ LR ++   A
Sbjct  380  LLIHGPKVSRDQYLNTEEFIDAVAEELRGRLPKKA  414



>gb|KHG29051.1| Isocitrate dehydrogenase [NADP], chloroplastic [Gossypium arboreum]
Length=481

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQETSTNSIASIFAWTRGL HRA+LD+N  L+DFV KLEAACIETVE+GKMTKDLA
Sbjct  385  LYQKGQETSTNSIASIFAWTRGLEHRAKLDKNGRLLDFVHKLEAACIETVEAGKMTKDLA  444

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKVSRE YL T +F+DAVA NL  K+  P + 
Sbjct  445  ILIHGPKVSREFYLTTGDFVDAVAINLERKLQQPTMC  481



>gb|AIZ74341.1| isocitrate dehydrogenase [Pinus massoniana]
Length=490

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N+ L+DFV KLE +C+ETVESGKMTKDLA
Sbjct  392  VHQKGGETSTNSIASIFAWTRGLEHRAKLDNNEKLLDFVHKLEDSCVETVESGKMTKDLA  451

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            +L HG KVSR  YLNTEEFIDAVA+NL SKI S
Sbjct  452  ILVHGAKVSRNFYLNTEEFIDAVAENLNSKILS  484



>ref|XP_010092444.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
 gb|EXB51210.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
Length=406

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L+DF QKLEAAC+ TVESG+MTKDLA
Sbjct  310  VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNARLLDFTQKLEAACVGTVESGRMTKDLA  369

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPK++R  YLNTEEFIDAVA+ LR ++   A
Sbjct  370  LLIHGPKITRSQYLNTEEFIDAVAEELRVRLSCKA  404



>emb|CDY68004.1| BnaAnng25850D [Brassica napus]
Length=166

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  65   VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNSKLLEFTEKLEAACVGTVESGKMTKDLA  124

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRS  313
            L+ HG K+SR+ YLNTEEFIDAVA +L++
Sbjct  125  LIIHGSKLSRDTYLNTEEFIDAVADDLKT  153



>gb|KJB33783.1| hypothetical protein B456_006G032000 [Gossypium raimondii]
 gb|KJB33784.1| hypothetical protein B456_006G032000 [Gossypium raimondii]
 gb|KJB33785.1| hypothetical protein B456_006G032000 [Gossypium raimondii]
Length=468

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV KLEAACIETVE+GKMTKDLA
Sbjct  372  LYQKGQETSTNSIASIFAWTRGLEHRAKLDKNERLLDFVHKLEAACIETVEAGKMTKDLA  431

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPALA  289
            +L HGPKVS+E YL T +F+DAVA NL  K+  P + 
Sbjct  432  ILIHGPKVSKEFYLTTGDFVDAVAINLERKLQQPTMC  468



>emb|CDP02088.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            ++QKGQ+TSTNSIASIFAWTRGL HRA+LDENK L+DFV  LEAACI TVESGKMTKDLA
Sbjct  384  LYQKGQDTSTNSIASIFAWTRGLEHRAKLDENKKLLDFVHNLEAACIGTVESGKMTKDLA  443

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            +L HGPKVSRE YL+T EFI AVA +L+ K+ +PA
Sbjct  444  ILIHGPKVSREFYLDTGEFIGAVATHLQKKLQAPA  478



>gb|KHN21348.1| Isocitrate dehydrogenase [NADP], chloroplastic [Glycine soja]
Length=416

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVE GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEAACIGTVELGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGPKVSR  YLNTEEFIDAVA+ LR+++ S
Sbjct  380  LLVHGPKVSRSQYLNTEEFIDAVAEELRTRLSS  412



>gb|ACU21054.1| unknown [Glycine max]
Length=416

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVE GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEAACIGTVELGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGPKVSR  YLNTEEFIDAVA+ LR+++ S
Sbjct  380  LLVHGPKVSRSQYLNTEEFIDAVAEELRTRLSS  412



>ref|XP_010420101.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
[Camelina sativa]
Length=492

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  396  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  455

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPK SR+ YLNTEEFIDAVA  L++++
Sbjct  456  LLIHGPKASRDSYLNTEEFIDAVASKLKTQL  486



>gb|EMT15852.1| Isocitrate dehydrogenase (NADP) [Aegilops tauschii]
Length=381

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+ GL HRA+LD+NK L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  285  VHQKGGETSTNSIASIFAWSTGLAHRAKLDDNKRLLDFTQKLEAACVGTVESGKMTKDLA  344

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGP VSR+ YLNT EFIDAVA+ LR+++ +
Sbjct  345  LLIHGPTVSRDKYLNTMEFIDAVAEELRTRLSA  377



>ref|XP_010453584.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=490

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  394  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  453

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPK SR+ YLNTEEFIDAVA  L++++
Sbjct  454  LLIHGPKASRDSYLNTEEFIDAVASKLKTQL  484



>gb|EMS45309.1| Isocitrate dehydrogenase [NADP] [Triticum urartu]
Length=408

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+ GL HRA+LD+NK L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  312  VHQKGGETSTNSIASIFAWSTGLAHRAKLDDNKRLLDFTQKLEAACVGTVESGKMTKDLA  371

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGP VSR+ YLNT EFIDAVA+ LR+++ +
Sbjct  372  LLIHGPTVSRDKYLNTMEFIDAVAEELRTRLSA  404



>ref|XP_010553875.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Tarenaya 
hassleriana]
Length=410

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LDEN  L+DF +KLEA+C+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDENPRLLDFTEKLEASCVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIG  304
            L+ HG K++RE YLNTEEFIDAVA  L+++IG
Sbjct  378  LIIHGSKLTREHYLNTEEFIDAVADELKARIG  409



>ref|XP_010693737.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Beta vulgaris 
subsp. vulgaris]
Length=416

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF  KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTSKLEAACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KV R  YLNTEEFIDAVAQ LR+++
Sbjct  380  LLVHGSKVERSQYLNTEEFIDAVAQELRARL  410



>ref|XP_008227912.1| PREDICTED: isocitrate dehydrogenase [NADP] [Prunus mume]
Length=411

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLE ACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNVKLLDFTQKLEEACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HGPK++R  YLNTEEFIDAVA+ LR+++
Sbjct  380  LIIHGPKLARNHYLNTEEFIDAVAEELRARL  410



>ref|XP_010492268.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=493

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ LMDFV+KLE++C+ TVE+GKMTKDLA
Sbjct  397  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLMDFVKKLESSCVNTVETGKMTKDLA  456

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPK SR+ YLNTEEFIDAVA  L++++
Sbjct  457  LLIHGPKASRDSYLNTEEFIDAVACKLKTQL  487



>dbj|BAJ89315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+ GL HRA+LD+NK L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSTGLAHRAKLDDNKRLLDFTQKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGP VSR+ YLNT EFIDAVA+ LR+++ +
Sbjct  378  LLIHGPTVSRDKYLNTMEFIDAVAEELRTRLSA  410



>ref|XP_004293807.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Fragaria vesca 
subsp. vesca]
Length=417

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DFV+KLEAAC+ TVESGKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWSRGLAHRAKLDSNARLLDFVEKLEAACVGTVESGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV R  YLNTE+FIDAVA+ LR ++ S A
Sbjct  381  LLIHGPKVLRSQYLNTEDFIDAVAEELRFRLFSRA  415



>emb|CAN83081.1| hypothetical protein VITISV_001328 [Vitis vinifera]
Length=398

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  302  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEAACIATVESGKMTKDLA  361

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV+R  YLNTEEFI+AVA+ LR+++
Sbjct  362  LLIHGPKVTRAQYLNTEEFIEAVAEELRARL  392



>ref|XP_007211789.1| hypothetical protein PRUPE_ppa006334mg [Prunus persica]
 gb|EMJ12988.1| hypothetical protein PRUPE_ppa006334mg [Prunus persica]
Length=417

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+D+ +KLEAAC+ TVESGKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNDRLLDYTEKLEAACVSTVESGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R  YLNTEEFIDAVA+ LR ++ S A
Sbjct  381  LLIHGPKVTRSKYLNTEEFIDAVAEELRVRLFSRA  415



