BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049P17

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767064.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    100   6e-22   Nicotiana sylvestris
ref|XP_009618579.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  99.8    2e-21   Nicotiana tomentosiformis
gb|AGB05602.1|  sn-glycerol-3-phosphate acyltransferase               98.6    4e-21   Camellia oleifera [abura-tsubaki]
ref|XP_006349549.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  96.7    2e-20   Solanum tuberosum [potatoes]
gb|ABP93351.1|  lysophosphatidyl acyltransferase 2                    95.9    4e-20   Helianthus annuus
ref|XP_002283340.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  95.5    5e-20   Vitis vinifera
ref|XP_010088401.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...  95.1    3e-19   
ref|XP_003535857.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  93.6    3e-19   Glycine max [soybeans]
ref|XP_004234840.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  92.8    5e-19   Solanum lycopersicum
ref|XP_010516384.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  88.6    1e-18   Camelina sativa [gold-of-pleasure]
emb|CDY33810.1|  BnaCnng07280D                                        91.7    1e-18   Brassica napus [oilseed rape]
emb|CAN83214.1|  hypothetical protein VITISV_038716                   91.7    1e-18   Vitis vinifera
gb|ADC97479.1|  lysophosphatidic acid acyltransferase                 91.7    1e-18   Brassica napus [oilseed rape]
gb|AAF20003.1|AF213937_1  1-acyl-sn-glycerol-3-phosphate acyltran...  90.9    2e-18   Prunus dulcis [sweet almond]
ref|XP_007145631.1|  hypothetical protein PHAVU_007G255300g           91.3    2e-18   Phaseolus vulgaris [French bean]
ref|XP_006402859.1|  hypothetical protein EUTSA_v10006028mg           91.3    2e-18   Eutrema salsugineum [saltwater cress]
ref|NP_001280186.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...  90.9    3e-18   Prunus mume [ume]
gb|ABM92334.2|  1-acylglycerol-3-phosphate acyltransferase            90.5    3e-18   Brassica juncea [brown mustard]
gb|ABU50327.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase        90.5    3e-18   Helianthus annuus
sp|Q9XFW4.1|LPAT2_BRANA  RecName: Full=1-acyl-sn-glycerol-3-phosp...  90.1    5e-18   Brassica napus [oilseed rape]
ref|XP_007202144.1|  hypothetical protein PRUPE_ppa007002mg           90.1    5e-18   Prunus persica
emb|CAA90019.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase       89.4    5e-18   Brassica napus [oilseed rape]
ref|XP_010504700.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  86.3    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009104068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  89.4    9e-18   Brassica rapa
emb|CDX67700.1|  BnaA07g17400D                                        89.4    1e-17   
ref|XP_004307568.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  89.4    1e-17   Fragaria vesca subsp. vesca
sp|Q6IWY1.1|LPAT2_BRAOL  RecName: Full=1-acyl-sn-glycerol-3-phosp...  88.6    2e-17   Brassica oleracea
gb|EYU20729.1|  hypothetical protein MIMGU_mgv1a008164mg              88.6    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_006293344.1|  hypothetical protein CARUB_v100174200mg          87.4    3e-17   
emb|CAB41190.1|  1-acylcerol-3-phosphate acyltransferase-like pro...  87.0    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36055.1|  hypothetical protein B456_006G138600                  87.8    3e-17   Gossypium raimondii
ref|XP_010554846.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  87.8    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_006351222.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  87.4    5e-17   Solanum tuberosum [potatoes]
gb|AAM61033.1|  1-acylcerol-3-phosphate acyltransferase-like protein  87.0    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567052.1|  lysophosphatidyl acyltransferase 2                  87.0    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007028850.1|  Lysophosphatidyl acyltransferase 2               87.0    7e-17   
ref|XP_002876428.1|  hypothetical protein ARALYDRAFT_907235           86.7    8e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_002323308.2|  hypothetical protein POPTR_0016s05340g           87.0    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010504698.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  86.3    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010257310.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  85.9    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009116469.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  85.9    2e-16   Brassica rapa
gb|ADC97478.1|  lysophosphatidic acid acyltransferase                 85.9    2e-16   Brassica napus [oilseed rape]
ref|XP_003518108.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  85.5    2e-16   Glycine max [soybeans]
gb|ACU18782.1|  unknown                                               84.3    3e-16   Glycine max [soybeans]
gb|KDP37345.1|  hypothetical protein JCGZ_06799                       85.1    3e-16   Jatropha curcas
ref|XP_011078878.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  84.7    4e-16   Sesamum indicum [beniseed]
gb|ABN09946.1|  lysophosphatidyl acyltransferase                      84.3    6e-16   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_003521190.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  84.3    6e-16   Glycine max [soybeans]
ref|XP_009345032.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  84.0    8e-16   Pyrus x bretschneideri [bai li]
emb|CDP10072.1|  unnamed protein product                              84.0    8e-16   Coffea canephora [robusta coffee]
ref|XP_008392182.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  83.6    1e-15   
gb|KFK35010.1|  hypothetical protein AALP_AA5G222500                  83.6    1e-15   Arabis alpina [alpine rockcress]
gb|AEZ56251.1|  plastid 1-acylglycerol-phosphate acyltransferase      83.6    1e-15   Jatropha curcas
ref|XP_010516385.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  83.6    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_011033303.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  83.2    2e-15   Populus euphratica
ref|XP_003554183.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  82.4    3e-15   Glycine max [soybeans]
ref|XP_010265751.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  82.0    4e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006493900.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  81.3    4e-15   Citrus sinensis [apfelsine]
ref|XP_006493899.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  81.3    4e-15   
gb|AHC70248.1|  lysophosphatidic acid acyltransferase                 81.6    5e-15   Sterculia foetida
ref|XP_009334964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  81.3    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_010672763.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  80.9    1e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006421452.1|  hypothetical protein CICLE_v10005148mg           79.7    1e-14   
ref|XP_006421453.1|  hypothetical protein CICLE_v10005148mg           79.7    1e-14   Citrus clementina [clementine]
ref|XP_011020321.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  80.1    2e-14   Populus euphratica
ref|XP_002308046.1|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...  80.1    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010672762.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  80.9    2e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002526730.1|  lysophosphatidic acid acyltransferase, putative  80.5    2e-14   
gb|AGO14579.1|  A-class lysophosphatidate acyltransferase 2 isofo...  79.7    3e-14   Echium pitardii
gb|AGO14580.1|  A-class lysophosphatidate acyltransferase 2 isofo...  79.7    3e-14   Echium pitardii
emb|CDX88957.1|  BnaA04g02290D                                        79.0    5e-14   
ref|XP_007162250.1|  hypothetical protein PHAVU_001G136600g           79.0    5e-14   Phaseolus vulgaris [French bean]
ref|XP_009139024.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  79.0    5e-14   Brassica rapa
ref|XP_011075205.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  77.8    1e-13   Sesamum indicum [beniseed]
gb|KCW90238.1|  hypothetical protein EUGRSUZ_A02397                   77.0    2e-13   Eucalyptus grandis [rose gum]
gb|ACV73676.1|  lysophosphatidic acid acyltransferase 2               77.0    2e-13   Tropaeolum majus
ref|XP_010057561.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  77.0    2e-13   Eucalyptus grandis [rose gum]
gb|KCW90236.1|  hypothetical protein EUGRSUZ_A02397                   77.0    3e-13   Eucalyptus grandis [rose gum]
gb|KEH41602.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase-li...  76.3    4e-13   Medicago truncatula
gb|KJB16431.1|  hypothetical protein B456_002G230000                  75.1    5e-13   Gossypium raimondii
emb|CAA88620.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase (...  75.9    6e-13   Limnanthes douglasii
gb|KHG04120.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 2      74.7    8e-13   Gossypium arboreum [tree cotton]
gb|KJB16432.1|  hypothetical protein B456_002G230000                  74.7    1e-12   Gossypium raimondii
ref|XP_004136588.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  75.1    1e-12   Cucumis sativus [cucumbers]
ref|XP_004165747.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  75.1    1e-12   
gb|KJB16430.1|  hypothetical protein B456_002G230000                  75.1    1e-12   Gossypium raimondii
gb|KJB16433.1|  hypothetical protein B456_002G230000                  74.7    1e-12   Gossypium raimondii
ref|XP_008443106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  74.3    2e-12   Cucumis melo [Oriental melon]
ref|XP_004249199.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  70.5    5e-11   Solanum lycopersicum
ref|XP_007015031.1|  Lysophosphatidyl acyltransferase 3               69.3    1e-10   
ref|XP_010524157.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_006852430.1|  hypothetical protein AMTR_s00021p00084240        68.9    2e-10   Amborella trichopoda
emb|CDP18472.1|  unnamed protein product                              68.6    2e-10   Coffea canephora [robusta coffee]
ref|XP_004493527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  67.8    2e-10   Cicer arietinum [garbanzo]
ref|XP_003625177.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase   67.0    3e-10   
gb|AFW60270.1|  hypothetical protein ZEAMMB73_783506                  67.0    4e-10   
gb|KDO61278.1|  hypothetical protein CISIN_1g016254mg                 67.0    4e-10   Citrus sinensis [apfelsine]
ref|XP_003625176.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase   66.6    5e-10   Medicago truncatula
gb|AFK40266.1|  unknown                                               66.6    5e-10   Medicago truncatula
gb|ACN28103.1|  unknown                                               67.0    7e-10   Zea mays [maize]
ref|XP_006470599.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  67.0    8e-10   Citrus sinensis [apfelsine]
ref|XP_006470598.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  67.0    9e-10   Citrus sinensis [apfelsine]
ref|XP_003575968.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  66.6    9e-10   Brachypodium distachyon [annual false brome]
ref|XP_002443267.1|  hypothetical protein SORBIDRAFT_08g016610        65.9    1e-09   Sorghum bicolor [broomcorn]
emb|CBI21663.3|  unnamed protein product                              66.2    1e-09   Vitis vinifera
ref|XP_002268451.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  65.5    2e-09   Vitis vinifera
ref|XP_004979811.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  65.5    2e-09   Setaria italica
ref|XP_009773917.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  65.5    2e-09   Nicotiana sylvestris
tpg|DAA42326.1|  TPA: hypothetical protein ZEAMMB73_334173            64.3    3e-09   
ref|NP_001148618.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...  64.7    4e-09   Zea mays [maize]
dbj|BAJ84894.1|  predicted protein                                    64.7    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW51192.1|  hypothetical protein EUGRSUZ_J00779                   64.3    4e-09   Eucalyptus grandis [rose gum]
ref|NP_001105919.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...  64.7    4e-09   Zea mays [maize]
ref|XP_010031802.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  64.3    5e-09   Eucalyptus grandis [rose gum]
gb|EMS63864.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1   63.9    7e-09   Triticum urartu
gb|EYU39879.1|  hypothetical protein MIMGU_mgv1a010933mg              63.2    7e-09   Erythranthe guttata [common monkey flower]
ref|XP_006446108.1|  hypothetical protein CICLE_v10015539mg           62.8    1e-08   
ref|XP_006446109.1|  hypothetical protein CICLE_v10015539mg           62.8    2e-08   Citrus clementina [clementine]
ref|XP_002451179.1|  hypothetical protein SORBIDRAFT_05g025420        62.4    2e-08   Sorghum bicolor [broomcorn]
ref|XP_010102333.1|  Xanthine dehydrogenase                           61.6    8e-08   
ref|XP_011080283.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  60.8    8e-08   Sesamum indicum [beniseed]
ref|XP_004250948.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  60.8    8e-08   
ref|XP_010545584.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  60.5    1e-07   
ref|XP_008450418.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  60.1    1e-07   Cucumis melo [Oriental melon]
gb|ABA94922.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase PL...  59.3    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68515.1|  hypothetical protein OsI_36790                        59.3    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_004139036.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  59.3    3e-07   Cucumis sativus [cucumbers]
ref|XP_009375057.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  59.3    3e-07   
ref|XP_008813483.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  58.5    4e-07   Phoenix dactylifera
gb|EPS68644.1|  lysophosphatidic acid acyltransferase                 58.2    6e-07   Genlisea aurea
ref|XP_003577308.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  58.2    6e-07   Brachypodium distachyon [annual false brome]
ref|XP_010906759.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  57.8    8e-07   Elaeis guineensis
ref|XP_006663068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  57.8    9e-07   Oryza brachyantha
ref|XP_008227141.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  57.4    1e-06   Prunus mume [ume]
ref|XP_009615949.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  57.0    2e-06   Nicotiana tomentosiformis
ref|XP_007214575.1|  hypothetical protein PRUPE_ppa019921mg           57.0    2e-06   
ref|XP_010909860.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...  56.2    3e-06   
ref|XP_010479592.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  56.2    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006361745.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  55.8    4e-06   Solanum tuberosum [potatoes]
ref|XP_009395596.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  55.8    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387255.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  55.8    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387254.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  55.8    4e-06   
gb|ADE75797.1|  unknown                                               55.1    6e-06   Picea sitchensis
ref|XP_010500700.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  55.1    7e-06   Camelina sativa [gold-of-pleasure]
gb|KFK35863.1|  hypothetical protein AALP_AA4G046700                  55.1    7e-06   Arabis alpina [alpine rockcress]
ref|XP_002298406.2|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...  55.1    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011006209.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  54.7    8e-06   Populus euphratica
ref|XP_010461958.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  54.7    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011006207.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  54.7    8e-06   Populus euphratica
ref|XP_011006208.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  54.7    9e-06   Populus euphratica
ref|XP_002894307.1|  hypothetical protein ARALYDRAFT_474240           53.9    2e-05   
ref|XP_002513487.1|  lysophosphatidic acid acyltransferase, putative  53.5    2e-05   Ricinus communis
ref|XP_006304715.1|  hypothetical protein CARUB_v10012002mg           53.1    3e-05   Capsella rubella
ref|XP_008377433.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  53.1    3e-05   Malus domestica [apple tree]
ref|XP_009144912.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  53.1    3e-05   Brassica rapa
emb|CDY35563.1|  BnaC05g27180D                                        53.1    3e-05   Brassica napus [oilseed rape]
ref|XP_008801930.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  53.1    3e-05   Phoenix dactylifera
ref|XP_008363723.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  51.2    4e-05   
ref|XP_002894308.1|  hypothetical protein ARALYDRAFT_892094           52.8    4e-05   
ref|XP_010673625.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  52.4    6e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673624.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  52.0    7e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009414749.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  51.6    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008363635.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  51.6    1e-04   
ref|XP_002526731.1|  conserved hypothetical protein                   49.3    2e-04   
ref|XP_004513649.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...  50.4    2e-04   Cicer arietinum [garbanzo]



>ref|XP_009767064.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nicotiana sylvestris]
Length=387

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+E  +D+GRPVKSLVVV SWAC+LILG +KF Q++ LLSSWKG+++SAAL+ VVT+LM
Sbjct  291  FGEEQLQDIGRPVKSLVVVASWACILILGTIKFLQATALLSSWKGVAVSAALMAVVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
            QILI FS++ERS  AKVAPA     NQ   + +++K+
Sbjct  351  QILINFSKSERSTAAKVAPAKEKNVNQPTGNGQEKKD  387



>ref|XP_009618579.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Nicotiana 
tomentosiformis]
Length=387

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+E  +D+GRPVKSLVVV SWAC+LILG +KF Q++ LLSSWKG++ISAAL+ VVT+LM
Sbjct  291  FGEEQLQDIGRPVKSLVVVASWACILILGTIKFLQATALLSSWKGVAISAALMAVVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
            QILI FS++ERS  AKVAPA     NQ   + + +K+
Sbjct  351  QILINFSKSERSTAAKVAPAKEKNVNQPTENVQDKKD  387



>gb|AGB05602.1| sn-glycerol-3-phosphate acyltransferase [Camellia oleifera]
Length=386

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            +E E+D+GRP+KSLVVV+SWACLLI GA+KFFQ + LLS+WKG++ SA  L +VT+LMQI
Sbjct  292  REQEQDMGRPIKSLVVVISWACLLIFGALKFFQWTSLLSTWKGMTFSAIGLAIVTVLMQI  351

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
            LI+FSQ+ERS PAKV P   N   + +   + + +
Sbjct  352  LIQFSQSERSTPAKVTPVKPNNGGEPSRTGQDKHK  386



>ref|XP_006349549.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=388

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+E  +D+GRP+KSLVVV SWAC+LILG +KF Q++ LLSSWKG++ISAAL+ ++T+LM
Sbjct  291  FGEEKLQDIGRPIKSLVVVASWACILILGTIKFLQATALLSSWKGVAISAALMAIITVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            Q LI FS++ERS  AKVAPA     NQ   + ++ K  
Sbjct  351  QFLINFSKSERSTAAKVAPAKEKNVNQARGNGQEDKTH  388



>gb|ABP93351.1| lysophosphatidyl acyltransferase 2 [Helianthus annuus]
Length=385

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  513  DLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKFS  334
            D+GRP+KSLVVVVSWACLL+ G  KF Q S LLSSWKGL+ +AA LG+VT LMQILI+FS
Sbjct  299  DIGRPLKSLVVVVSWACLLVFGTFKFLQWSNLLSSWKGLTFTAAGLGIVTFLMQILIQFS  358

Query  333  QAERSVPAKVAPASTNTSN  277
            QAERS PAKVAPA ++  N
Sbjct  359  QAERSTPAKVAPARSSKGN  377



>ref|XP_002283340.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Vitis 
vinifera]
 emb|CBI29878.3| unnamed protein product [Vitis vinifera]
Length=387

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+   +D GRP+KSL+VV+SWACLLILGA+KF Q S LLSSWKG+S +A  L +VT+LM
Sbjct  291  FGEGEFQDTGRPIKSLLVVISWACLLILGALKFLQWSSLLSSWKGISFTAIGLAIVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
             ILIKFSQ+ERS PAKVAPA      + +   R +  
Sbjct  351  HILIKFSQSERSTPAKVAPAKPKNGGESSEPGRHKHH  387



>ref|XP_010088401.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
 gb|EXB35416.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
Length=528

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D GRP+KSL+VV SWACLL+ GA+KF Q S LLSS KGL+ +A  L +VT LMQ+
Sbjct  434  QELQ-DTGRPIKSLLVVTSWACLLVFGALKFLQWSSLLSSRKGLAFTAFGLAIVTALMQL  492

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            LI+FSQAERS PAKVAPA+     + +  +R+ K+ 
Sbjct  493  LIRFSQAERSTPAKVAPANPKNGGETSEAAREDKQH  528



>ref|XP_003535857.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN22374.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=383

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D GRP+KSLVVV+SWAC++++G VKF Q S LLSSWKG++ SA  LGVVT+LM I
Sbjct  291  QELQ-DTGRPIKSLVVVISWACVVVMGVVKFLQWSSLLSSWKGVAFSAFGLGVVTLLMHI  349

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKR  250
            LI FSQ+ERS P KVAPA +  S Q+ +   K+
Sbjct  350  LIMFSQSERSTPTKVAPAKSKNSEQLEARDNKQ  382



>ref|XP_004234840.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317926.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317927.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
Length=375

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+E  +D+GRP+KSLVVV SW+C+LILG +KF Q++ LLSSWKG++ISAAL+ ++T+LM
Sbjct  291  FGEEKLQDIGRPIKSLVVVASWSCILILGTIKFLQATALLSSWKGVAISAALMAIITVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNT  283
            QILI FS++ERS  AKVAPA   T
Sbjct  351  QILINFSKSERSTAAKVAPAKEKT  374



>ref|XP_010516384.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
Length=134

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG+++SA  LG++T+ MQ
Sbjct  37   GQQ-EQNIGRPIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGIALSALALGIITLCMQ  95

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA    ++Q  S S+   E+
Sbjct  96   ILIRSSQSERSTPAKVVPAKPKDNHQSESSSQTEVEK  132



>emb|CDY33810.1| BnaCnng07280D [Brassica napus]
Length=391

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E ++GRP+KSL VVVSWACLL LGA+KF   S L SS KG+++SA  LG++T+ MQ
Sbjct  293  GQK-EHNIGRPIKSLAVVVSWACLLTLGAMKFLHWSNLFSSLKGIALSALGLGIITLCMQ  351

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA     +Q  S S+   E+
Sbjct  352  ILIRSSQSERSTPAKVAPAKPKDKHQSGSSSQTEVEE  388



>emb|CAN83214.1| hypothetical protein VITISV_038716 [Vitis vinifera]
Length=390

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+   +D GRP+KSL+VV+SWACLLILGA+KF Q S LLSSWKG+S +A  L +VT+LM
Sbjct  291  FGEGEFQDTGRPIKSLLVVISWACLLILGALKFLQWSSLLSSWKGISFTAIGLAIVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQ  274
             ILIKFSQ+ERS PAKVAPA      +
Sbjct  351  HILIKFSQSERSTPAKVAPAKPKNGGE  377



>gb|ADC97479.1| lysophosphatidic acid acyltransferase [Brassica napus]
Length=391

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E ++GRP+KSL VVVSWACLL LGA+KF   S L SS KG+++SA  LG++T+ MQ
Sbjct  293  GQK-EHNIGRPIKSLAVVVSWACLLTLGAMKFLHWSNLFSSLKGIALSALGLGIITLCMQ  351

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA     +Q  S S+   E+
Sbjct  352  ILIRSSQSERSTPAKVAPAKPKDKHQSGSSSQTEVEE  388



>gb|AAF20003.1|AF213937_1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus dulcis]
Length=306

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +  GRP+KSL+VV +WACLLILGA+KF   S LLSSWKG++ SA  LGVVT+LM
Sbjct  211  FGDQQLKVTGRPLKSLLVVTAWACLLILGALKFLYWSSLLSSWKGIAFSALGLGVVTVLM  270

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            QILI+FSQ+ERS PA VAP  TN  N+  S  +  K+Q
Sbjct  271  QILIRFSQSERSTPAPVAP--TNNKNKGESSGKPEKQQ  306



>ref|XP_007145631.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
 gb|ESW17625.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
Length=383

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D GRP+KSLVVV+SWAC+++ GA+KF Q S LLSSWKG++ SA  LGVVT+LM I
Sbjct  291  QELQ-DTGRPIKSLVVVLSWACVVVTGALKFLQWSSLLSSWKGVAFSAIGLGVVTLLMHI  349

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKR  250
            LI+FSQAERS P+KVAPA +    ++ +   K+
Sbjct  350  LIQFSQAERSTPSKVAPAKSRNREELEARDNKQ  382



>ref|XP_006402859.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
 gb|ESQ44312.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
Length=389

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
            LGQ+ E+++GRP+KSL VVVSWACLL LGA+KF   + L SSWKG+++SA  LG++T+ M
Sbjct  291  LGQQ-EQNIGRPIKSLAVVVSWACLLTLGAMKFLHWAKLFSSWKGIALSALGLGIITLCM  349

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            QILI+ SQ+ERS PAKVAPA     +   S S+   E+
Sbjct  350  QILIRSSQSERSTPAKVAPAKPKDHHHSESASQTEMEK  387



>ref|NP_001280186.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Prunus mume]
 dbj|BAE48660.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus mume]
Length=386

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +  GRP+KSL+VV +WACLLILGA+KF   S LLSSWKG++ SA  LGVVT+LM
Sbjct  291  FGDQQLKVTGRPLKSLLVVTAWACLLILGALKFLYWSSLLSSWKGIAFSALGLGVVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            QILI+FSQ+ERS PA VAPA  N +N+  S  +  K+Q
Sbjct  351  QILIRFSQSERSTPASVAPA--NNNNKGESSGKPEKQQ  386



>gb|ABM92334.2| 1-acylglycerol-3-phosphate acyltransferase [Brassica juncea]
Length=390

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRPVKSL VVVSWACLL LGA+KF   S L SSWKG+++SA  LG++T+ MQ
Sbjct  292  GQK-EQNIGRPVKSLAVVVSWACLLTLGAMKFLHWSNLFSSWKGIALSAFGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA    ++Q    S+   E+
Sbjct  351  ILIRSSQSERSTPAKVAPAKPKDNHQSGPSSQTEVEE  387



>gb|ABU50327.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Helianthus annuus]
Length=382

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
             ++GRP+KSLVVVVSWACLL+LG  KF Q S LLSSWKGL+ +A  LG+VT LMQILI+F
Sbjct  297  HEIGRPLKSLVVVVSWACLLVLGIFKFLQWSNLLSSWKGLTFTAIGLGIVTFLMQILIQF  356

Query  336  SQAERSVPAKVAPASTNTSN  277
            SQ+ERS PAKVAP  ++  N
Sbjct  357  SQSERSTPAKVAPTRSSNGN  376



>sp|Q9XFW4.1|LPAT2_BRANA RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
napus]
 emb|CAB09138.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
napus]
Length=390

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VVVSWACLL LGA+KF   S L SSWKG+++SA  LG++T+ MQ
Sbjct  292  GQK-EQNIGRPIKSLAVVVSWACLLTLGAMKFLHWSNLFSSWKGIALSAFGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA    ++Q    S+   E+
Sbjct  351  ILIRSSQSERSTPAKVAPAKPKDNHQSGPSSQTEVEE  387



>ref|XP_007202144.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
 gb|EMJ03343.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
Length=386

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +  GRP KSL+VV +WACLLILGA+KF   S LLSSWKG++ SA  LGVVT+LM
Sbjct  291  FGDQQLKVTGRPPKSLLVVTAWACLLILGALKFLYWSSLLSSWKGIAFSALGLGVVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            QILI+FSQ+ERS PA VAP  TN +N+  S  +  K+Q
Sbjct  351  QILIRFSQSERSTPAPVAP--TNNNNKGESSGKPEKQQ  386



>emb|CAA90019.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Brassica napus]
Length=311

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWACLL LGA+KF   S L SSWKG+++SA  LG++T+ MQ
Sbjct  213  GQK-EQNIGRPIKSLAVVLSWACLLTLGAMKFLHWSNLFSSWKGIALSALGLGIITLCMQ  271

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA    ++Q    S+   E+
Sbjct  272  ILIRSSQSERSTPAKVAPAKPKDNHQSGPSSQTEVEE  308