>ref|XP_003616186.1| Isocitrate dehydrogenase [Medicago truncatula]
 gb|AES99144.1| NADP-dependent isocitrate dehydrogenase [Medicago truncatula]
Length=412

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNATLLDFTEKLEAACIGVVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA +L++KI +
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVAADLKTKISA  412



>emb|CDM82394.1| unnamed protein product [Triticum aestivum]
Length=414

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+ GL HRA LD+NK L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSTGLAHRARLDDNKRLLDFTQKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGP VSR+ YLNT EFIDAVA+ LR+++ +
Sbjct  378  LLIHGPTVSRDKYLNTMEFIDAVAEELRTRLSA  410



>ref|XP_002268982.1| PREDICTED: isocitrate dehydrogenase [NADP] [Vitis vinifera]
 emb|CBI24124.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEAACIATVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV+R  YLNTEEFI+AVA+ LR+++
Sbjct  380  LLIHGPKVTRAQYLNTEEFIEAVAEELRARL  410



>ref|NP_001236203.1| NADP-dependent isocitrate dehydrogenase [Glycine max]
 gb|AAC64182.1| NADP-dependent isocitrate dehydrogenase [Glycine max]
Length=416

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HR +LD N  L+DF +KLEAACI TVE GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRPKLDGNARLLDFTEKLEAACIGTVELGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGPKVSR  YLNTEEFIDAVA+ LR+++ S
Sbjct  380  LLVHGPKVSRSQYLNTEEFIDAVAEELRTRLSS  412



>ref|XP_010924867.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Elaeis 
guineensis]
 ref|XP_010924869.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Elaeis 
guineensis]
Length=392

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N +L+DF +KLEAACI TVESGKMTKDLA
Sbjct  299  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNPSLLDFTKKLEAACIGTVESGKMTKDLA  358

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV+R+ +LNTEEFI+AVA+ LR+++
Sbjct  359  LLIHGPKVTRDQWLNTEEFINAVAEELRARL  389



>gb|KJB78117.1| hypothetical protein B456_012G179300 [Gossypium raimondii]
Length=319

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  228  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFTEKLEAACIGTVESGKMTKDLA  287

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  288  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  318



>ref|XP_010260857.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Nelumbo 
nucifera]
Length=418

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LDEN  L+DF +KLEAAC+  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDENSRLLDFTEKLEAACVGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KV+R+ YLNTEEFIDAVA++LR+++
Sbjct  380  LLIHGSKVTRDHYLNTEEFIDAVAEDLRARL  410



>ref|XP_006598235.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
isoform X2 [Glycine max]
Length=390

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVE GKMTKDLA
Sbjct  294  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEAACIGTVELGKMTKDLA  353

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGPKVSR  YLNTEEFIDAVA+ L++++ S
Sbjct  354  LLVHGPKVSRYQYLNTEEFIDAVAKELQTRLSS  386



>ref|XP_010260858.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X2 [Nelumbo 
nucifera]
Length=416

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LDEN  L+DF +KLEAAC+  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDENSRLLDFTEKLEAACVGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KV+R+ YLNTEEFIDAVA++LR+++
Sbjct  380  LLIHGSKVTRDHYLNTEEFIDAVAEDLRARL  410



>ref|XP_010924866.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Elaeis 
guineensis]
Length=411

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N +L+DF +KLEAACI TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNPSLLDFTKKLEAACIGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV+R+ +LNTEEFI+AVA+ LR+++
Sbjct  378  LLIHGPKVTRDQWLNTEEFINAVAEELRARL  408



>gb|KHF98695.1| Isocitrate dehydrogenase [NADP] [Gossypium arboreum]
Length=411

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF++KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFIEKLEAACIATVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  380  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  410



>gb|ACJ11744.1| Isocitrate dehydrogenase [Gossypium hirsutum]
Length=411

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF++KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFIEKLEAACIATVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  380  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  410



>ref|XP_008225974.1| PREDICTED: isocitrate dehydrogenase [NADP] [Prunus mume]
Length=417

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N+ L+D+ +KLEAAC+ TVESGKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNERLLDYTEKLEAACVSTVESGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R  YLNTEEFIDAVA+ +R ++ S A
Sbjct  381  LLIHGPKVTRSKYLNTEEFIDAVAEEVRVRLFSRA  415



>ref|XP_009127460.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Brassica 
rapa]
 emb|CDY16428.1| BnaA02g12320D [Brassica napus]
Length=412

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNSKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVADELKTRLGVKA  412



>emb|CDY60868.1| BnaCnng36970D [Brassica napus]
Length=412

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNSKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVADELKTRLGVKA  412



>ref|XP_009105173.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Brassica 
rapa]
Length=412

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNSKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVADELKTRLGVKA  412



>emb|CDY07472.1| BnaA07g25510D [Brassica napus]
Length=412

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNSKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVADELKTRLGVKA  412



>ref|XP_011038411.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Populus 
euphratica]
Length=416

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAAC+  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAKLLDFTEKLEAACVGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIG  304
            LL HG KVSR+ YLNTEEFIDAVA+ L++++G
Sbjct  380  LLIHGSKVSRDQYLNTEEFIDAVAKELKARLG  411



>ref|XP_010230691.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Brachypodium 
distachyon]
Length=414

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+ GL HRA+LD+NK L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSTGLAHRAKLDDNKRLLDFTQKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP V+R+ YLNT EFIDAVA+ LR+++
Sbjct  378  LLIHGPNVTRDKYLNTVEFIDAVAEELRTRL  408



>gb|AAL11503.1|AF367443_1 NADP-dependent isocitrate dehydrogenase [Prunus persica]
Length=414

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLE ACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTQKLEEACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HGPK++R  YLNTEEFI+AVA+ LR+++
Sbjct  380  LIIHGPKLARNHYLNTEEFIEAVAEELRARL  410



>emb|CDY39261.1| BnaC06g27300D [Brassica napus]
Length=413

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  319  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNSKLLEFTEKLEAACVGTVESGKMTKDLA  378

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  379  LIIHGSKLSRDTYLNTEEFIDAVADELKTRLGVKA  413



>sp|Q40345.1|IDHP_MEDSA RecName: Full=Isocitrate dehydrogenase [NADP], chloroplastic; 
Short=IDH; AltName: Full=IDP; AltName: Full=NADP(+)-specific 
ICDH; AltName: Full=Oxalosuccinate decarboxylase; Flags: Precursor, 
partial [Medicago sativa]
 gb|AAA32656.1| isocitrate dehydrogenase precursor [Medicago sativa]
Length=433

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VESGKMTKDLA
Sbjct  341  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNATLLDFTEKLEAACIGVVESGKMTKDLA  400

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L++KI +
Sbjct  401  LILHGSKLSREHYLNTEEFIDAVAAELKTKISA  433



>gb|KFK25699.1| hypothetical protein AALP_AA8G147500 [Arabis alpina]
Length=490

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV+KLE++C+ TVE+GKMTKDLA
Sbjct  399  LHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKLLDFVKKLESSCVNTVETGKMTKDLA  458

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KVSR+ YL+TEEFIDAVA NL+S++
Sbjct  459  LLVHGSKVSRDSYLSTEEFIDAVASNLKSQL  489



>ref|XP_008371955.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Malus 
domestica]
Length=478

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+C+ TVESGKMTKDLA
Sbjct  382  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEASCVGTVESGKMTKDLA  441

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R  YLNTEEFIDAVA  LR ++ S A
Sbjct  442  LLIHGPKVTRSQYLNTEEFIDAVADELRVRLSSRA  476



>gb|AGV54452.1| NADPH-specific isocitrate dehydrogenase [Phaseolus vulgaris]
Length=412

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  LR KI +
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVAAELRDKISA  412



>ref|XP_007217240.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 ref|XP_007217241.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 ref|XP_007217242.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 gb|EMJ18439.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 gb|EMJ18440.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 gb|EMJ18441.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
Length=415

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLE ACI TVESGKMTKDLA
Sbjct  324  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTQKLEEACIGTVESGKMTKDLA  383