>ref|XP_010504700.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
Length=134

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG+++SA  LG++T+ MQ
Sbjct  37   GQQ-EQNIGRPIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGIALSALALGIITLCMQ  95

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA     +   S S+   E+
Sbjct  96   ILIRSSQSERSTPAKVVPAKPKDHHNSESSSQTEVEK  132



>ref|XP_009104068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWACLL LGA+KF   S L SSWKG+++SA  LG++T+ MQ
Sbjct  292  GQK-EQNIGRPIKSLAVVLSWACLLTLGAMKFLHWSNLFSSWKGIALSALGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA    ++Q    S+   E+
Sbjct  351  ILIRSSQSERSTPAKVAPAKPKDNHQSGPSSQTEVEE  387



>emb|CDX67700.1| BnaA07g17400D [Brassica napus]
Length=391

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWACLL LGA+KF   S L SSWKG+++SA  LG++T+ MQ
Sbjct  293  GQK-EQNIGRPIKSLAVVLSWACLLTLGAMKFLHWSNLFSSWKGIALSALGLGIITLCMQ  351

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA    ++Q    S+   E+
Sbjct  352  ILIRSSQSERSTPAKVAPAKPKDNHQSGPSSQTEVEE  388



>ref|XP_004307568.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+   GRP KSLVVV SWACLL+ G++KF   S LLSS KG++ S   LG+VTILMQI
Sbjct  294  QELQ-STGRPWKSLVVVTSWACLLVFGSIKFLYWSSLLSSRKGIAFSLLGLGIVTILMQI  352

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            LI+FSQ+ERS PAKVAP   N   Q  S  +  K+Q
Sbjct  353  LIRFSQSERSTPAKVAPTKHNNGGQ--SSGKPTKQQ  386



>sp|Q6IWY1.1|LPAT2_BRAOL RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
oleracea]
 gb|AAT36638.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
oleracea]
Length=391

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++ RP+KSL VVVSWACLL LGA+KF   S L SS KG+++SA  LG++T+ MQ
Sbjct  293  GQK-EQNIDRPIKSLAVVVSWACLLTLGAMKFLHWSNLFSSLKGIALSALGLGIITLCMQ  351

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKVAPA     +Q  S S+   E+
Sbjct  352  ILIRSSQSERSTPAKVAPAKPKDKHQSGSSSQTEVEE  388



>gb|EYU20729.1| hypothetical protein MIMGU_mgv1a008164mg [Erythranthe guttata]
Length=383

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G++L+ D GRPVKSL+VV SWA LLILGA+KFFQ + L SSWKG++ SA  L ++T LM
Sbjct  291  FGEQLQ-DFGRPVKSLLVVSSWAILLILGALKFFQRASLFSSWKGITFSAIALALITFLM  349

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQ  274
            Q+LI+FSQ+ERS PAKV PA    S +
Sbjct  350  QVLIQFSQSERSTPAKVTPAKPKKSGE  376



>ref|XP_006293344.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
 gb|EOA26242.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
Length=363

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG+++SA  LG++T+ MQ
Sbjct  266  GQQ-EQNIGRPIKSLAVVLSWACILTLGAIKFLHWAQLFSSWKGIALSALALGIITLCMQ  324

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA      Q  S S+   E+
Sbjct  325  ILIRSSQSERSTPAKVVPAKPKDHQQSESSSQTEVEK  361



>emb|CAB41190.1| 1-acylcerol-3-phosphate acyltransferase-like protein [Arabidopsis 
thaliana]
Length=310

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG++ISA  LG++T+ MQ
Sbjct  213  GQQ-EQNIGRPIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGITISALGLGIITLCMQ  271

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA    ++   S S+   E+
Sbjct  272  ILIRSSQSERSTPAKVVPAKPKDNHHPESSSQTETEK  308



>gb|KJB36055.1| hypothetical protein B456_006G138600 [Gossypium raimondii]
Length=387

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+GRP+KSL+VV SWACL+  GA  F Q S LLSSWKG+++SA  L +VTILMQI+I F
Sbjct  297  QDIGRPIKSLLVVASWACLVAYGAYNFLQWSSLLSSWKGIALSAVGLAIVTILMQIMILF  356

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            SQ+ERS PAKVAP     +N  +S++R+ K+Q
Sbjct  357  SQSERSTPAKVAPGKPK-NNSESSEARRDKQQ  387



>ref|XP_010554846.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=387

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  519  ERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIK  340
            E+++GRP+KSL+VV SWAC+L  GA+KF Q S L SSWKG++IS   LGVVT+LMQ+LI+
Sbjct  295  EQNIGRPIKSLMVVSSWACMLTFGALKFLQWSKLFSSWKGIAISGIGLGVVTLLMQVLIR  354

Query  339  FSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
             SQ+ERS PAKVAP    ++   AS   + K++
Sbjct  355  SSQSERSTPAKVAPVKPRSNGDTASQPTEEKQK  387



>ref|XP_006351222.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=382

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G++  +++GRPVKS VV+VSWAC+++ GA+KF  S+ LLSSWKG++ISAALL VVT+LM
Sbjct  291  FGEQQLQNVGRPVKSFVVIVSWACIVLFGAIKFLHSTALLSSWKGVAISAALLAVVTLLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSN  277
            QILI+FSQ+ERS PAK +  + +++N
Sbjct  351  QILIRFSQSERSTPAKPSIVNQHSTN  376



>gb|AAM61033.1| 1-acylcerol-3-phosphate acyltransferase-like protein [Arabidopsis 
thaliana]
Length=389

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG++ISA  LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGITISALGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA    ++   S S+   E+
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKDNHHPESSSQTETEK  387



>ref|NP_567052.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
 sp|Q8LG50.2|LPAT2_ARATH RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Arabidopsis 
thaliana]
 gb|ABG48392.1| At3g57650 [Arabidopsis thaliana]
 gb|AEE79683.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
Length=389

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG++ISA  LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGITISALGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA    ++   S S+   E+
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKDNHHPESSSQTETEK  387



>ref|XP_007028850.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
 gb|EOY09352.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
Length=401

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +DLGRP+KSL+VV SWACL+  GA+KF Q S LLSSWKG++     L +VTILM ILI F
Sbjct  311  QDLGRPIKSLLVVASWACLMAYGALKFLQCSSLLSSWKGIAFFLVGLAIVTILMHILILF  370

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            SQ+ERS PAKVAP       +  S++R+ K+Q
Sbjct  371  SQSERSTPAKVAPGKPKNDGE-TSEARRDKQQ  401



>ref|XP_002876428.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52687.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VVVSWAC+L LGA+KF   + L SSWKG+++SA  LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVVSWACVLTLGAIKFLHWAQLFSSWKGITLSAVGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
            ILI+ SQ+ERS PAKV PA     N    +   + E
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKEHNHSEPEPSSQTE  386



>ref|XP_002323308.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
 gb|EEF05069.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
Length=435

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
             QEL+ D GR  KSLVVV SWACLLI GA+KF Q S LLSS +G++ + + L VVT+LM 
Sbjct  341  AQELQ-DHGRSKKSLVVVTSWACLLIFGALKFLQWSSLLSSRRGIAFTVSGLAVVTVLMH  399

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
            ILI+FSQ+ERS PAKVAPA T    + +     ++ 
Sbjct  400  ILIRFSQSERSTPAKVAPAKTKNEGKPSETGDDKQH  435



>ref|XP_010504698.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Camelina 
sativa]
Length=389

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG+++SA  LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGIALSALALGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA     +   S S+   E+
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKDHHNSESSSQTEVEK  387



>ref|XP_010257310.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nelumbo nucifera]
Length=387

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QE + D GRP+KSL+VV+SW+CLL+ GA KFF+ + LLSSWKG++ SAA L +VT+LM I
Sbjct  294  QEFQ-DTGRPIKSLLVVISWSCLLLFGAFKFFKWTSLLSSWKGVAFSAAGLAIVTLLMHI  352

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
             I FSQ+ERS P KVAP+   +  +++   R ++ 
Sbjct  353  FILFSQSERSTPTKVAPSRPKSGVELSVTGRDKQH  387



>ref|XP_009116469.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SW+CLLILGA+KF   S L SSWKG++ SA  LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVLSWSCLLILGAMKFLHWSNLFSSWKGIAFSALGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPAST-NTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA   +  N   S S+   E+
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKDNHNDSGSSSQTEVEK  388



>gb|ADC97478.1| lysophosphatidic acid acyltransferase [Brassica napus]
 gb|ADC97480.1| lysophosphatidic acid acyltransferase [Brassica napus]
 emb|CDY06085.1| BnaA09g36950D [Brassica napus]
 emb|CDX72008.1| BnaC08g28660D [Brassica napus]
Length=390

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SW+CLLILGA+KF   S L SSWKG++ SA  LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVLSWSCLLILGAMKFLHWSNLFSSWKGIAFSALGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPAST-NTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA   +  N   S S+   E+
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKDNHNDSGSSSQTEVEK  388



>ref|XP_003518108.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN05957.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=384

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D GRPVKSLVVV+ WAC+++ G VKF Q S LLSSWKG++ SA  LGVVT+LM I
Sbjct  291  QELQ-DTGRPVKSLVVVILWACVVVTGVVKFLQWSSLLSSWKGVAFSAFGLGVVTLLMHI  349

Query  348  LIKFSQAERSVPAKVAPA--STNTSNQVASDSRK  253
            LI FSQ+ERS P+KVAP   S N+    A D+++
Sbjct  350  LIMFSQSERSTPSKVAPTKKSKNSEQLEARDNKQ  383



>gb|ACU18782.1| unknown [Glycine max]
Length=297

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D GRP+KSL+VV+SWACL++ G+VKF Q S LLSSWKG++ SA  L VVT LMQI
Sbjct  214  QELQ-DTGRPIKSLLVVISWACLVVAGSVKFLQWSSLLSSWKGVAFSAFGLAVVTALMQI  272

Query  348  LIKFSQAERSVPAKVAPASTNT  283
            LI+FSQ+ERS PAK+ PA +  
Sbjct  273  LIQFSQSERSNPAKIVPAKSKN  294



>gb|KDP37345.1| hypothetical protein JCGZ_06799 [Jatropha curcas]
Length=385

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+ RP+KSLVVV SWAC+LI GA KF Q S L SSWKG+++SA+ L +VT+LMQ+LI+F
Sbjct  297  QDISRPIKSLVVVTSWACMLIFGAWKFLQWSSLFSSWKGIALSASALAIVTVLMQVLIRF  356

Query  336  SQAERSVPAKVAPASTNT  283
            SQ+E S PAKVAPA    
Sbjct  357  SQSEHSTPAKVAPAKQKN  374



>ref|XP_011078878.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
 ref|XP_011078879.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=386

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G++L+ + GRPVKSL+VV SWA LLILG +K  Q   L SSWKG+  SA  L V+TILM
Sbjct  291  FGEQLQ-NTGRPVKSLLVVSSWAILLILGTMKVIQWFSLFSSWKGIIFSAVALAVITILM  349

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            QILI+FSQ+ERS PAKVAPA   +  + +S SR  K Q
Sbjct  350  QILIQFSQSERSTPAKVAPAKHKSVTE-SSASRLDKHQ  386



>gb|ABN09946.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
 gb|ABN09947.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
Length=390

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL V +SW+CLLILGA+KF   S L SSWKG++ SA  LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVSLSWSCLLILGAMKFLHWSNLFSSWKGIAFSALGLGIITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPAST-NTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA   +  N   S S+   E+
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKDNHNDSGSSSQTEAEK  388



>ref|XP_003521190.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
1 [Glycine max]
 gb|KHN07393.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=377

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D GRP+KSL+VV+SWACL++ G+VKF Q S LLSSWKG++ SA  L VVT LMQI
Sbjct  294  QELQ-DTGRPIKSLLVVISWACLVVAGSVKFLQWSSLLSSWKGVAFSAFGLAVVTALMQI  352

Query  348  LIKFSQAERSVPAKVAPASTNT  283
            LI+FSQ+ERS PAK+ PA +  
Sbjct  353  LIQFSQSERSNPAKIVPAKSKN  374



>ref|XP_009345032.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G ++ +  GRP KSL+VV SW+CLLILGA+KF   S LLSSWKG+  S   L +VT+LM
Sbjct  291  FGDQILQPTGRPRKSLLVVASWSCLLILGALKFLHWSSLLSSWKGIGFSTFCLSIVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRK  247
            Q LI+FSQ+E S PA+VAP   N+  + +S+  K++
Sbjct  351  QFLIRFSQSEHSTPARVAPVKDNSKGESSSNLDKQQ  386



>emb|CDP10072.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+ L RD+GRP KSL+VVVSW+CLL  G +KF Q S LLSSWKGL++SA  L VVT++M
Sbjct  291  FGELLLRDIGRPKKSLLVVVSWSCLLAFGVLKFLQWSSLLSSWKGLTLSAVALLVVTLMM  350

Query  354  QILIKFSQAERSVPAKVAPA  295
            QILI+FSQ+ERS P KVAP 
Sbjct  351  QILIRFSQSERSTPGKVAPG  370



>ref|XP_008392182.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Malus 
domestica]
Length=386