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HGPK++R  YLNTEEFI+AVA+ LR+++
Sbjct  384  LIIHGPKLARNHYLNTEEFIEAVAEELRARL  414



>ref|XP_008371954.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Malus 
domestica]
Length=480

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+C+ TVESGKMTKDLA
Sbjct  384  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEASCVGTVESGKMTKDLA  443

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R  YLNTEEFIDAVA  LR ++ S A
Sbjct  444  LLIHGPKVTRSQYLNTEEFIDAVADELRVRLSSRA  478



>gb|AAB39248.1| NADP-isocitrate dehydrogenase [Eucalyptus globulus]
Length=416

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNAKLLDFAEKLEAACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPK +R+ YLNTEEFIDAVA  L++++   +L
Sbjct  380  LLIHGPKFTRDQYLNTEEFIDAVAVELKARLSCQSL  415



>ref|XP_006391329.1| hypothetical protein EUTSA_v10018635mg [Eutrema salsugineum]
 gb|ESQ28615.1| hypothetical protein EUTSA_v10018635mg [Eutrema salsugineum]
Length=412

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNSKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVANELKARLGIKA  412



>ref|XP_007141953.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
 gb|ESW13947.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
Length=410

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  LR KI +
Sbjct  378  LILHGSKLSREHYLNTEEFIDAVAAELRDKISA  410



>gb|KJB43198.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=361

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  270  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFTEKLEAACIGTVESGKMTKDLA  329

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  330  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  360



>ref|XP_003546847.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN40171.1| Isocitrate dehydrogenase [NADP], chloroplastic [Glycine soja]
Length=416

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVE GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTEKLEAACIGTVELGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGPKVSR  YLNTEEFIDAVA+ L++++ S
Sbjct  380  LLVHGPKVSRYQYLNTEEFIDAVAKELQTRLSS  412



>ref|XP_007141952.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
 gb|ESW13946.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
Length=412

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  LR KI +
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVAAELRDKISA  412



>ref|XP_006302327.1| hypothetical protein CARUB_v10020383mg [Capsella rubella]
 gb|EOA35225.1| hypothetical protein CARUB_v10020383mg [Capsella rubella]
Length=410

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G+
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVAAELKTRLGA  410



>ref|XP_010415139.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Camelina 
sativa]
Length=412

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVAAELKARLGVKA  412



>gb|KDO46549.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=395

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  301  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLA  360

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE YLNTEEFIDAVA +LR+++   A
Sbjct  361  LIIHGSKMTREHYLNTEEFIDAVADDLRARLSGKA  395



>ref|XP_009409414.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L+DF QKLEAACI TVESG MTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDNNARLLDFTQKLEAACIGTVESGMMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV+R+ YL+TE+FIDAV   LR+K+
Sbjct  378  LLVHGPKVTRDKYLSTEQFIDAVVAELRTKL  408



>gb|KDO46543.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=413

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  319  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLA  378

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE YLNTEEFIDAVA +LR+++   A
Sbjct  379  LIIHGSKMTREHYLNTEEFIDAVADDLRARLSGKA  413



>ref|XP_004490788.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cicer arietinum]
Length=412

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF  KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNATLLDFTDKLEAACIGVVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L++KI +
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVAAELKAKISA  412



>dbj|BAE48792.1| NADP-isocitrate dehydrogenase [Codonopsis lanceolata]
Length=416

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFTEKLEAACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SRE YLNTEEFIDAVA  L++++
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVADELKARL  410



>gb|KDO46544.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=412

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE YLNTEEFIDAVA +LR+++   A
Sbjct  378  LIIHGSKMTREHYLNTEEFIDAVADDLRARLSGKA  412



>ref|XP_009363306.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Pyrus x bretschneideri]
Length=417

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+C+ TVESGKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFAEKLEASCVGTVESGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R  YLNTEEF+DAVA  LR ++ S A
Sbjct  381  LLIHGPKVTRSQYLNTEEFMDAVADQLRVRLSSRA  415



>ref|XP_002276200.2| PREDICTED: isocitrate dehydrogenase [NADP] [Vitis vinifera]
Length=486

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            +QKG ETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV KLEAACIETVESG MTKDLA+
Sbjct  388  YQKGLETSTNSIASIFAWTRGLEHRAKLDKNERLLDFVHKLEAACIETVESGNMTKDLAI  447

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSK  310
            L HGPK S+E YLNTEEFID VA NL +K
Sbjct  448  LIHGPKASKEFYLNTEEFIDTVAHNLEAK  476



>ref|XP_006432387.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 ref|XP_006432388.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45627.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45628.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|KDO46548.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=414

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE YLNTEEFIDAVA +LR+++   A
Sbjct  380  LIIHGSKMTREHYLNTEEFIDAVADDLRARLSGKA  414



>ref|XP_006432389.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 ref|XP_006432390.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 ref|XP_006432391.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45629.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45630.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45631.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|KDO46545.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
 gb|KDO46546.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
 gb|KDO46547.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=414

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE YLNTEEFIDAVA +LR+++   A
Sbjct  380  LIIHGSKMTREHYLNTEEFIDAVADDLRARLSGKA  414



>gb|KCW69443.1| hypothetical protein EUGRSUZ_F02901 [Eucalyptus grandis]
Length=408

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+CI TVESGKMTKDLA
Sbjct  312  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNAKLLDFAEKLEASCIGTVESGKMTKDLA  371

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPK +R+ YLNTEEFIDAVA  L++++   +L
Sbjct  372  LLIHGPKFTRDQYLNTEEFIDAVAAELKARLSCQSL  407



>gb|KJB43199.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=390

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  299  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFTEKLEAACIGTVESGKMTKDLA  358

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  359  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  389



>ref|XP_010062317.1| PREDICTED: isocitrate dehydrogenase [NADP] [Eucalyptus grandis]
 dbj|BAI50641.1| NADP-dependent isocitrate dehydrogenase [Eucalyptus grandis x 
Eucalyptus urophylla]
 gb|KCW69442.1| hypothetical protein EUGRSUZ_F02901 [Eucalyptus grandis]
Length=416

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+CI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNAKLLDFAEKLEASCIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPAL  292
            LL HGPK +R+ YLNTEEFIDAVA  L++++   +L
Sbjct  380  LLIHGPKFTRDQYLNTEEFIDAVAAELKARLSCQSL  415



>ref|XP_010101074.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
 gb|EXB86784.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
Length=411

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA LD N+ L+DF QKLEAACI  VESGKMTKDLA
Sbjct  319  VHQKGGETSTNSIASIFAWSRGLAHRANLDNNERLLDFTQKLEAACIGVVESGKMTKDLA  378

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SR+ YLNTEEFIDAVA  LR+K+ S
Sbjct  379  LIIHGSKLSRKHYLNTEEFIDAVAAELRAKLSS  411



>emb|CBI34891.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            +QKG ETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV KLEAACIETVESG MTKDLA+
Sbjct  442  YQKGLETSTNSIASIFAWTRGLEHRAKLDKNERLLDFVHKLEAACIETVESGNMTKDLAI  501

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSK  310
            L HGPK S+E YLNTEEFID VA NL +K
Sbjct  502  LIHGPKASKEFYLNTEEFIDTVAHNLEAK  530



>ref|XP_010511516.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Camelina 
sativa]
Length=412

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F  KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLEFTDKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVAAELKARLGVKA  412



>ref|XP_002886987.1| hypothetical protein ARALYDRAFT_475696 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63246.1| hypothetical protein ARALYDRAFT_475696 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  317  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACVGTVESGKMTKDLA  376

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA  L++++
Sbjct  377  LIIHGSKLSRDTYLNTEEFIDAVAAELKARL  407



>gb|EPS58684.1| hypothetical protein M569_16128, partial [Genlisea aurea]
Length=415

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DFV+KLEAAC+  VESGKMTKDLA
Sbjct  323  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFVEKLEAACVGVVESGKMTKDLA  382

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG ++SR+ YLNTEEFIDAVA +L+ K+ S
Sbjct  383  LIIHGSRLSRDQYLNTEEFIDAVAADLKLKLSS  415



>gb|KJB43203.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=409

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFTEKLEAACIGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  378  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  408