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G ++ +  G+P KSL+VV SW+CLLILGA+KF   S LLSSWKG+  S   L +VT+LM
Sbjct  291  FGDQILQPTGQPRKSLLVVASWSCLLILGALKFLYRSSLLSSWKGIGFSTLGLSIVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRK  247
            Q LI+FSQ+ERS PA+VAPA  N+  + +S+  K++
Sbjct  351  QFLIRFSQSERSTPARVAPAKDNSKGESSSNLDKQQ  386



>gb|KFK35010.1| hypothetical protein AALP_AA5G222500 [Arabis alpina]
Length=389

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSLVVV+SWAC+L LGA+KF   + + SSWKG+++SA  LGVVT+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLVVVMSWACVLTLGAMKFLHWAQVFSSWKGIALSALGLGVVTLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQ  274
            ILI+ SQ+ERS PAK+ PA     + 
Sbjct  351  ILIRSSQSERSTPAKIVPAKPKVHHN  376



>gb|AEZ56251.1| plastid 1-acylglycerol-phosphate acyltransferase [Jatropha curcas]
Length=385

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+ RP+KSL VV SWAC+LI GA KF Q S L SSWKG+++SA+ L +VT+LMQ+LI+F
Sbjct  297  QDISRPIKSLXVVTSWACMLIFGAWKFLQWSSLFSSWKGIALSASALAIVTVLMQVLIRF  356

Query  336  SQAERSVPAKVAPASTNT  283
            SQ+E S PAKVAPA    
Sbjct  357  SQSEHSTPAKVAPAKQKN  374



>ref|XP_010516385.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516386.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516388.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010427647.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
Length=389

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWAC+L LGA+KF   + L SSWKG+++S   LG++T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGIALSGLALGIITLGMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ERS PAKV PA     +   S S+   E+
Sbjct  351  ILIRSSQSERSTPAKVVPAKPKDHHNSESSSQTEVEK  387



>ref|XP_011033303.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Populus euphratica]
Length=386

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
             QEL+ D GR  KSLVVV SWACLL+ G +KF Q S LLSS +G++ +   L VVT+LM 
Sbjct  292  AQELQ-DHGRSKKSLVVVTSWACLLVFGVLKFLQWSSLLSSRRGIAFTVLGLAVVTVLMH  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
            ILI+FSQ+ERS PAKVAPA T    + +     ++ 
Sbjct  351  ILIRFSQSERSTPAKVAPAKTKNEGKPSETGDDKQH  386



>ref|XP_003554183.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN26342.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=387

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            Q+L+ D GRP+KSL+VV+SW CL++ G+VKF Q S LLSSWKG++ SA  L VVT LMQI
Sbjct  294  QDLQ-DTGRPIKSLLVVISWVCLVVAGSVKFLQRSSLLSSWKGVAFSAFGLAVVTALMQI  352

Query  348  LIKFSQAERSVPAKVAPA-STNTSNQVASDSRKRKEQ  241
            LI+FSQ+ERS PAK+A A S N   Q+  ++R  K+Q
Sbjct  353  LIQFSQSERSNPAKIARAKSKNKGGQL--EARNDKQQ  387



>ref|XP_010265751.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nelumbo nucifera]
Length=387

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D GRP KSL+VV+SW+CLL+  A KF + S LLSSWKG++ SAA L +VTILM
Sbjct  291  FGDQEFQDTGRPKKSLLVVISWSCLLVFVAFKFCKWSSLLSSWKGIAFSAAGLSLVTILM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
             I I FSQ+ERS PAK+APA   +  + +  SR +++
Sbjct  351  HIFILFSQSERSTPAKIAPARPKSGGESSVTSRDKQQ  387



>ref|XP_006493900.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
Length=386

 Score = 81.3 bits (199),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ ++ RP KSL+VV+SWA L+I G +KF Q S LLSSWKG++ SA  LG+VT+LMQI
Sbjct  294  QELQ-EIPRPKKSLLVVISWASLVIFGVLKFLQWSSLLSSWKGIAFSAFGLGIVTVLMQI  352

Query  348  LIKFSQAERSVPAKVAPASTNTS--NQVASDSRK  253
            LI+FSQ+ERS PAKV P+  N+    Q   D  +
Sbjct  353  LIRFSQSERSTPAKVVPSKPNSKEPEQTTQDKHR  386


 Score = 26.6 bits (57),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKHNAEDT  
Sbjct  279  DALLDKHNAEDTFS  292



>ref|XP_006493899.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=413

 Score = 81.3 bits (199),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ ++ RP KSL+VV+SWA L+I G +KF Q S LLSSWKG++ SA  LG+VT+LMQI
Sbjct  321  QELQ-EIPRPKKSLLVVISWASLVIFGVLKFLQWSSLLSSWKGIAFSAFGLGIVTVLMQI  379

Query  348  LIKFSQAERSVPAKVAPASTNTS--NQVASDSRK  253
            LI+FSQ+ERS PAKV P+  N+    Q   D  +
Sbjct  380  LIRFSQSERSTPAKVVPSKPNSKEPEQTTQDKHR  413


 Score = 26.6 bits (57),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKHNAEDT  
Sbjct  306  DALLDKHNAEDTFS  319



>gb|AHC70248.1| lysophosphatidic acid acyltransferase [Sterculia foetida]
Length=387

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 6/105 (6%)
 Frame = -2

Query  540  RHLGQELERD-----LGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALL  376
            +H+ ++   D     LGRP+K L+VV SWAC +  GA+KF Q S LLSSWKG++ SA  L
Sbjct  284  KHIAEDTFSDQPLHYLGRPIKPLLVVTSWACFVAYGALKFLQWSSLLSSWKGIAFSAFGL  343

Query  375  GVVTILMQILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
             +VTILM ILI FSQ+ERS PAKVAP     ++Q   ++R+ K+Q
Sbjct  344  AIVTILMHILILFSQSERSTPAKVAPGKPK-NDQENLEARRDKQQ  387



>ref|XP_009334964.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009334965.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009340151.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+   GRP+KSL+VV SW+CLLILGA+KF   S LLSSWKG+  S   LG+VT+LMQ 
Sbjct  294  QELQTT-GRPLKSLLVVASWSCLLILGALKFLHWSSLLSSWKGIGFSTLGLGIVTVLMQF  352

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKRK  247
            LI+FSQ+E S PA V+PA   +  + +  + K++
Sbjct  353  LIRFSQSEHSTPAPVSPAKNVSKGESSGKADKQQ  386



>ref|XP_010672763.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=391

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D GRP+KSLVVV +W    +LG +KF   S LLSSWKG++ SAA LG++T+LM
Sbjct  291  FGDQFLQDSGRPLKSLVVVAAWVVTSVLGVMKFLHWSHLLSSWKGIAFSAAALGLITVLM  350

Query  354  QILIKFSQAERSVPAKVAPA---STNTSNQVASDSRKRKEQ  241
            Q++I+FSQ+ERS PAKVAPA   +T  S+  +SD ++ K+ 
Sbjct  351  QVMIQFSQSERSTPAKVAPAKPKNTGDSSSSSSDLKQHKQH  391



>ref|XP_006421452.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34692.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=349

 Score = 79.7 bits (195),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ ++ RP KSL+VV+SWA L+I G +KF Q S LLSSWKG++ SA  LG+VT+LMQI
Sbjct  256  QELQ-EIPRPKKSLLVVISWASLVIFGVLKFLQWSSLLSSWKGIAFSAFGLGIVTVLMQI  314

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
            LI+FSQ+ERS PAKV P+    S +    ++ ++ 
Sbjct  315  LIRFSQSERSTPAKVVPSKPKNSKEPEQTTQDKQR  349


 Score = 26.6 bits (57),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKHNAEDT  
Sbjct  241  DALLDKHNAEDTFS  254



>ref|XP_006421453.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34693.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=387

 Score = 79.7 bits (195),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ ++ RP KSL+VV+SWA L+I G +KF Q S LLSSWKG++ SA  LG+VT+LMQI
Sbjct  294  QELQ-EIPRPKKSLLVVISWASLVIFGVLKFLQWSSLLSSWKGIAFSAFGLGIVTVLMQI  352

Query  348  LIKFSQAERSVPAKVAPASTNTSNQ  274
            LI+FSQ+ERS PAKV P+    S +
Sbjct  353  LIRFSQSERSTPAKVVPSKPKNSKE  377


 Score = 26.6 bits (57),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKHNAEDT  
Sbjct  279  DALLDKHNAEDTFS  292



>ref|XP_011020321.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Populus 
euphratica]
Length=379

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ DLGRP KSLVVV SWACLLI GA+KF Q S LLSS KG++ + + L VVT+LM I
Sbjct  294  QELQ-DLGRPKKSLVVVTSWACLLISGALKFLQRSSLLSSRKGVAFAVSSLAVVTLLMYI  352

Query  348  LIKFSQAERSVPAKVAPA  295
            LI+FSQ+ERS  AKVA A
Sbjct  353  LIRFSQSERSTTAKVAAA  370



>ref|XP_002308046.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE91569.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=385

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ DLGRP KSLVVV SWACLLI GA+KF Q S LLSS KG++ + + L VVT+LM I
Sbjct  294  QELQ-DLGRPKKSLVVVTSWACLLISGALKFLQRSSLLSSRKGIAFAVSSLAVVTLLMYI  352

Query  348  LIKFSQAERSVPAKVAPA  295
            LI+FSQ+ERS  AKVA A
Sbjct  353  LIRFSQSERSTTAKVAAA  370



>ref|XP_010672762.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D GRP+KSLVVV +W    +LG +KF   S LLSSWKG++ SAA LG++T+LM
Sbjct  362  FGDQFLQDSGRPLKSLVVVAAWVVTSVLGVMKFLHWSHLLSSWKGIAFSAAALGLITVLM  421

Query  354  QILIKFSQAERSVPAKVAPA---STNTSNQVASDSRKRKEQ  241
            Q++I+FSQ+ERS PAKVAPA   +T  S+  +SD ++ K+ 
Sbjct  422  QVMIQFSQSERSTPAKVAPAKPKNTGDSSSSSSDLKQHKQH  462



>ref|XP_002526730.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|ACC59198.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ricinus communis]
 gb|EEF35644.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|AFR42413.1| A-class lysophosphatidate acyltransferase-2 [Ricinus communis]
Length=395

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D+GRP KSLVVV  W+CLLI G +KF Q S LLSSWKG+++S + L +VT+LM I
Sbjct  294  QELQ-DIGRPKKSLVVVTLWSCLLIFGTLKFLQWSSLLSSWKGIALSMSALAIVTVLMHI  352

Query  348  LIKFSQAERSVPAKVAPAS  292
            LI+FSQ+E S PA+VAPA+
Sbjct  353  LIRFSQSEHSTPAQVAPAN  371



>gb|AGO14579.1| A-class lysophosphatidate acyltransferase 2 isoform 1 [Echium 
pitardii]
Length=387

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -2

Query  540  RHLGQELERDL-----GRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALL  376
            +H+ ++   DL     GRP+KSLVVV  W C+LILG +KF Q S LLSSWKG+ IS   L
Sbjct  284  KHIAEDTFSDLPQQNIGRPLKSLVVVTCWGCMLILGIIKFLQRSMLLSSWKGIVISLVGL  343

Query  375  GVVTILMQILIKFSQAERSVPAKVAPA-STNTSNQVASDSRKRK  247
            G +T LM ILI+FSQ+ERS PAKV+P    N  +   S   KR+
Sbjct  344  GGITFLMHILIQFSQSERSTPAKVSPGRQKNVGSPSNSTDDKRQ  387



>gb|AGO14580.1| A-class lysophosphatidate acyltransferase 2 isoform 2 [Echium 
pitardii]
Length=387

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -2

Query  540  RHLGQELERDL-----GRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALL  376
            +H+ ++   DL     GRP+KSLVVV  W C+LILG +KF Q S LLSSWKGL IS   L
Sbjct  284  KHIAEDTFSDLPQQNIGRPLKSLVVVTCWGCMLILGIIKFLQRSMLLSSWKGLVISLVGL  343

Query  375  GVVTILMQILIKFSQAERSVPAKVAPA-STNTSNQVASDSRKRK  247
            G +T LM ILI+FSQ+ERS PAKV+P    N  +   S   KR+
Sbjct  344  GGITFLMHILIQFSQSERSTPAKVSPGRQKNVGSPSNSTDDKRQ  387



>emb|CDX88957.1| BnaA04g02290D [Brassica napus]
Length=384

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWACLL LGA+KF   S L SSWKG+++SA  LGV+T+ MQ
Sbjct  292  GQQ-EQNIGRPIKSLAVVLSWACLLTLGAIKFLHWSDLFSSWKGMALSALGLGVITLCMQ  350

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ER  PAK     TN  +   S S+   E+
Sbjct  351  ILIRSSQSERWTPAK-----TNDHHHAGSFSQTDVEK  382



>ref|XP_007162250.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
 gb|ESW34244.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
Length=387

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            +EL+ D GRP+KSL+V++SWACL++ G VKF Q S LLSSWKG++ SA  L VVT LMQI
Sbjct  294  KELQ-DTGRPIKSLLVMMSWACLVVAGFVKFLQRSSLLSSWKGVAFSAVGLAVVTALMQI  352

Query  348  LIKFSQAERSVPAKVAPASTNTSNQ  274
            +I+FSQ+ERS P K+AP  + +  +
Sbjct  353  MIQFSQSERSNPTKIAPVQSKSKGE  377



>ref|XP_009139024.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Brassica rapa]
Length=385

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = -2

Query  531  GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQ  352
            GQ+ E+++GRP+KSL VV+SWACLL LGA+KF   S L SSWKG+++SA  LGV+T+ MQ
Sbjct  293  GQQ-EQNIGRPIKSLAVVLSWACLLTLGAIKFLHWSDLFSSWKGMALSALGLGVITLCMQ  351

Query  351  ILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            ILI+ SQ+ER  PAK     TN  +   S S+   E+
Sbjct  352  ILIRSSQSERWTPAK-----TNDHHHAGSFSQTDVEK  383



>ref|XP_011075205.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Sesamum 
indicum]
Length=381

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G++L+ D  RPVKSL+VV  WA LLILG +K  Q   LLSS KG ++SA  L VVTILM
Sbjct  291  FGEQLQ-DTSRPVKSLLVVCCWAILLILGTLKVIQHYSLLSSRKGAALSAIALAVVTILM  349

Query  354  QILIKFSQAERSVPAKVAPASTNT  283
            QILI+FSQ+ERS PAKV P+ +  
Sbjct  350  QILIQFSQSERSTPAKVVPSKSRN  373



>gb|KCW90238.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=356

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            +EL+ D GRP+KSL+VV+SW CL+ +GA +F + +  LSSWKG++ S   L ++T+LM I
Sbjct  263  RELQ-DTGRPIKSLLVVISWTCLVGVGAWQFLRRTSFLSSWKGIAFSLISLAIITVLMHI  321

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            L+KFSQ+ERS PAKVAP+      + +S+  ++KE+
Sbjct  322  LVKFSQSERSTPAKVAPSKPKIDGE-SSNRVEKKEK  356



>gb|ACV73676.1| lysophosphatidic acid acyltransferase 2 [Tropaeolum majus]
Length=380

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 8/98 (8%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D+GRP+KSL+VV+SWACLLI GA+KF   S LLSSWKG+ ISA+ LG+VT+LM
Sbjct  291  FGDQDLQDIGRPLKSLLVVISWACLLISGALKFLIGSALLSSWKGIVISASGLGLVTVLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            Q LI FSQ+ERS  AK+  A+         + R+ K Q
Sbjct  351  QTLILFSQSERSTSAKIGSAN--------GEERRTKHQ  380



>ref|XP_010057561.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW90237.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=387

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D GRP+KSL+VV+SW CL+ +GA +F + +  LSSWKG++ S   L ++T+LM IL+KF
Sbjct  297  QDTGRPIKSLLVVISWTCLVGVGAWQFLRRTSFLSSWKGIAFSLISLAIITVLMHILVKF  356

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            SQ+ERS PAKVAP+      + +S+  ++KE+
Sbjct  357  SQSERSTPAKVAPSKPKIDGE-SSNRVEKKEK  387



>gb|KCW90236.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=395

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D GRP+KSL+VV+SW CL+ +GA +F + +  LSSWKG++ S   L ++T+LM IL+KF
Sbjct  305  QDTGRPIKSLLVVISWTCLVGVGAWQFLRRTSFLSSWKGIAFSLISLAIITVLMHILVKF  364

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            SQ+ERS PAKVAP+      + +S+  ++KE+
Sbjct  365  SQSERSTPAKVAPSKPKIDGE-SSNRVEKKEK  395



>gb|KEH41602.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=386

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            RDLGRP+KSL+VV++W C+++ G VK  Q S LLSSWKG++ S   L +VT LMQ LIKF
Sbjct  297  RDLGRPIKSLLVVITWICVVVAGTVKLLQWSSLLSSWKGVAFSVFSLAIVTALMQFLIKF  356

Query  336  SQAERSVPAKVAPASTNTSNQV-ASDSRKR  250
            SQ+ERS PAKV+P+ + +  ++ ASD ++ 
Sbjct  357  SQSERSNPAKVSPSKSKSREELQASDDKQE  386



>gb|KJB16431.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=301

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+GRP K L+VV SWAC++  GA+KF Q S LLSSW+G+++SA +L +VT LMQILI F
Sbjct  217  QDIGRPAKPLLVVCSWACIVGYGALKFLQQSSLLSSWRGIALSAFILAIVTFLMQILILF  276

Query  336  SQAERSVPAKVAPASTNTSNQV  271
            +Q+ERS PAKVA      + +V
Sbjct  277  TQSERSTPAKVAAGKPRMTGRV  298



>emb|CAA88620.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase (putative) [Limnanthes 
douglasii]
Length=377

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+GRP+KSLVVVVSW CLL LG VKF Q S LLSSWKG+ I+  +LG+VT+LM ILI+ 
Sbjct  297  QDIGRPMKSLVVVVSWMCLLCLGLVKFLQWSALLSSWKGMMITTFVLGIVTVLMHILIRS  356

Query  336  SQAERSVPAKVAPAST  289
            SQ+E S PAK     T
Sbjct  357  SQSEHSTPAKTRARQT  372



>gb|KHG04120.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Gossypium arboreum]
Length=381

 Score = 74.7 bits (182),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+GRP K L+VV SWAC++  GA+KF Q S LLSSW+G+++SA +L +VT LMQILI F
Sbjct  297  QDIGRPAKPLLVVCSWACIVGYGALKFLQRSSLLSSWRGIALSAFILAIVTFLMQILILF  356

Query  336  SQAERSVPAKVAPASTNTSNQV  271
            +Q+ERS PAKVA      + +V
Sbjct  357  TQSERSTPAKVAAGKPRMTGRV  378


 Score = 25.4 bits (54),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKH AEDT  
Sbjct  279  DKLLDKHRAEDTFS  292



>gb|KJB16432.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=350

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+GRP K L+VV SWAC++  GA+KF Q S LLSSW+G+++SA +L +VT LMQILI F
Sbjct  266  QDIGRPAKPLLVVCSWACIVGYGALKFLQQSSLLSSWRGIALSAFILAIVTFLMQILILF  325

Query  336  SQAERSVPAKVAPASTNTSNQV  271
            +Q+ERS PAKVA      + +V
Sbjct  326  TQSERSTPAKVAAGKPRMTGRV  347



>ref|XP_004136588.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 gb|KGN59338.1| hypothetical protein Csa_3G812100 [Cucumis sativus]
Length=388

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            ++LGRP+KSL+V +SWACLLILG++K  Q S  LSSWKGL+ SA  L +VT+LMQILI+F
Sbjct  297  QELGRPIKSLLVAISWACLLILGSLKLLQGSTFLSSWKGLTFSATGLAIVTVLMQILIRF  356

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            SQ+ERS PAKV P   NTS +   D R++ +Q
Sbjct  357  SQSERSTPAKVVPTKANTSGR-PLDPRQQPKQ  387



>ref|XP_004165747.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
Length=388

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            ++LGRP+KSL+V +SWACLLILG++K  Q S  LSSWKGL+ SA  L +VT+LMQILI+F
Sbjct  297  QELGRPIKSLLVAISWACLLILGSLKLLQGSTFLSSWKGLTFSATGLAIVTVLMQILIRF  356

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            SQ+ERS PAKV P   NTS +   D R++ +Q
Sbjct  357  SQSERSTPAKVVPTKANTSGR-PLDPRQQPKQ  387



>gb|KJB16430.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+GRP K L+VV SWAC++  GA+KF Q S LLSSW+G+++SA +L +VT LMQILI F
Sbjct  297  QDIGRPAKPLLVVCSWACIVGYGALKFLQQSSLLSSWRGIALSAFILAIVTFLMQILILF  356

Query  336  SQAERSVPAKVAPASTNTSNQV  271
            +Q+ERS PAKVA      + +V
Sbjct  357  TQSERSTPAKVAAGKPRMTGRV  378



>gb|KJB16433.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +D+GRP K L+VV SWAC++  GA+KF Q S LLSSW+G+++SA +L +VT LMQILI F
Sbjct  297  QDIGRPAKPLLVVCSWACIVGYGALKFLQQSSLLSSWRGIALSAFILAIVTFLMQILILF  356

Query  336  SQAERSVPAKVAPASTNTSNQV  271
            +Q+ERS PAKVA      + +V
Sbjct  357  TQSERSTPAKVAAGKPRMTGRV  378



>ref|XP_008443106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Cucumis 
melo]
Length=388

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            ++LGRP+KSL+V +SWACLLILG++K  Q S  LSSWKGL+ SA  L +VT+LMQILI+F
Sbjct  297  QELGRPIKSLLVAISWACLLILGSLKLLQGSTFLSSWKGLTFSATGLAIVTVLMQILIRF  356

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRKEQ  241
            SQ+ERS PAKV P   NTS     D R++ +Q
Sbjct  357  SQSERSTPAKVVPTKANTSGG-PLDPRQQPKQ  387



>ref|XP_004249199.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Solanum lycopersicum]
Length=382

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G++  +++GRPVKS VV+ SWAC+++ GA+KF  S+ LLSSWKG++ISAALL  VT+LM
Sbjct  291  FGEQQLQNVGRPVKSFVVIASWACIVLFGAIKFIHSTALLSSWKGVAISAALLAAVTLLM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSN  277
            QILI+FSQ+ERS PAK +  + +++N
Sbjct  351  QILIRFSQSERSTPAKQSTVNQHSTN  376



>ref|XP_007015031.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
 gb|EOY32650.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
Length=379

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -2

Query  525  ELE-RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            +LE +D+GRP KSL+VV+SW+CLL+LG +K FQ    L+SW+ ++ S   L +VTI+MQI
Sbjct  293  DLEYQDIGRPKKSLIVVISWSCLLLLGIIKLFQWFSFLASWEVIAFSVTFLVIVTIVMQI  352

Query  348  LIKFSQAERSVPAKV  304
            LI  S+++RS P KV
Sbjct  353  LIHSSESKRSTPPKV  367



>ref|XP_010524157.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
 ref|XP_010524167.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=382

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  519  ERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIK  340
            E+++GRPVKSLVVV SWAC+L  GA+KF Q S L S+WKG+ +S   LGVVT+LMQ+LI+
Sbjct  295  EQNIGRPVKSLVVVSSWACILTTGAMKFLQWSKLFSTWKGIGLSGVGLGVVTLLMQVLIR  354

Query  339  FSQAER  322
             SQ+ER
Sbjct  355  SSQSER  360



>ref|XP_006852430.1| hypothetical protein AMTR_s00021p00084240 [Amborella trichopoda]
 gb|ERN13897.1| hypothetical protein AMTR_s00021p00084240 [Amborella trichopoda]
Length=387

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G++L + +GRP K L+VV+ W+ +L+ G  +FF+ S +LS+WKG+   +A L  VT++M
Sbjct  291  FGEQLLQPIGRPKKPLLVVICWSAILLYGTFRFFKWSSVLSTWKGILFVSAGLLFVTLIM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRK  247
             + I FSQ+ERS P KVAP+  N  +     + K++
Sbjct  351  HVFILFSQSERSTPKKVAPSKDNNVSAPLQTNHKKE  386



>emb|CDP18472.1| unnamed protein product [Coffea canephora]
Length=377

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +    +GRP++SL+VV+SW C LI GAV FF+      SW  ++     L +V +LM
Sbjct  290  FGNKDNYHIGRPIRSLLVVISWTCFLIFGAVNFFE--WCPFSWGEIAFCTVFLALVVVLM  347

Query  354  QILIKFSQAERSVPAKVAPAST  289
            QILI FSQ+E+S P K +P ++
Sbjct  348  QILIVFSQSEQSTPVKESPRNS  369



>ref|XP_004493527.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=387

 Score = 67.8 bits (164),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -2

Query  504  RPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKFSQAE  325
            RP+KSLVV +SWA ++++G+VKF Q S +LSSWKG++ S   L VVT LM IL+ FSQAE
Sbjct  301  RPIKSLVVALSWAFVVVVGSVKFLQWSSMLSSWKGVAFSTFGLAVVTGLMHILVLFSQAE  360

Query  324  RSVPAKVAPASTNTSNQ  274
            RS PAKVAPA      +
Sbjct  361  RSNPAKVAPAKPKNKGE  377


 Score = 23.9 bits (50),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKH AEDT  
Sbjct  279  DALLDKHIAEDTFS  292



>ref|XP_003625177.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
Length=270

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D  RP+K L V +SW  +++ G+VKF Q S LLSSWKG++ S   L VVT LMQ+
Sbjct  177  QELQ-DSRRPIKPLAVALSWGFVVVAGSVKFLQWSSLLSSWKGVAFSTFGLAVVTGLMQV  235

Query  348  LIKFSQAERSVPAKVAPASTNTSNQ  274
            LI FSQAERS PAKVAPA      +
Sbjct  236  LILFSQAERSNPAKVAPAKPKNKEE  260