>gb|AAD51361.1|AF176669_1 NADP-isocitrate dehydrogenase [Citrus limon]
Length=414

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACVGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE YLNTEEFIDAVA +LR+++   A
Sbjct  380  LIIHGSKMTREHYLNTEEFIDAVADDLRARLSGKA  414



>gb|KJB43194.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
 gb|KJB43197.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=411

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFTEKLEAACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  380  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  410



>gb|KJB43202.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=413

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  322  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPKLLDFTEKLEAACIGTVESGKMTKDLA  381

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA +L++++
Sbjct  382  LIIHGSKLARDKYLNTEEFIDAVAADLKARL  412



>ref|XP_003595878.1| Isocitrate dehydrogenase [Medicago truncatula]
 gb|AES66129.1| NADP-dependent isocitrate dehydrogenase [Medicago truncatula]
 gb|AFK36970.1| unknown [Medicago truncatula]
Length=416

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW++GL HRA+LD N  L+DF +KLEAACI TVE GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSQGLAHRAKLDGNARLLDFTEKLEAACIGTVELGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSR  YLNTEEFIDAVA+ LR+++ + A
Sbjct  380  LLIHGPKVSRSHYLNTEEFIDAVAEELRTRLTTQA  414



>ref|XP_006494575.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494576.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Citrus 
sinensis]
Length=414

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACVGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE YLNTEEFIDAVA +LR+++   A
Sbjct  380  LIIHGSKMTREHYLNTEEFIDAVANDLRARLSGKA  414



>dbj|BAD94180.1| NADP specific isocitrate dehydrogenase like protein [Arabidopsis 
thaliana]
Length=90

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -1

Query  567  GQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLALLNH  388
            G ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLAL+ H
Sbjct  2    GGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACVGTVESGKMTKDLALIIH  61

Query  387  GPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            G K+SR+ YLNTEEFIDAVA  L+ ++ +
Sbjct  62   GSKLSRDTYLNTEEFIDAVAAELKERLNA  90



>emb|CAN74293.1| hypothetical protein VITISV_015982 [Vitis vinifera]
Length=486

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -1

Query  576  HQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLAL  397
            +QKG ETSTNSIASIFAWTRGL HRA+LD+N+ L+DFV KLEAACIETVESG MTKDLA+
Sbjct  388  YQKGLETSTNSIASIFAWTRGLEHRAKLDKNERLLDFVHKLEAACIETVESGNMTKDLAI  447

Query  396  LNHGPKVSRELYLNTEEFIDAVAQNLRSK  310
            L HGPK S E YLNTEEFID VA NL +K
Sbjct  448  LIHGPKASXEFYLNTEEFIDTVAHNLEAK  476



>ref|XP_007149133.1| hypothetical protein PHAVU_005G043900g [Phaseolus vulgaris]
 gb|ESW21127.1| hypothetical protein PHAVU_005G043900g [Phaseolus vulgaris]
Length=416

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQ+G ETSTNSIASIFAW+RGL HRA+LD N  L++F +KLEAACI TVE GKMTKDLA
Sbjct  320  VHQEGGETSTNSIASIFAWSRGLAHRAKLDGNARLLEFTEKLEAACIGTVELGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HGPKVSR  YLNTEEFIDAVA+ LR+++ S
Sbjct  380  LLVHGPKVSRSKYLNTEEFIDAVAEELRTRLSS  412



>gb|KDP35739.1| hypothetical protein JCGZ_10511 [Jatropha curcas]
Length=414

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF QKLEAAC+  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNARLLDFTQKLEAACVGVVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HG K+SR+ YLNTEEFIDAVA  L +++G  A
Sbjct  380  LLIHGSKLSRDQYLNTEEFIDAVAAELAARLGIKA  414



>ref|XP_001778590.1| predicted protein [Physcomitrella patens]
 gb|EDQ56620.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGLGHRA LD N  L +F Q LEAACI TVESGKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWTRGLGHRALLDGNAKLQEFAQSLEAACIATVESGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSP  298
            LL+HGP VSR  YLNTEEFIDAVA  L S++ SP
Sbjct  381  LLSHGPNVSRNNYLNTEEFIDAVADELISRL-SP  413



>ref|XP_002270617.1| PREDICTED: isocitrate dehydrogenase [NADP] [Vitis vinifera]
 emb|CAN72808.1| hypothetical protein VITISV_010484 [Vitis vinifera]
 emb|CBI27352.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNARLLDFTEKLEAACVGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KV+R+ YLNTEEFIDAVA  L +K+
Sbjct  380  LLIHGSKVTRDWYLNTEEFIDAVAAELTAKL  410



>ref|XP_011038412.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Populus 
euphratica]
Length=414

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAAC+  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAKLLDFTEKLEAACVGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HG KVSR+ YLNTEEFIDAVA+ L++++   A
Sbjct  380  LLIHGSKVSRDQYLNTEEFIDAVAKELKARLSVKA  414



>ref|XP_002305928.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE86439.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
Length=414

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNARLLDFTEKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KVSR+ YLNTEEFIDAVA+ L++++
Sbjct  380  LLIHGSKVSRDHYLNTEEFIDAVAEELKARL  410



>emb|CAD24782.1| isocitrate dehydrogenase [Arabidopsis thaliana]
Length=410

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA  L+ ++
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVAAELKERL  408



>gb|AFF18784.1| NADP-dependent isocitrate dehydrogenase, partial [Dimocarpus 
longan]
Length=93

 Score =   137 bits (345),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  567  GQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLALLNH  388
            G ETSTNSIASIFAW+RGL HRA+LD N  L+DFV+KLEAAC+ TV S KMTKDLALL H
Sbjct  1    GGETSTNSIASIFAWSRGLAHRAKLDNNDRLLDFVEKLEAACVGTVNSEKMTKDLALLIH  60

Query  387  GPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            GPKV+R  YLNTEEFIDAVA  LR+++   A
Sbjct  61   GPKVARAQYLNTEEFIDAVAAELRARLSIKA  91



>ref|NP_176768.1| NADP+-dependent isocitrate dehydrogenase [Arabidopsis thaliana]
 sp|Q9SRZ6.1|ICDHC_ARATH RecName: Full=Cytosolic isocitrate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAF06054.1|AC009513_10 Strong similarity to gb|AF155333 NADP-specific isocitrate dehydrogenase 
from Oryza sativa. ESTs gb|R30474, gb|H36712, gb|T22563, 
gb|N97293, gb|T43729, gb|Z17440, gb|Z34193, gb|Z46528, 
gb|T14072, gb|T42413, gb|AA389759, gb|N38098, gb|T43337, 
gb|N96032, gb|N96031 and gb|Z38038 come from this gene [Arabidopsis 
thaliana]
 gb|AAL31907.1|AF419575_1 At1g65930/F12P19_10 [Arabidopsis thaliana]
 gb|AAK73989.1| At1g65930/F12P19_10 [Arabidopsis thaliana]
 gb|AAM19856.1| At1g65930/F12P19_10 [Arabidopsis thaliana]
 gb|AAO00760.1| isocitrate dehydrogenase, putative [Arabidopsis thaliana]
 gb|AEE34442.1| isocitrate dehydrogenase [Arabidopsis thaliana]
Length=410

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA  L+ ++
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVAAELKERL  408



>dbj|BAC77063.1| NADP-specific isocitrate dehydrogenase [Lupinus albus]
Length=412

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF QKLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAKLLDFTQKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L++++ +
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVANELKARLSA  412



>ref|XP_004488601.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cicer arietinum]
Length=416

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW++GL HRA+LD N  L+DF +KLEA+CI TVE GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSQGLAHRAKLDGNARLLDFTEKLEASCIGTVELGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKVSR  YLNTEEFIDAVA+ LR+++ + A
Sbjct  380  LLIHGPKVSRSHYLNTEEFIDAVAEELRTRLTTKA  414



>gb|EYU33810.1| hypothetical protein MIMGU_mgv1a007171mg [Erythranthe guttata]
Length=416