>gb|AFW60270.1| hypothetical protein ZEAMMB73_783506 [Zea mays]
Length=294

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            R +GRPVKSL+V + W+CLL+ GA++FF+ + LLS+W+G++ +AA + +VT LM + I F
Sbjct  216  RPIGRPVKSLLVTLFWSCLLLFGAIEFFKWTQLLSTWRGVAFTAAGMALVTGLMHVFIMF  275

Query  336  SQAERSVPAKVA  301
            SQAERS  AK A
Sbjct  276  SQAERSSSAKAA  287



>gb|KDO61278.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
 gb|KDO61279.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=309

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D+GRP KSL VVVSW+CLLI   VK FQ + +L+SW  ++ SA  L +V  +M
Sbjct  211  FGLQERQDIGRPKKSLFVVVSWSCLLIFILVKLFQWTSILASWAAIAFSAFFLLLVVGVM  270

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQV  271
            QILI+ S++E S P K+ P    T+ ++
Sbjct  271  QILIQSSESEHSTPLKITPHQDPTTERL  298



>ref|XP_003625176.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
 gb|AES81394.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=387

 Score = 66.6 bits (161),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D  RP+K L V +SW  +++ G+VKF Q S LLSSWKG++ S   L VVT LMQ+
Sbjct  294  QELQ-DSRRPIKPLAVALSWGFVVVAGSVKFLQWSSLLSSWKGVAFSTFGLAVVTGLMQV  352

Query  348  LIKFSQAERSVPAKVAPASTNTSNQ  274
            LI FSQAERS PAKVAPA      +
Sbjct  353  LILFSQAERSNPAKVAPAKPKNKEE  377


 Score = 23.9 bits (50),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKH AEDT  
Sbjct  279  DALLDKHVAEDTFS  292



>gb|AFK40266.1| unknown [Medicago truncatula]
Length=387

 Score = 66.6 bits (161),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            QEL+ D  RP+K L V +SW  +++ G+VKF Q S LLSSWKG++ S   L VVT LMQ+
Sbjct  294  QELQ-DSRRPIKPLAVALSWGFVVVAGSVKFLQWSSLLSSWKGVAFSTFGLAVVTGLMQV  352

Query  348  LIKFSQAERSVPAKVAPASTNTSNQ  274
            LI FSQAERS PAKVAPA      +
Sbjct  353  LILFSQAERSNPAKVAPAKPKNKEE  377


 Score = 23.9 bits (50),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = -3

Query  569  DNLLDKHNAEDTLD  528
            D LLDKH AEDT  
Sbjct  279  DALLDKHVAEDTFS  292



>gb|ACN28103.1| unknown [Zea mays]
 gb|AFW60269.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRPVKSL+V + W+CLL+ GA++FF+ + LLS+W+G++ +AA + 
Sbjct  284  KHLATGTFDEEIRPIGRPVKSLLVTLFWSCLLLFGAIEFFKWTQLLSTWRGVAFTAAGMA  343

Query  372  VVTILMQILIKFSQAERSVPAKVA  301
            +VT LM + I FSQAERS  AK A
Sbjct  344  LVTGLMHVFIMFSQAERSSSAKAA  367



>ref|XP_006470599.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
 gb|KDO61277.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=392

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D+GRP KSL VVVSW+CLLI   VK FQ + +L+SW  ++ SA  L +V  +M
Sbjct  294  FGLQERQDIGRPKKSLFVVVSWSCLLIFILVKLFQWTSILASWAAIAFSAFFLLLVVGVM  353

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQV  271
            QILI+ S++E S P K+ P    T+ ++
Sbjct  354  QILIQSSESEHSTPLKITPHQDPTTERL  381



>ref|XP_006470598.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=426

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D+GRP KSL VVVSW+CLLI   VK FQ + +L+SW  ++ SA  L +V  +M
Sbjct  328  FGLQERQDIGRPKKSLFVVVSWSCLLIFILVKLFQWTSILASWAAIAFSAFFLLLVVGVM  387

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRK  253
            QILI+ S++E S P K+ P    T+ ++   S K
Sbjct  388  QILIQSSESEHSTPLKITPHQDPTTERLLPISVK  421



>ref|XP_003575968.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Brachypodium distachyon]
Length=374

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            RH+      E  R +GRPVKSLVVV+SW+CLL+ GA +F Q + LLS+WKG+ +  A L 
Sbjct  284  RHIATGSFDEEIRPIGRPVKSLVVVLSWSCLLLYGAHRFLQWTQLLSTWKGVILFVAGLA  343

Query  372  VVTILMQILIKFSQAERSVPAKVA  301
            +VT +M + I FSQ+ERS  AK A
Sbjct  344  MVTAVMHVFIMFSQSERSSSAKAA  367



>ref|XP_002443267.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
 gb|EES17105.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
Length=374

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            R +GRPVKSL+VV+SW+CLL+ GA +F Q + LLS+WKG+ + AA L +VT +M + I F
Sbjct  296  RPIGRPVKSLLVVLSWSCLLLYGAYRFLQWTQLLSTWKGIILLAAGLALVTGVMHVFIMF  355

Query  336  SQAERSVPAKVAPASTNTSNQVASD  262
            SQ+ERS  A+ A       N+V  D
Sbjct  356  SQSERSSSARAA------RNRVKKD  374



>emb|CBI21663.3| unnamed protein product [Vitis vinifera]
Length=402

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +   ++GRP KSL VV++W+CLL+LG VKFFQ S LLSSW+G++   A L  +T++M
Sbjct  292  FGIQEYHNIGRPKKSLFVVITWSCLLLLGLVKFFQWSLLLSSWEGITSLLAFLVFITVIM  351

Query  354  QILIKFSQAERS  319
             ILI FSQ+ERS
Sbjct  352  HILIIFSQSERS  363



>ref|XP_002268451.2| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Vitis vinifera]
Length=386

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +   ++GRP KSL VV++W+CLL+LG VKFFQ S LLSSW+G++   A L  +T++M
Sbjct  297  FGIQEYHNIGRPKKSLFVVITWSCLLLLGLVKFFQWSLLLSSWEGITSLLAFLVFITVIM  356

Query  354  QILIKFSQAERS  319
             ILI FSQ+ERS
Sbjct  357  HILIIFSQSERS  368



>ref|XP_004979811.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Setaria italica]
Length=374

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRPVKSL+V + WACLL+ GA++FF+ + LLS+W+G++ +AA + 
Sbjct  284  KHLATGTFDEEIRPIGRPVKSLLVTLFWACLLLFGAIQFFKWTQLLSTWRGVAFTAAGMA  343

Query  372  VVTILMQILIKFSQAERSVPAKVA  301
            +VT +M + I FSQAERS  A+ A
Sbjct  344  LVTGVMHVFIMFSQAERSSSARAA  367



>ref|XP_009773917.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nicotiana sylvestris]
Length=377

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D+GRP KSL+VV+ W+C L   A+KFF+      SW G+   A  L  V +LM
Sbjct  290  FGDQECQDIGRPKKSLLVVICWSCFLFFSAIKFFE--WCPFSWGGVVFCAVFLVFVLVLM  347

Query  354  QILIKFSQAERSVPAKVAPASTNTSN  277
            QILI FS++E+S+  KV P +T   N
Sbjct  348  QILIVFSKSEKSIAPKVPPRNTLEEN  373



>tpg|DAA42326.1| TPA: hypothetical protein ZEAMMB73_334173 [Zea mays]
Length=294

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            R +GRPVKSL+V + W+CLL+ GA++FF+ + LLS+W+G++ +AA + +VT +M + I F
Sbjct  216  RPIGRPVKSLLVTLFWSCLLLFGAIEFFKWTQLLSTWRGVAFTAAGMALVTGVMHVFIMF  275

Query  336  SQAERSVPAKVA  301
            SQAERS  A+ A
Sbjct  276  SQAERSSSARAA  287



>ref|NP_001148618.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG32258.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRPVKSL+V + W+CLL+ GA++FF+ + LLS+W+G++ +AA + 
Sbjct  284  KHLATGTFDEEIRPIGRPVKSLLVTLFWSCLLLFGAIEFFKWTQLLSTWRGVAFTAAGMA  343

Query  372  VVTILMQILIKFSQAERSVPAKVA  301
            +VT +M + + FSQAERS  AK A
Sbjct  344  LVTGVMHVFVMFSQAERSSSAKAA  367



>dbj|BAJ84894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -2

Query  510  LGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKFSQ  331
            +GRPVKSL+VV+SW+CLL+ GA +F Q + LLS+WKG+ + A  L +VT +M + I FSQ
Sbjct  298  IGRPVKSLMVVLSWSCLLLYGAHRFLQWTQLLSTWKGVILFATGLAMVTAVMHVFIMFSQ  357

Query  330  AERSVPAKVA  301
            AERS  AK A
Sbjct  358  AERSSSAKAA  367



>gb|KCW51192.1| hypothetical protein EUGRSUZ_J00779 [Eucalyptus grandis]
Length=308

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G E  +D+GRP+KSL+VV  W+CLL+ G V+FF  S LL+SW+G+ I  A L +VT+ M
Sbjct  219  FGTEQRQDIGRPIKSLLVVSFWSCLLVYGVVEFFLWSALLTSWEGVMIVVAALVLVTLAM  278

Query  354  QILIKFSQAERSVPAK  307
            QILI+ S++ERS P +
Sbjct  279  QILIQSSESERSTPVE  294



>ref|NP_001105919.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 sp|Q41745.1|LPAT_MAIZE RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
PLS1; AltName: Full=Phospholipid synthesis protein 1 [Zea mays]
 emb|CAA82638.1| 1-acyl-glycerol-3-phosphate acyltransferase (putative) [Zea mays]
 gb|ACG37259.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG40468.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACR38397.1| unknown [Zea mays]
 tpg|DAA42327.1| TPA: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea 
mays]
Length=374

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRPVKSL+V + W+CLL+ GA++FF+ + LLS+W+G++ +AA + 
Sbjct  284  KHLATGTFDEEIRPIGRPVKSLLVTLFWSCLLLFGAIEFFKWTQLLSTWRGVAFTAAGMA  343

Query  372  VVTILMQILIKFSQAERSVPAKVA  301
            +VT +M + I FSQAERS  A+ A
Sbjct  344  LVTGVMHVFIMFSQAERSSSARAA  367



>ref|XP_010031802.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Eucalyptus grandis]
Length=380

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G E  +D+GRP+KSL+VV  W+CLL+ G V+FF  S LL+SW+G+ I  A L +VT+ M
Sbjct  291  FGTEQRQDIGRPIKSLLVVSFWSCLLVYGVVEFFLWSALLTSWEGVMIVVAALVLVTLAM  350

Query  354  QILIKFSQAERSVPAK  307
            QILI+ S++ERS P +
Sbjct  351  QILIQSSESERSTPVE  366



>gb|EMS63864.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Triticum 
urartu]
Length=347

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -2

Query  510  LGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKFSQ  331
            +GRPVKSL+VV+SW+C L+ GA +F Q + LLS+WKG+ + A+ L +VT +M + I FSQ
Sbjct  271  IGRPVKSLMVVLSWSCFLLYGAHRFLQWTQLLSTWKGVILFASGLAMVTAVMHVFIMFSQ  330

Query  330  AERSVPAKVA  301
            AERS  AK A
Sbjct  331  AERSSSAKAA  340



>gb|EYU39879.1| hypothetical protein MIMGU_mgv1a010933mg [Erythranthe guttata]
Length=297

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
             E  +D GRPVKSLVVV S A LLILGA+K  Q   LLS+W G++ISA  LGV+T+LMQI
Sbjct  212  DEQLQDTGRPVKSLVVVCSLAILLILGALKVIQRFSLLSTWTGVTISAVALGVITVLMQI  271

Query  348  LIKFSQAERSVPAKVAPASTNTSNQVAS  265
            LI+FSQ+ERS P KV P  T   N V S
Sbjct  272  LIQFSQSERSTPPKVGP--TTPRNGVES  297



>ref|XP_006446108.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59348.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=310

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D+GRP KSL VVVSW+CLLI   VK FQ + +L+SW  ++ SA  L +V  +M
Sbjct  211  FGLQERQDIGRPKKSLFVVVSWSCLLIFILVKLFQWTSILASWAAIAFSAFFLLLVVGVM  270

Query  354  QILIKFSQAERSVPA-KVAPASTNTSNQV  271
            QILI+ S++E S P  K+ P    T+ ++
Sbjct  271  QILIQSSESEHSTPPLKITPHQDPTTERL  299



>ref|XP_006446109.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59349.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=390

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G +  +D+GRP KSL VVVSW+CLLI   VK FQ + +L+SW  ++ SA  L +V  +M
Sbjct  291  FGLQERQDIGRPKKSLFVVVSWSCLLIFILVKLFQWTSILASWAAIAFSAFFLLLVVGVM  350

Query  354  QILIKFSQAERSVPA-KVAPASTNTSNQVASDSRK  253
            QILI+ S++E S P  K+ P    T+ ++   S K
Sbjct  351  QILIQSSESEHSTPPLKITPHQDPTTERLLPISVK  385