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LDEN  L+DF +KLE +CI +VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDENARLLDFTEKLETSCIASVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            +L HGPKV+R+ YLNTEEFID VA+ LR ++
Sbjct  380  ILLHGPKVNRDQYLNTEEFIDEVAEELRGRL  410



>gb|KDP39826.1| hypothetical protein JCGZ_04236 [Jatropha curcas]
Length=416

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            V+QKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF  KLEAAC+ TVESGKMTKDLA
Sbjct  320  VYQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTAKLEAACVGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R  YLNTEEFID+VA+ LR ++ + A
Sbjct  380  LLIHGPKVTRAQYLNTEEFIDSVAEELRVRLSTKA  414



>gb|AFW83444.1| hypothetical protein ZEAMMB73_038317 [Zea mays]
Length=412

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF  KLEAAC+ETVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFALKLEAACVETVESGKMTKDLA  377

Query  399  LLNHG-PKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            +L HG   V+R  YLNTEEFIDAVA  LRS++G+
Sbjct  378  ILVHGSSSVTRSHYLNTEEFIDAVATELRSRLGA  411



>ref|NP_001142417.1| uncharacterized protein LOC100274592 [Zea mays]
 gb|ACF88442.1| unknown [Zea mays]
Length=412

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF  KLEAAC+ETVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFALKLEAACVETVESGKMTKDLA  377

Query  399  LLNHG-PKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            +L HG   V+R  YLNTEEFIDAVA  LRS++G+
Sbjct  378  ILVHGSSSVTRSHYLNTEEFIDAVATELRSRLGA  411



>gb|KHN39494.1| Isocitrate dehydrogenase [NADP] [Glycine soja]
Length=320

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  228  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  287

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +++ +
Sbjct  288  LILHGSKLSREHYLNTEEFIDAVAAELSARLSA  320



>gb|KGN50927.1| hypothetical protein Csa_5G346550 [Cucumis sativus]
Length=392

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N +L++F +KLE ACI+TVESGKMTKDLA
Sbjct  297  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNASLLEFTEKLELACIDTVESGKMTKDLA  356

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA+ L+S++
Sbjct  357  LILHGSKLSRDQYLNTEEFIDAVAEELKSRL  387



>ref|XP_007022795.1| Isocitrate dehydrogenase (NADP) isoform 1 [Theobroma cacao]
 gb|EOY14320.1| Isocitrate dehydrogenase (NADP) isoform 1 [Theobroma cacao]
Length=416

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA LD N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRARLDGNARLLDFTEKLEAACVGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP+V+R  YLNTEEFIDAVA+ L  ++
Sbjct  380  LLIHGPRVTRSQYLNTEEFIDAVAKELSKRL  410



>ref|XP_006574402.1| PREDICTED: uncharacterized protein LOC100786103 isoform X2 [Glycine 
max]
 ref|XP_006574403.1| PREDICTED: uncharacterized protein LOC100786103 isoform X3 [Glycine 
max]
Length=393

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  301  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  360

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +K+ +
Sbjct  361  LILHGSKLSREHYLNTEEFIDAVAAELSAKLST  393



>ref|XP_008463133.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] isoform 
X3 [Cucumis melo]
Length=410

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N +L++F +KLE+ACI TVESGKMTKDLA
Sbjct  317  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNASLLEFTEKLESACISTVESGKMTKDLA  376

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA+ L+S++
Sbjct  377  LILHGSKLSRDQYLNTEEFIDAVAEELKSRL  407



>ref|XP_008463131.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Cucumis 
melo]
Length=417

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N +L++F +KLE+ACI TVESGKMTKDLA
Sbjct  317  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNASLLEFTEKLESACISTVESGKMTKDLA  376

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA+ L+S++
Sbjct  377  LILHGSKLSRDQYLNTEEFIDAVAEELKSRL  407



>ref|XP_004309437.1| PREDICTED: isocitrate dehydrogenase [NADP] [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQ+G ETSTNSIASIFAWTRGL HRA+LD+N  L++F QKLE ACI TVESGKMTKDLA
Sbjct  320  VHQRGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLEFTQKLEEACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HGPK++R  YLNTEEFIDAVA  L++K+
Sbjct  380  LILHGPKLARNHYLNTEEFIDAVAAELKAKL  410



>ref|XP_008463132.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] isoform 
X2 [Cucumis melo]
Length=412

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N +L++F +KLE+ACI TVESGKMTKDLA
Sbjct  317  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNASLLEFTEKLESACISTVESGKMTKDLA  376

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA+ L+S++
Sbjct  377  LILHGSKLSRDQYLNTEEFIDAVAEELKSRL  407



>ref|XP_006574401.1| PREDICTED: uncharacterized protein LOC100786103 isoform X1 [Glycine 
max]
Length=401

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  309  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  368

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +K+ +
Sbjct  369  LILHGSKLSREHYLNTEEFIDAVAAELSAKLST  401



>ref|XP_010470469.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like isoform 
X5 [Camelina sativa]
Length=412

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K+SR+ YLNTEEFIDAV+  L++++G  A
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVSAELKARLGVKA  412



>ref|XP_006372414.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
 gb|ERP50211.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
Length=410

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAAC+  VESGKMTKDLA
Sbjct  316  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAKLLDFTEKLEAACVGAVESGKMTKDLA  375

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HG KVSR+ YLNTEEFIDAVA  L++++   A
Sbjct  376  LLIHGSKVSRDQYLNTEEFIDAVAVELKARLSVEA  410



>gb|AAM13090.1| similar to NADP-specific isocitrate dehydrogenase [Arabidopsis 
thaliana]
Length=410

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTE+FIDAVA  L+ ++
Sbjct  378  LIIHGSKLSRDTYLNTEDFIDAVAAELKERL  408



>ref|NP_001241237.1| uncharacterized protein LOC100786103 [Glycine max]
 gb|ACU18009.1| unknown [Glycine max]
Length=413

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +K+ +
Sbjct  381  LILHGSKLSREHYLNTEEFIDAVAAELSAKLST  413



>ref|XP_010551544.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Tarenaya 
hassleriana]
Length=412

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LDEN  L+DF +KLEAAC+  VESGKMTKDL+
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDENPRLLDFTEKLEAACVGAVESGKMTKDLS  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            L+ HG K++RE Y NTEEFIDAVA  L++++G  A
Sbjct  378  LIIHGSKLTREHYFNTEEFIDAVADELQARLGLKA  412



>gb|ABA18651.1| cytosolic NADP+-isocitrate dehydrogenase [Populus tremula x Populus 
alba]
Length=420

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+R L HRA+LD+N  L+DF +KLEAAC+  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRELAHRAKLDDNAKLLDFTEKLEAACVGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIG  304
            LL HG KVSR+ YLNTEEFIDAVA+ L++++G
Sbjct  380  LLIHGSKVSRDQYLNTEEFIDAVAEELKARLG  411



>ref|XP_009395062.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395064.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNARLLDFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HG  V+R  YLNTEEFIDAVA  LR+++ +
Sbjct  378  LLIHGSSVTRAQYLNTEEFIDAVASELRARLSA  410



>ref|XP_004157023.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cucumis sativus]
Length=410

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N +L++F +KLE ACI+TVESGKMTKDLA
Sbjct  317  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNASLLEFTEKLELACIDTVESGKMTKDLA  376

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA+ L+S++
Sbjct  377  LILHGSKLSRDQYLNTEEFIDAVAEELKSRL  407



>ref|XP_006354121.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Solanum tuberosum]
Length=415

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA LD N+ L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRATLDNNERLLDFTEKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SRE YLNTEEFIDAVA  L++++
Sbjct  380  LIIHGSKLSREHYLNTEEFIDAVADELKARL  410



>ref|XP_010915645.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Elaeis 
guineensis]
Length=415

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+CI TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNGQLLDFTEKLEASCIGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL +G KV+R+ YLNTEEFIDAVA+ LR+++
Sbjct  378  LLIYGSKVTRDQYLNTEEFIDAVAEELRARL  408



>ref|XP_004150540.1| PREDICTED: LOW QUALITY PROTEIN: isocitrate dehydrogenase [NADP], 
chloroplastic-like [Cucumis sativus]
Length=420