>ref|XP_002451179.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
 gb|EES10167.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
Length=374

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRPVKSL+V + W+ LL+ GA+KFF+ + LLS+W+G++ +AA + 
Sbjct  284  KHLATGTFDEEIRPIGRPVKSLLVTLFWSFLLLFGAIKFFKWTQLLSTWRGVAFTAAGMA  343

Query  372  VVTILMQILIKFSQAERSVPAKVA  301
            +VT +M + I FSQAERS  AK A
Sbjct  344  LVTGVMHVFIMFSQAERSSSAKAA  367



>ref|XP_010102333.1| Xanthine dehydrogenase [Morus notabilis]
 gb|EXB93294.1| Xanthine dehydrogenase [Morus notabilis]
Length=1731

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -2

Query  525  ELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQIL  346
            ELE ++GRP KSL+VVV W CL++ G VK FQ S LLSSW+G++IS ALL +VT +MQIL
Sbjct  295  ELE-EIGRPKKSLIVVVCWLCLIVYGIVKLFQWSSLLSSWQGIAISGALLLLVTAVMQIL  353

Query  345  IKFSQAERSVPAK  307
            +  S++ERS P  
Sbjct  354  VHSSESERSTPTD  366



>ref|XP_011080283.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=377

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 7/85 (8%)
 Frame = -2

Query  540  RHL-----GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALL  376
            RHL     G E+  D+GRP KSL+VV++W+ +LIL  +K  +      SW  +      L
Sbjct  283  RHLATNTFGDEIRHDIGRPKKSLLVVLTWSSILILAIIKVLE--CFPFSWGEIVFCVVFL  340

Query  375  GVVTILMQILIKFSQAERSVPAKVA  301
             +VT LMQILI FSQ+E S P KV+
Sbjct  341  ALVTTLMQILIVFSQSEHSTPPKVS  365



>ref|XP_004250948.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Solanum lycopersicum]
Length=377

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -2

Query  540  RHL-----GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALL  376
            RHL     G +  +D+GRP KSL+VV+ W+C L L A+KFF+      SW G+   A  L
Sbjct  283  RHLATGTFGDQECQDIGRPKKSLMVVICWSCFLFLSAIKFFE--WCPFSWGGVVFCAVFL  340

Query  375  GVVTILMQILIKFSQAERSVPAKVAPASTNTSN  277
             +V +LMQILI FS++E S   KV P ST   N
Sbjct  341  VLVLVLMQILIVFSKSENSTAPKVPPPSTLKEN  373



>ref|XP_010545584.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
 ref|XP_010545585.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
Length=380

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
             D+GRPVK L+V  +W  LL+ G  K  Q    ++SWK + +SA LL V TI+MQ+LI+ 
Sbjct  297  HDIGRPVKPLIVFTTWFSLLVFGGFKLLQWLSTVASWKIICLSAFLLVVTTIMMQVLIQS  356

Query  336  SQAERSVPAK  307
            S +ERS PAK
Sbjct  357  SDSERSTPAK  366



>ref|XP_008450418.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis melo]
Length=380

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 7/86 (8%)
 Frame = -2

Query  513  DLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKFS  334
            D+GRP KSL+VV+ W+C+L  G VKFFQ S LLSSW+G+++SAALL ++ ++MQ+L+  S
Sbjct  298  DIGRPKKSLLVVLCWSCILAYGIVKFFQWSALLSSWEGIALSAALLILIILVMQLLVHSS  357

Query  333  QAERSVPAKVAPASTNTSNQVASDSR  256
            ++ RS P        N S+Q  +  R
Sbjct  358  ESTRSTP-------INVSSQYNAKER  376



>gb|ABA94922.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAH01342.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 10/97 (10%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRPVKSL+V + W+CLL+ GAVK F  + LLS+WKG+  +   L 
Sbjct  284  KHLATGTFDEEIRPIGRPVKSLLVTLFWSCLLLYGAVKLFLWTQLLSTWKGVGFTGLGLA  343

Query  372  VVTILMQILIKFSQAERSVPAKVAPASTNTSNQVASD  262
            +VT +M + I FSQ+ERS  AK A       N+V  D
Sbjct  344  LVTAVMHVFIMFSQSERSSSAKAA------RNRVKKD  374



>gb|EEC68515.1| hypothetical protein OsI_36790 [Oryza sativa Indica Group]
Length=374

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 10/97 (10%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRPVKSL+V + W+CLL+ GAVK F  + LLS+WKG+  +   L 
Sbjct  284  KHLATCTFDEEIRPIGRPVKSLLVTLFWSCLLLYGAVKLFLWTQLLSTWKGVGFTGLGLA  343

Query  372  VVTILMQILIKFSQAERSVPAKVAPASTNTSNQVASD  262
            +VT +M + I FSQ+ERS  AK A       N+V  D
Sbjct  344  LVTAVMHVFIMFSQSERSSSAKAA------RNRVKKD  374



>ref|XP_004139036.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 ref|XP_004154631.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 gb|KGN66490.1| hypothetical protein Csa_1G613620 [Cucumis sativus]
Length=380

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  513  DLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKFS  334
            D+GRP KSL+VV+ W+C+L  G VKFFQ S LLSSW+G+++SA LL ++ ++MQ+L+  S
Sbjct  298  DIGRPKKSLLVVLCWSCILAYGIVKFFQWSALLSSWEGIALSAGLLILIILVMQLLVHSS  357

Query  333  QAERSVPAKVAPASTNTSN  277
            ++ RS P  V+   T    
Sbjct  358  ESTRSTPIIVSSQDTTKER  376



>ref|XP_009375057.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Pyrus 
x bretschneideri]
Length=380

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            Q+L+ ++GRP+KSL+VVV W+ LL  G  KF Q S LL+SW+G++ SA  L +V I+MQI
Sbjct  294  QQLQ-NIGRPIKSLIVVVLWSILLAYGIYKFVQWSALLASWEGIAFSATFLVLVVIVMQI  352

Query  348  LIKFSQAERSVPAKVAP  298
            LI+ S++ERS P  V P
Sbjct  353  LIQSSESERSTPLTVPP  369



>ref|XP_008813483.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Phoenix dactylifera]
Length=374

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G EL R LGRP+KSL+VV  W+ LL   A +FF+ S LLS+WKG++ S A L +VT++M
Sbjct  291  FGDEL-RPLGRPIKSLLVVAFWSSLLSYAAFRFFKWSALLSTWKGVAFSTAGLLLVTVVM  349

Query  354  QILIKFSQAERSVPAKVAPASTN  286
             + I FSQ+ERS  A+ A + T 
Sbjct  350  HVFILFSQSERSTMARAACSRTK  372



>gb|EPS68644.1| lysophosphatidic acid acyltransferase, partial [Genlisea aurea]
Length=365

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            +E  +D+GRPVK L+VV  W  LL LG +   Q   +LSSWKG++     LGVVTILMQI
Sbjct  295  EEQLQDVGRPVKPLLVVGFWGILLALGTMNLIQRFAILSSWKGVAFCGIALGVVTILMQI  354

Query  348  LIKFSQAERSV  316
            LI+FSQ+E+S 
Sbjct  355  LIQFSQSEKST  365



>ref|XP_003577308.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Brachypodium distachyon]
Length=374

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            R +GRP+KSL+V + W+CLL+ G  +FF+ + LLS+WKG+  +A  L +VT +M + I F
Sbjct  296  RPIGRPMKSLLVTLFWSCLLLYGVTEFFKWAQLLSTWKGVGFTAVGLALVTGIMHVFIMF  355

Query  336  SQAERSVPAKVA  301
            SQ+ERS  A+ A
Sbjct  356  SQSERSSSARAA  367



>ref|XP_010906759.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Elaeis guineensis]
Length=374

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+EL R +GRP+KSL+VV  W+ LL     +FF+ S LLS+WKG++ S A L +VTI+M
Sbjct  291  FGEEL-RPIGRPIKSLLVVAFWSFLLSYVVFRFFKWSALLSTWKGVAFSTAGLLLVTIVM  349

Query  354  QILIKFSQAERSVPAKVAPASTNTS  280
             + I FSQ+ERS  AK A   T+T 
Sbjct  350  HVFILFSQSERSSMAKAARRRTHTD  374



>ref|XP_006663068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Oryza brachyantha]
Length=374

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 10/97 (10%)
 Frame = -2

Query  540  RHLG----QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLG  373
            +HL      E  R +GRP+KSL+V + W+CLL+ GA+K F  + LLS+WKG+  +   L 
Sbjct  284  KHLATGTFDEEIRPIGRPIKSLLVTLFWSCLLLYGAIKLFLWTQLLSTWKGVGFTVLGLA  343

Query  372  VVTILMQILIKFSQAERSVPAKVAPASTNTSNQVASD  262
            +VT +M + I FSQ+ERS  AK A       N+V  D
Sbjct  344  LVTAVMHVFIMFSQSERSSSAKAA------RNRVKKD  374



>ref|XP_008227141.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Prunus mume]
Length=380

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            Q+L+ ++GRP+KSL+VV+ W+CLL  G  KF   S LLSSWKG++ SA  L ++ I+MQI
Sbjct  294  QQLQ-NIGRPMKSLIVVLLWSCLLGYGIFKFVPWSSLLSSWKGIAFSATFLVLIVIVMQI  352

Query  348  LIKFSQAERSVPAKVAPAS  292
            LI  S++ERS P  + P  
Sbjct  353  LIHSSESERSTPLNITPQD  371



>ref|XP_009615949.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Nicotiana tomentosiformis]
Length=377

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -2

Query  540  RHL-----GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALL  376
            RHL     G +  +D+GRP KSL+VV+ W+C L   A+KFF+      SW G+   A  L
Sbjct  283  RHLVTGTFGDQECQDIGRPKKSLLVVICWSCFLFFSAIKFFE--WCPFSWGGVVFCAVFL  340

Query  375  GVVTILMQILIKFSQAERSVPAKVAPASTNTSN  277
             +V +LMQILI FS++E+S+  KV   +T   N
Sbjct  341  VLVLVLMQILIVFSKSEKSIAPKVPSPNTLEEN  373



>ref|XP_007214575.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
 gb|EMJ15774.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
Length=380

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            Q+L+ ++GRP+KSL+VV+ W+CL+  G  KF   S LLSSWKG++ SA  L +V I+MQI
Sbjct  294  QQLQ-NIGRPMKSLIVVLLWSCLIGYGIFKFVPWSSLLSSWKGIAFSATFLVLVVIVMQI  352

Query  348  LIKFSQAERSVPAKVAP  298
            LI  S++ERS P  + P
Sbjct  353  LIHSSESERSTPLNITP  369



>ref|XP_010909860.1| PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-glycerol-3-phosphate 
acyltransferase PLS1-like [Elaeis guineensis]
Length=373

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G EL R +GRP+KSL+VV  W+ LL   A +FF+ S LLS+WKG++ S   L +VT++M
Sbjct  290  FGDEL-RPIGRPIKSLLVVAFWSSLLSYAAFRFFKWSALLSTWKGVAFSTVGLLLVTVVM  348

Query  354  QILIKFSQAERSVPAKVAPASTN  286
             + I FSQ+ERS  A+ A + T 
Sbjct  349  HVFILFSQSERSTMARAARSRTK  371



>ref|XP_010479592.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
              + RP+K L+VV+ W CLLI G  K FQ   +++SWK + +    L + TI MQ+LI+ 
Sbjct  297  HQINRPIKPLIVVIIWLCLLIYGGFKLFQWLSVVASWKIIFLLVFFLVIATITMQVLIQS  356

Query  336  SQAERSVPAK  307
            S+++RS PAK
Sbjct  357  SESQRSTPAK  366



>ref|XP_006361745.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Solanum tuberosum]
Length=377

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 7/93 (8%)
 Frame = -2

Query  540  RHL-----GQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALL  376
            RHL     G +  +D+GRP KSL+VV+ W+C L   A+KFF+      SW G+   A  L
Sbjct  283  RHLATGTFGDQECQDIGRPKKSLMVVICWSCFLFFSAIKFFE--WCPFSWGGVVFCAVFL  340

Query  375  GVVTILMQILIKFSQAERSVPAKVAPASTNTSN  277
             +V +LMQILI  S++E+S   KV P +T   N
Sbjct  341  VLVLVLMQILIVSSKSEKSTAPKVPPPNTLKEN  373



>ref|XP_009395596.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  519  ERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIK  340
            +R +GRP+KSL+V   W+C+L  G  +FF+ S LLS+WKG++IS A L +V I+M I I 
Sbjct  295  QRQIGRPLKSLLVFAFWSCVLSYGVFRFFKWSELLSTWKGVAISTAALLLVVIVMHIFIL  354

Query  339  FSQAERSVPAKVA  301
            FSQ+ERS  A+ A
Sbjct  355  FSQSERSSTARAA  367



>ref|XP_009387255.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=374

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            R LG+P+KSL+VVV W+ LL     +FF+ + LLS+WKG+ ++ A + +VTI+M I I+F
Sbjct  296  RQLGQPIKSLLVVVFWSSLLSYATFRFFKWTELLSTWKGVVLTIAAVILVTIVMHIFIRF  355