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N +L++F +KLE ACI+TVESGKMTKDLA
Sbjct  327  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNASLLEFTEKLELACIDTVESGKMTKDLA  386

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA+ L+S++
Sbjct  387  LILHGSKLSRDQYLNTEEFIDAVAEELKSRL  417



>gb|AEZ00844.1| putative isocitrate dehydrogenase protein, partial [Elaeis guineensis]
Length=408

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+CI TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNGQLLDFTEKLEASCIGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL +G KV+R+ YLNTEEFIDAVA+ LR+++
Sbjct  378  LLIYGSKVTRDQYLNTEEFIDAVAEELRARL  408



>ref|XP_011005927.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
 ref|XP_011005928.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
 ref|XP_011005930.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
Length=414

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNARLLDFTEKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KVSR  YLNTEEFIDAVA+ L++++
Sbjct  380  LLIHGSKVSRGHYLNTEEFIDAVAEELKARL  410



>ref|XP_010915644.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Elaeis 
guineensis]
Length=416

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEA+CI TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNGQLLDFTEKLEASCIGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL +G KV+R+ YLNTEEFIDAVA+ LR+++
Sbjct  378  LLIYGSKVTRDQYLNTEEFIDAVAEELRARL  408



>dbj|BAC77064.1| NADP-specific isocitrate dehydrogenase [Lupinus albus]
Length=412

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLE ACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAKLLDFTKKLEEACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L++KI +
Sbjct  380  LIIHGSKLSREHYLNTEEFIDAVANELKAKISA  412



>ref|XP_002527208.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
 gb|EEF35175.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
Length=416

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQ+G ETSTNSIASIFAW+RGL HRA+LD N  L++F +KLEAAC+  VESGKMTKDLA
Sbjct  320  VHQRGGETSTNSIASIFAWSRGLAHRAKLDGNARLLEFTEKLEAACVGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGPKV+R  YLNTEEFIDAVA+ LR ++ + A
Sbjct  380  LLIHGPKVTRAQYLNTEEFIDAVAEELRLRLSAKA  414



>dbj|BAG84436.1| NADP-dependent isocitrate dehydrogenase [Passiflora edulis]
Length=414

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAAC+  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFTEKLEAACVGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA  L++++
Sbjct  380  LIIHGSKLSRDKYLNTEEFIDAVADELKARL  410



>gb|KFK35526.1| hypothetical protein AALP_AA4G002200 [Arabis alpina]
Length=416

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDRNAALLNFTEKLEAACMGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV RE Y+NTEEF+DAVA  LR ++
Sbjct  380  LLIHGPKVRREEYVNTEEFMDAVAWELRRRL  410



>gb|KJB81473.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
Length=376

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VH+ G ETSTNSIASIFAW+RGL HRA LD N  L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  280  VHKTGGETSTNSIASIFAWSRGLAHRARLDGNDRLLDFTQKLEAACVGTVESGKMTKDLA  339

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR  YLNTEEFI+AVA+ L +++
Sbjct  340  LLIHGPKVSRSQYLNTEEFIEAVAKELSNRM  370



>ref|XP_010669953.1| PREDICTED: isocitrate dehydrogenase [NADP] [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669954.1| PREDICTED: isocitrate dehydrogenase [NADP] [Beta vulgaris subsp. 
vulgaris]
Length=410

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N+ L+ F Q LEAAC++TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDNNERLLGFTQTLEAACVDTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R+ YLNTEEFIDAVA  L++++
Sbjct  380  LITHGSKLTRDQYLNTEEFIDAVAAELKARL  410



>ref|XP_006596496.1| PREDICTED: isocitrate dehydrogenase [NADP] [Glycine max]
 sp|Q06197.2|IDHC_SOYBN RecName: Full=Isocitrate dehydrogenase [NADP]; Short=IDH; AltName: 
Full=IDP; AltName: Full=NADP(+)-specific ICDH; AltName: 
Full=Oxalosuccinate decarboxylase [Glycine max]
Length=413

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +++ +
Sbjct  381  LILHGSKLSREHYLNTEEFIDAVAAELSARLSA  413



>dbj|BAA34112.1| NADP specific isocitrate dehydrogenase [Daucus carota]
Length=412

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+ F +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAALLSFAEKLEAACVGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA +L++++ +
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVASDLKARLAN  412



>gb|AAM65674.1| isocitrate dehydrogenase, putative [Arabidopsis thaliana]
Length=410

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQK  ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKAGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SR+ YLNTEEFIDAVA  L+ ++ +
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVAAELKERLNA  410



>ref|NP_001136968.1| seed maturation protein PM41 [Zea mays]
 gb|ACF82986.1| unknown [Zea mays]
 tpg|DAA58298.1| TPA: seed maturation protein PM41 [Zea mays]
Length=412

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF  KLEAAC+  VESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFALKLEAACVGAVESGKMTKDLA  377

Query  399  LLNHG-PKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HG  KV+R  YLNTEEFIDAVA  LRS++G+
Sbjct  378  LLVHGSSKVTRSHYLNTEEFIDAVATELRSRLGA  411



>emb|CDY46358.1| BnaAnng08060D [Brassica napus]
Length=375

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N +L++F++KLEAAC+ TVESGKMTKDLA
Sbjct  279  VHQKGGETSTNSIASIFAWSRGLAHRAKLDSNASLLNFIEKLEAACMATVESGKMTKDLA  338

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KV R+ Y+NTEEFIDAVA  LR ++
Sbjct  339  LLIHGSKVKRDDYVNTEEFIDAVAWELRKRL  369



>ref|XP_009124160.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like isoform 
X2 [Brassica rapa]
Length=400

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  299  VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNSKLLEFTEKLEAACVGTVESGKMTKDLA  358

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRS  313
            L+ HG K+SR+ YLNTEEFIDAVA +L++
Sbjct  359  LIIHGSKLSRDTYLNTEEFIDAVADDLKT  387



>ref|XP_002528517.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
 gb|EEF33886.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
Length=413

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNARLLDFTEKLEAACIGVVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KV+R+ YLNTEEFIDAVA +L  ++
Sbjct  380  LLIHGSKVTRDQYLNTEEFIDAVAADLAERL  410



>ref|XP_008783873.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Phoenix dactylifera]
Length=416

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF +KLEAACI TVESG+MTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDNNGQLLDFTEKLEAACIGTVESGRMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL  G KV+R+ YLNTEEFIDAVA+ LR+++
Sbjct  378  LLIFGSKVTRDQYLNTEEFIDAVAEELRARL  408



>pir||S33612 isocitrate dehydrogenase (NADP) (EC 1.1.1.42) - soybean
Length=451

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  359  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  418

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +++ +
Sbjct  419  LILHGSKLSREHYLNTEEFIDAVAAELSARLSA  451



>gb|AAA33978.1| NADPH-specific isocitrate dehydrogenase, partial [Glycine max]
Length=441

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  349  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLA  408

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +++ +
Sbjct  409  LILHGSKLSREHYLNTEEFIDAVAAELSARLSA  441



>ref|XP_008381384.1| PREDICTED: isocitrate dehydrogenase [NADP] [Malus domestica]
Length=412

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F QKLE ACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNPRLLEFTQKLEEACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIG  304
            L+ HG K++R  YLNTEEFIDAVA+ L++K+ 
Sbjct  380  LILHGSKLARNHYLNTEEFIDAVAEELKAKLA  411



>ref|NP_001056381.1| Os05g0573200 [Oryza sativa Japonica Group]
 gb|AAD37810.1|AF155334_1 NADP-specific isocitrate dehydrogenase [Oryza sativa]
 gb|AAU44104.1| isocitrate dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF18295.1| Os05g0573200 [Oryza sativa Japonica Group]
 gb|EEE64768.1| hypothetical protein OsJ_19624 [Oryza sativa Japonica Group]
Length=412

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLEAACI  VESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFTQKLEAACIGAVESGKMTKDLA  377

Query  399  LLNHGPK-VSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HG   V+R  YLNTEEFIDAVA  LRS++ +
Sbjct  378  LLVHGSSNVTRSHYLNTEEFIDAVADELRSRLAA  411



>ref|XP_006422322.1| hypothetical protein CICLE_v10005058mg [Citrus clementina]
 ref|XP_006493724.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Citrus 
sinensis]
 ref|XP_006493725.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Citrus 
sinensis]
 gb|ESR35562.1| hypothetical protein CICLE_v10005058mg [Citrus clementina]
Length=416

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW++GL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSQGLAHRAKLDGNPRLLDFTEKLEAACIATVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP+V+R  YLNTEEFIDAV + L+ ++
Sbjct  380  LLIHGPQVARPQYLNTEEFIDAVTETLKERM  410



>ref|XP_009624622.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana tomentosiformis]
Length=415

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA LD N+ L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRATLDNNERLLDFTEKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA  L++++
Sbjct  380  LIIHGSKLSRDHYLNTEEFIDAVADELKARL  410



>gb|KHN41035.1| Isocitrate dehydrogenase [NADP] [Glycine soja]
Length=413

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L+DF +KLEAACI  VE+GKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNAKLLDFTEKLEAACIGVVEAGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA  L +K+ +
Sbjct  381  LILHGSKLSREHYLNTEEFIDAVAAELSAKLST  413



>sp|P50218.1|IDHC_TOBAC RecName: Full=Isocitrate dehydrogenase [NADP]; Short=IDH; AltName: 
Full=IDP; AltName: Full=NADP(+)-specific ICDH; AltName: 
Full=Oxalosuccinate decarboxylase [Nicotiana tabacum]
 emb|CAA54912.1| isocitrate dehydrogenase (NADP+) [Nicotiana tabacum]
Length=415

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA LD N+ L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRATLDNNERLLDFTEKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA  L++++
Sbjct  380  LIIHGSKLSRDHYLNTEEFIDAVADELKARL  410



>ref|XP_011014473.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X2 [Populus 
euphratica]
Length=405

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF  KLEA+CI  V+SGKMTKDLA
Sbjct  309  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNVKLLDFTTKLEASCIGAVQSGKMTKDLA  368

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGP+VSR  +LNTEEFIDAVA+ LR+++   A
Sbjct  369  LLIHGPRVSRSQFLNTEEFIDAVAEELRARLSVKA  403



>ref|XP_004961158.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Setaria italica]
Length=415

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLEAACI  VESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFTQKLEAACIGAVESGKMTKDLA  377

Query  399  LLNHGPK-VSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HG   V+R  YLNTEEFIDAVA  LRS++ +
Sbjct  378  LLVHGSSNVTRSHYLNTEEFIDAVADELRSRLAA  411



>ref|XP_010913457.1| PREDICTED: isocitrate dehydrogenase [NADP] [Elaeis guineensis]
Length=409

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LDEN  L+DF  KLEAAC+  VESG+MTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRAKLDENAQLLDFTAKLEAACVGAVESGRMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            +L HG KV+R+ +LNTEEFIDAVA+ LR+++
Sbjct  378  ILIHGSKVTRDQWLNTEEFIDAVAEELRARL  408



>ref|XP_009785664.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana sylvestris]
Length=415

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA LD N+ L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRATLDNNERLLDFTEKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K+SR+ YLNTEEFIDAVA  L++++
Sbjct  380  LIIHGSKLSRDHYLNTEEFIDAVADELKARL  410



>gb|KJB81468.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
 gb|KJB81469.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
Length=417

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VH+ G ETSTNSIASIFAW+RGL HRA LD N  L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  321  VHKTGGETSTNSIASIFAWSRGLAHRARLDGNDRLLDFTQKLEAACVGTVESGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR  YLNTEEFI+AVA+ L +++
Sbjct  381  LLIHGPKVSRSQYLNTEEFIEAVAKELSNRM  411



>ref|XP_011014465.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Populus 
euphratica]
Length=428

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+DF  KLEA+CI  V+SGKMTKDLA
Sbjct  332  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNVKLLDFTTKLEASCIGAVQSGKMTKDLA  391

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGP+VSR  +LNTEEFIDAVA+ LR+++   A
Sbjct  392  LLIHGPRVSRSQFLNTEEFIDAVAEELRARLSVKA  426



>gb|KHG15210.1| Isocitrate dehydrogenase [NADP] [Gossypium arboreum]
Length=417

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VH+ G ETSTNSIASIFAW+RGL HRA LD N  L+DF QKLEAAC+ TVESGKMTKDLA
Sbjct  321  VHKTGGETSTNSIASIFAWSRGLAHRARLDGNDRLLDFTQKLEAACVGTVESGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKVSR  YLNTEEFI+AVA+ L +++
Sbjct  381  LLIHGPKVSRSQYLNTEEFIEAVAKELSNRM  411



>ref|XP_006858533.1| hypothetical protein AMTR_s00071p00157830 [Amborella trichopoda]
 gb|ERN20000.1| hypothetical protein AMTR_s00071p00157830 [Amborella trichopoda]
Length=416

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L +F +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNARLKEFAEKLEAACVGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSP  298
            L+ HG KV+RE YLNTEEFIDAVA +L+ ++ SP
Sbjct  380  LIIHGSKVTREHYLNTEEFIDAVADDLKCRL-SP  412



>ref|XP_009124158.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like isoform 
X1 [Brassica rapa]
Length=419

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNSKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRS  313
            L+ HG K+SR+ YLNTEEFIDAVA +L++
Sbjct  378  LIIHGSKLSRDTYLNTEEFIDAVADDLKT  406



>gb|KDO61504.1| hypothetical protein CISIN_1g040623mg, partial [Citrus sinensis]
Length=443

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW++GL HRA+LD N  L+DF +KLEAACI TVESGKMTKDLA
Sbjct  347  VHQKGGETSTNSIASIFAWSQGLAHRAKLDGNPRLLDFTEKLEAACIATVESGKMTKDLA  406

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP+V+R  YLNTEEFIDAV + L+ ++
Sbjct  407  LLIHGPQVARPQYLNTEEFIDAVTETLKERM  437



>ref|XP_002315093.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF01264.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
Length=428

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+ GL HRA+LD N  LMDF  KLEA+CI  VESGKMTKDLA
Sbjct  332  VHQKGGETSTNSIASIFAWSSGLAHRAKLDGNVKLMDFTAKLEASCIGAVESGKMTKDLA  391

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGSPA  295
            LL HGP+VSR  +LNTEEFIDAVA+ LR+++   A
Sbjct  392  LLIHGPRVSRSQFLNTEEFIDAVAEELRARLSVKA  426



>ref|XP_001778805.1| predicted protein [Physcomitrella patens]
 gb|EDQ56391.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HR +LD N+ L+DF  KLE AC+ TVE+GKMTKDLA
Sbjct  321  VHQKGGETSTNSIASIFAWTRGLSHRGKLDGNEKLVDFATKLEQACVGTVENGKMTKDLA  380

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG K+SR+ YLNTEEFIDAVA+ L+SK+
Sbjct  381  LLIHGSKLSRDTYLNTEEFIDAVAEELKSKL  411



>emb|CDY20354.1| BnaC02g24620D [Brassica napus]
Length=419

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNSKLLEFTEKLEAACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRS  313
            L+ HG K+SR+ YLNTEEFIDAVA +L++
Sbjct  378  LIIHGAKLSRDTYLNTEEFIDAVADDLQT  406



>ref|XP_006392554.1| hypothetical protein EUTSA_v10012325mg [Eutrema salsugineum]
 gb|ESQ29840.1| hypothetical protein EUTSA_v10012325mg [Eutrema salsugineum]
Length=463

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L++F +KLEAAC+ +VESGKMTKDLA
Sbjct  367  VHQKGGETSTNSIASIFAWSRGLAHRAKLDSNAALLNFTEKLEAACMGSVESGKMTKDLA  426

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV R+ Y+NTEEFIDAVA  LR ++
Sbjct  427  LLIHGPKVRRDAYVNTEEFIDAVAWELRRRL  457



>ref|XP_010480188.1| PREDICTED: peroxisomal isocitrate dehydrogenase [NADP] [Camelina 
sativa]
Length=415