Query  336  SQAERSVPAKVA  301
            SQ+ERS  A+ A
Sbjct  356  SQSERSSTARAA  367



>ref|XP_009387254.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=389

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            R LG+P+KSL+VVV W+ LL     +FF+ + LLS+WKG+ ++ A + +VTI+M I I+F
Sbjct  311  RQLGQPIKSLLVVVFWSSLLSYATFRFFKWTELLSTWKGVVLTIAAVILVTIVMHIFIRF  370

Query  336  SQAERSVPAKVA  301
            SQ+ERS  A+ A
Sbjct  371  SQSERSSTARAA  382



>gb|ADE75797.1| unknown [Picea sitchensis]
Length=385

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 52/97 (54%), Gaps = 3/97 (3%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G+ L + + RP+K L+V++ W+ LL + A K  +                +L   T++M
Sbjct  291  FGEHLYQPIQRPLKPLLVILGWSSLLSVPAYKLLRHLLSSWQGSLCLTVGFIL--TTLVM  348

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQVASDSRKRKE  244
             I I+FSQ+E S PAKVAPA   T+ +V    ++ K+
Sbjct  349  NIFIRFSQSEHSTPAKVAPAK-ETNGRVLPIGKEDKD  384



>ref|XP_010500700.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
              + RP+K L+VV+ W C+LI G  K FQ   +++SWK + +    L + TI MQ+LI+ 
Sbjct  297  HQINRPIKPLIVVIIWLCILIYGGFKLFQWLSVVASWKIIFLLVFFLVIATITMQVLIQS  356

Query  336  SQAERSVPAK  307
            S+++RS PAK
Sbjct  357  SESQRSTPAK  366



>gb|KFK35863.1| hypothetical protein AALP_AA4G046700 [Arabis alpina]
Length=376

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -2

Query  510  LGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKFSQ  331
            + RP+KSL+VV+ W CLL+ G  K FQ   +++SWK + +   +L + T  MQILI+ S+
Sbjct  299  ISRPIKSLIVVIIWLCLLMYGGFKLFQWLSMVASWKIICLFIVVLVIATTTMQILIQSSE  358

Query  330  AERSVPAK  307
            + RS PAK
Sbjct  359  SHRSTPAK  366



>ref|XP_002298406.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE83211.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=382

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSA-ALLGVVTILMQILIK  340
            +D+GRP KSL V++ W+ LL    V+ FQ   L  +   +   + A L +VTI+MQILI+
Sbjct  297  QDIGRPKKSLFVMIFWSSLLAYATVRLFQWLSLFLASWEVITFSIAFLFLVTIIMQILIQ  356

Query  339  FSQAERSVPAKVAPASTNTSNQV  271
             S++ERS PA     S  T  ++
Sbjct  357  SSESERSTPATNFTLSEGTRQRL  379



>ref|XP_011006209.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X3 [Populus euphratica]
Length=340

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSA-ALLGVVTILMQILIK  340
            +D+GRP KSL V++ W+ LL    V+ FQ   L  +   +   + A L +VTI+MQILI+
Sbjct  255  QDIGRPKKSLFVMIFWSSLLAYATVRLFQWLSLFLASWEVVAFSIAFLFLVTIIMQILIQ  314

Query  339  FSQAERSVPAKVAPASTNTSNQV  271
             S++ERS PA     S  T  ++
Sbjct  315  SSESERSTPAANFTLSEGTRQRL  337



>ref|XP_010461958.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Camelina 
sativa]
Length=376

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
              + RP+K L++V+ W CLLI G  K FQ   +++SWK + +    L + TI MQ+LI+ 
Sbjct  297  HQINRPIKPLILVIIWLCLLIYGGFKLFQWLSVVASWKIIFLLVFFLVIATITMQVLIQS  356

Query  336  SQAERSVPAK  307
            S+++RS PAK
Sbjct  357  SESQRSTPAK  366



>ref|XP_011006207.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X1 [Populus euphratica]
Length=382

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSA-ALLGVVTILMQILIK  340
            +D+GRP KSL V++ W+ LL    V+ FQ   L  +   +   + A L +VTI+MQILI+
Sbjct  297  QDIGRPKKSLFVMIFWSSLLAYATVRLFQWLSLFLASWEVVAFSIAFLFLVTIIMQILIQ  356

Query  339  FSQAERSVPAKVAPASTNTSNQV  271
             S++ERS PA     S  T  ++
Sbjct  357  SSESERSTPAANFTLSEGTRQRL  379



>ref|XP_011006208.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X2 [Populus euphratica]
Length=382

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSA-ALLGVVTILMQILIK  340
            +D+GRP KSL V++ W+ LL    V+ FQ   L  +   +   + A L +VTI+MQILI+
Sbjct  297  QDIGRPKKSLFVMIFWSSLLAYATVRLFQWLSLFLASWEVVAFSIAFLFLVTIIMQILIQ  356

Query  339  FSQAERSVPAKVAPASTNTSNQV  271
             S++ERS PA     S  T  ++
Sbjct  357  SSESERSTPAANFTLSEGTRQRL  379



>ref|XP_002894307.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70566.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
Length=376

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -2

Query  525  ELE-RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            +LE   + RP+K L+VV+ W CLLI G  K  Q   +++SWK + +    L + TI MQ+
Sbjct  293  DLEVHQINRPIKPLIVVIIWLCLLIFGGFKLLQWLSIVASWKIILLFVFFLVIATITMQV  352

Query  348  LIKFSQAERSVPAK  307
            LI+ S+++RS PAK
Sbjct  353  LIQSSESQRSTPAK  366



>ref|XP_002513487.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|EEF48890.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
Length=381

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
               +  + +GRP KSL VV+ W+ LLI G V  FQ    L+SW+ LS S  LL +VTI+M
Sbjct  291  FSDQKHQHIGRPKKSLFVVIFWSNLLIFGIVMSFQFLSFLNSWQVLSFSVTLLVLVTIVM  350

Query  354  QILIKFSQAERSVPAKVAPASTNTSNQ  274
            QILI  S++E S P    P     S+Q
Sbjct  351  QILIHSSESEHSTP----PPKLTFSDQ  373



>ref|XP_006304715.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
 gb|EOA37613.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
Length=376

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
              + RP+K L+VV+ W CLLI G  K  Q   L++SWK + +    L + TI MQ+LI+ 
Sbjct  297  HQINRPIKPLIVVIIWLCLLIYGGFKLLQWLSLVASWKIIFLFVFFLVIATITMQVLIQS  356

Query  336  SQAERSVPAK  307
            S+++RS PAK
Sbjct  357  SESQRSTPAK  366



>ref|XP_008377433.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Malus 
domestica]
Length=380

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            Q+L+ ++GRP+KSL+VVV W+ LL  G  KF Q S LL+SW+G++ SA  L ++ I+MQI
Sbjct  294  QQLQ-NIGRPIKSLIVVVFWSILLAYGIYKFVQWSALLTSWQGIAFSATFLVLIGIIMQI  352

Query  348  LIKFSQAERSVPAKVAPAS  292
            LI  S++E   P  V P  
Sbjct  353  LILSSESEHYTPLTVPPKD  371



>ref|XP_009144912.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Brassica 
rapa]
 emb|CDY29625.1| BnaA05g15450D [Brassica napus]
Length=376

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
              + RP+K L+VV+ W CLL+ G  K  Q   +++SW+ + +   +L + TI MQ+LI+ 
Sbjct  297  HQINRPIKPLIVVIVWVCLLMYGGFKLLQWLSMVASWEIICLFVVILVIATITMQVLIQS  356

Query  336  SQAERSVPAK  307
            S++ RS PAK
Sbjct  357  SESHRSTPAK  366



>emb|CDY35563.1| BnaC05g27180D [Brassica napus]
Length=376

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
              + RP+K L+VV+ W CLL+ G  K  Q   +++SW+ + +   +L + TI MQ+LI+ 
Sbjct  297  HQINRPIKPLIVVIVWVCLLMYGGFKLLQWLSMVASWEIICLFVVILVIATITMQVLIQS  356

Query  336  SQAERSVPAK  307
            S++ RS PAK
Sbjct  357  SESHRSTPAK  366



>ref|XP_008801930.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Phoenix dactylifera]
Length=374

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -2

Query  534  LGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILM  355
             G EL R +GRP+KSL+VV  W+ LL     +FF+ S LLS+WKG++ S A L +VTI+M
Sbjct  291  FGDEL-RPIGRPIKSLLVVAFWSSLLSYVVFRFFKWSALLSTWKGVAFSTAGLLLVTIVM  349

Query  354  QILIKFSQAERSVPAKVAPASTN  286
             + I FSQAERS  A+ A   TN
Sbjct  350  HVFILFSQAERSSMARAARRRTN  372



>ref|XP_008363723.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Malus domestica]
Length=171

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 53/74 (72%), Gaps = 4/74 (5%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            +++GRP KSL+VV+ W+ LL  G  KF Q S LL+SW+G++ SA  L ++ I+MQILI+ 
Sbjct  88   QNIGRPTKSLIVVILWSILLAYGIYKFVQCSALLASWEGIAFSATFLVLIVIVMQILIQS  147

Query  336  SQAERS----VPAK  307
            S++ERS    VP K
Sbjct  148  SESERSTALTVPQK  161



>ref|XP_002894308.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70567.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
              + RP+K L+VV+ W CLLI G  K FQ   L++SWK + +    L + TI MQ+L++ 
Sbjct  297  HQINRPIKPLIVVIIWLCLLIYGGFKLFQWLSLVASWKIILLFVFFLVIATITMQVLVQT  356

Query  336  SQAERSVPAK  307
            S+++R  PAK
Sbjct  357  SESQRFTPAK  366



>ref|XP_010673625.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=343

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = -2

Query  537  HLGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTIL  358
            + G +  +D+G P +SL+V++ W+CLL +G   FF  + L S+W+G+ ISAA L +V + 
Sbjct  250  NFGNKEIQDIGLPKQSLIVMIVWSCLLSVGTFAFFLWTRLFSTWQGIIISAAFLLLVIVT  309

Query  357  MQILIKFSQAE---RSVPAKVAPASTNTSN  277
            MQ+LI FS++E    SVP K     +   N
Sbjct  310  MQVLILFSRSEPSIDSVPVKTPQKDSTREN  339



>ref|XP_010673624.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=383

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = -2

Query  537  HLGQELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTIL  358
            + G +  +D+G P +SL+V++ W+CLL +G   FF  + L S+W+G+ ISAA L +V + 
Sbjct  290  NFGNKEIQDIGLPKQSLIVMIVWSCLLSVGTFAFFLWTRLFSTWQGIIISAAFLLLVIVT  349

Query  357  MQILIKFSQAE---RSVPAKVAPASTNTSN  277
            MQ+LI FS++E    SVP K     +   N
Sbjct  350  MQVLILFSRSEPSIDSVPVKTPQKDSTREN  379



>ref|XP_009414749.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  519  ERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIK  340
            +R +GRP+KSL+VV  W  LL     +FF+ + LLS+WKG++++ A L +VT++M I I+
Sbjct  295  QRQIGRPMKSLLVVAFWFSLLSYATFRFFKWTELLSTWKGVALTTAALLMVTMIMHIFIR  354

Query  339  FSQAERSV  316
            FSQ+E S 
Sbjct  355  FSQSEHST  362



>ref|XP_008363635.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Malus domestica]
Length=385

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 5/78 (6%)
 Frame = -2

Query  528  QELERDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQI  349
            Q+L+ ++GRP KSL+VV+ W+ LL  G  KF Q S LL+SW+G++ SA  L ++ I+MQI
Sbjct  299  QQLQ-NIGRPTKSLIVVILWSILLAYGIYKFVQCSALLASWEGIAFSATFLVLIVIVMQI  357

Query  348  LIKFSQAERS----VPAK  307
            LI+ S++ERS    VP K
Sbjct  358  LIQSSESERSTALTVPQK  375



>ref|XP_002526731.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35645.1| conserved hypothetical protein [Ricinus communis]
Length=157

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  293  LAGATFAGTDRSA*ENLISICMRIVTTPRRAAEIDRPFHDDRSPEDWKNFTAPRISRHAH  472
            L+ AT+AG + S  +  I++ ++ V   R   +   PFHDD S E W+NF  P+IS+H H
Sbjct  3    LSRATWAGVECSECKKRINMFIKTVMFERADTDNAIPFHDDESDEHWRNFKVPKISKHDH  62



>ref|XP_004513649.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=386

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = -2

Query  516  RDLGRPVKSLVVVVSWACLLILGAVKFFQssgllsswkglsiSAALLGVVTILMQILIKF  337
            RDL RP+KSL+VV++W C+++  +VK  Q S LLSSWKG++ S   L +VT+LMQ+LI F
Sbjct  297  RDLVRPIKSLLVVITWVCVVVWASVKLLQWSSLLSSWKGVAFSVFGLAIVTVLMQVLIMF  356

Query  336  SQAERSVPAKVAPASTNTSNQVASDSRKRK  247
            SQ+ERS PAKV+P+      ++     K++
Sbjct  357  SQSERSNPAKVSPSKPKNREELQGSDDKQE  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515