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNS+ASIFAW+RGL HRA+LD N  L+ F +KLEAAC+ TVESGKMTKDLA
Sbjct  319  VHQKGGETSTNSLASIFAWSRGLAHRAKLDSNGALLSFTEKLEAACMGTVESGKMTKDLA  378

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV R+ Y+NTEEFIDAVA  LR ++
Sbjct  379  LLIHGPKVRRDQYVNTEEFIDAVAWELRRRL  409



>ref|XP_002891883.1| hypothetical protein ARALYDRAFT_474695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68142.1| hypothetical protein ARALYDRAFT_474695 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L+ + +KLEAAC+ TVESGKMTKDLA
Sbjct  319  VHQKGGETSTNSIASIFAWSRGLAHRAKLDSNAALLSYTEKLEAACMGTVESGKMTKDLA  378

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGPKV R+ Y+NTEEFIDAVA  LR ++
Sbjct  379  LLIHGPKVRRDQYVNTEEFIDAVAWELRRRL  409



>ref|XP_009370567.1| PREDICTED: isocitrate dehydrogenase [NADP] [Pyrus x bretschneideri]
Length=412

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F QKLE ACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLEFTQKLEEACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R  YLNTEEFIDAVA  L++K+
Sbjct  380  LILHGSKLARNHYLNTEEFIDAVANELKAKL  410



>gb|ADU20197.1| NADP-dependent isocitric acid dehydrogenase [Pyrus pyrifolia]
Length=412

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F QKLE ACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLEFTQKLEEACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R  YLNTEEFIDAVA  L++K+
Sbjct  380  LILHGSKLARNHYLNTEEFIDAVANELKAKL  410



>ref|XP_002312216.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE89583.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
Length=428

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L DF  KLEA+CI  VESGKMTKDLA
Sbjct  332  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNVRLSDFTAKLEASCIGAVESGKMTKDLA  391

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP+VSR  YLNTEEFIDAVA+ L++++
Sbjct  392  LLIHGPRVSRGRYLNTEEFIDAVAEELKARL  422



>ref|XP_009367131.1| PREDICTED: isocitrate dehydrogenase [NADP] [Pyrus x bretschneideri]
Length=412

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L++F QKLE ACI TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLEFTQKLEEACIGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            L+ HG K++R  YLNTEEFIDAVA  L++K+
Sbjct  380  LILHGSKLARNHYLNTEEFIDAVADELKAKL  410



>ref|XP_009384960.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HR +LD+N  L+DF QKLE AC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWSRGLAHRGKLDDNTRLVDFTQKLEEACVGTVESGKMTKDLA  377

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HG  V+R  YLNTEEFIDAVA  LR+++ +
Sbjct  378  LLIHGSSVTRAQYLNTEEFIDAVASELRARLSA  410



>ref|XP_011012227.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Populus 
euphratica]
Length=372

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L DF  KLEA+CI  VESGKMTKDLA
Sbjct  276  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNVRLSDFTAKLEASCIGAVESGKMTKDLA  335

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP+VSR  YLNTEEFIDA+A+ L++++
Sbjct  336  LLIHGPRVSRGRYLNTEEFIDALAEELKARL  366



>gb|ACN32072.1| unknown [Zea mays]
 gb|ACN34275.1| unknown [Zea mays]
 gb|AFW79265.1| hypothetical protein ZEAMMB73_761630 [Zea mays]
Length=415

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLEAAC+  VESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFTQKLEAACVGAVESGKMTKDLA  377

Query  399  LLNHGPK-VSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HG   ++R  YLNTEEFIDAVA  LRS++ +
Sbjct  378  LLVHGSSNITRSHYLNTEEFIDAVADELRSRLAA  411



>ref|NP_001140324.1| isocitrate dehydrogenase2 [Zea mays]
 gb|ACF83590.1| unknown [Zea mays]
Length=415

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD+N  L+DF QKLEAAC+  VESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFTQKLEAACVGAVESGKMTKDLA  377

Query  399  LLNHGPK-VSRELYLNTEEFIDAVAQNLRSKIGS  301
            LL HG   ++R  YLNTEEFIDAVA  LRS++ +
Sbjct  378  LLVHGSSNITRSHYLNTEEFIDAVADELRSRLAA  411



>gb|ABK25438.1| unknown [Picea sitchensis]
Length=398

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L++F +KLE ACI TVE+GKMTKDLA
Sbjct  301  VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNARLLEFSEKLEVACIGTVEAGKMTKDLA  360

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA++L+ ++ +
Sbjct  361  LIIHGSKLSREHYLNTEEFIDAVAEDLKIRLSA  393



>gb|ACN40177.1| unknown [Picea sitchensis]
Length=418

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LD N  L++F +KLE ACI TVE+GKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRAKLDGNARLLEFSEKLEVACIGTVEAGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS-PALA  289
            L+ HG K+SRE YLNTEEFIDAVA++L+ ++ + P L+
Sbjct  380  LIIHGSKLSREHYLNTEEFIDAVAEDLKIRLSAKPKLS  417



>ref|NP_001275253.1| isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Solanum tuberosum]
 emb|CAA63220.1| isocitrate dehydrogenase (NAD+) [Solanum tuberosum]
Length=470

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 80/91 (88%), Gaps = 1/91 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            +HQKGQETSTNS+ASIFAWT+GLGHRA+LD N+ L++FV  LEA+CI T+ESGKMT +LA
Sbjct  375  LHQKGQETSTNSVASIFAWTKGLGHRAQLDGNQKLLEFVHTLEASCIGTIESGKMT-NLA  433

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            +L HG KVSRE YLNTEEFIDAVAQ L+ K+
Sbjct  434  ILAHGSKVSREFYLNTEEFIDAVAQKLQEKL  464



>emb|CAA73139.1| isocitrate dehydrogenase (NADP+) [Apium graveolens]
Length=412

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD+N  L+ F +KLEAAC+ TVE+G+MTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDDNAALLSFAEKLEAACVGTVEAGRMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKIGS  301
            L+ HG K+SRE YLNTEEFIDAVA +L++++ +
Sbjct  380  LILHGSKLSREHYLNTEEFIDAVADDLKARLAN  412



>ref|XP_009104137.1| PREDICTED: peroxisomal isocitrate dehydrogenase [NADP] [Brassica 
rapa]
Length=416

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N +L++F +KLEAAC+ TVESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDSNASLLNFTEKLEAACMGTVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG KV R+ Y+NTEEFIDAVA  LR ++
Sbjct  380  LLIHGSKVKRDDYVNTEEFIDAVAWELRKRL  410



>gb|EMT15199.1| putative Isocitrate dehydrogenase (NADP), chloroplastic [Aegilops 
tauschii]
Length=409

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA+LDEN  L++F QKLE AC+ TVESGKMTKDLA
Sbjct  318  VHQKGGETSTNSIASIFAWTRGLAHRAKLDENARLLEFAQKLEEACVGTVESGKMTKDLA  377

Query  399  LLNHG-PKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HG  KV+R  YLNTEEFIDAVA  L+S++
Sbjct  378  LLVHGSSKVTRSDYLNTEEFIDAVAAELKSRL  409



>gb|AFL48182.1| isocitrate dehydrogenase [Capsicum annuum]
Length=415

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAWTRGL HRA LD+N+ L+DF +KLEAACI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWTRGLAHRATLDKNERLLDFTEKLEAACIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVA  328
            L+ HG K+SRE YLNTEEFIDAVA
Sbjct  380  LIIHGSKLSREHYLNTEEFIDAVA  403



>ref|XP_011012153.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Populus 
euphratica]
Length=416

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  579  VHQKGQETSTNSIASIFAWTRGLGHRAELDENKNLMDFVQKLEAACIETVESGKMTKDLA  400
            VHQKG ETSTNSIASIFAW+RGL HRA+LD N  L DF  KLEA+CI  VESGKMTKDLA
Sbjct  320  VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNVRLSDFTAKLEASCIGAVESGKMTKDLA  379

Query  399  LLNHGPKVSRELYLNTEEFIDAVAQNLRSKI  307
            LL HGP+VSR  YLNTEEFIDA+A+ L++++
Sbjct  380  LLIHGPRVSRGRYLNTEEFIDALAEELKARL  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220