BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049P02

Length=597
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    230   6e-69   Nicotiana tomentosiformis
ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         228   4e-68   Nicotiana sylvestris
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   226   3e-67   Sesamum indicum [beniseed]
gb|KHF97947.1|  hypothetical protein F383_10892                         223   7e-66   Gossypium arboreum [tree cotton]
gb|AID55377.1|  glycoside hydrolase family 9 B5                         221   2e-65   Gossypium hirsutum [American cotton]
gb|ADU15552.1|  EG                                                      221   2e-65   Gossypium hirsutum [American cotton]
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   221   3e-65   Eucalyptus grandis [rose gum]
emb|CDP07412.1|  unnamed protein product                                221   3e-65   Coffea canephora [robusta coffee]
gb|KJB58121.1|  hypothetical protein B456_009G195400                    216   5e-65   Gossypium raimondii
ref|XP_010244092.1|  PREDICTED: endoglucanase 24-like                   220   5e-65   Nelumbo nucifera [Indian lotus]
gb|KJB58119.1|  hypothetical protein B456_009G195400                    216   1e-64   Gossypium raimondii
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   218   2e-64   Solanum tuberosum [potatoes]
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    216   1e-63   Solanum lycopersicum
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    216   1e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB58120.1|  hypothetical protein B456_009G195400                    216   1e-63   Gossypium raimondii
gb|KJB58118.1|  hypothetical protein B456_009G195400                    216   1e-63   Gossypium raimondii
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                   216   2e-63   Citrus sinensis [apfelsine]
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                   216   3e-63   Citrus sinensis [apfelsine]
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg             216   3e-63   Citrus clementina [clementine]
ref|XP_010104437.1|  Endoglucanase 24                                   215   5e-63   Morus notabilis
ref|XP_007017776.1|  EG isoform 2                                       214   6e-63   Theobroma cacao [chocolate]
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  214   7e-63   Ricinus communis
ref|XP_007017775.1|  EG isoform 1                                       214   1e-62   
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                214   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         214   1e-62   Populus trichocarpa [western balsam poplar]
emb|CDP04111.1|  unnamed protein product                                202   1e-62   Coffea canephora [robusta coffee]
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    213   2e-62   Cucumis sativus [cucumbers]
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        213   2e-62   Cucumis melo [Oriental melon]
dbj|BAF42037.1|  cellulase2                                             212   6e-62   Pyrus communis
ref|XP_009378180.1|  PREDICTED: endoglucanase 2-like                    212   6e-62   Pyrus x bretschneideri [bai li]
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                    211   1e-61   Populus euphratica
gb|AGV22125.1|  endo-1,4-beta-glucanase 3                               210   3e-61   Betula luminifera [liang ye hua]
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   210   3e-61   Glycine max [soybeans]
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                   210   5e-61   Prunus mume [ume]
ref|XP_011045112.1|  PREDICTED: endoglucanase 2                         209   6e-61   Populus euphratica
gb|KDP36939.1|  hypothetical protein JCGZ_08230                         209   9e-61   Jatropha curcas
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             209   1e-60   Phaseolus vulgaris [French bean]
ref|XP_002276739.1|  PREDICTED: endoglucanase 10                        208   1e-60   Vitis vinifera
ref|XP_008372790.1|  PREDICTED: endoglucanase 24-like                   208   2e-60   
gb|KJB14408.1|  hypothetical protein B456_002G123700                    207   3e-60   Gossypium raimondii
ref|XP_008364934.1|  PREDICTED: endoglucanase 10-like                   207   4e-60   
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        207   5e-60   Glycine max [soybeans]
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    206   1e-59   
gb|KHN45917.1|  Endoglucanase 2                                         207   1e-59   Glycine soja [wild soybean]
ref|XP_004500948.1|  PREDICTED: endoglucanase 10-like                   206   2e-59   Cicer arietinum [garbanzo]
ref|XP_010536354.1|  PREDICTED: endoglucanase 10-like                   205   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                         205   3e-59   Malus domestica [apple tree]
ref|XP_002307711.1|  glycosyl hydrolase family 9 family protein         204   8e-59   Populus trichocarpa [western balsam poplar]
gb|AFZ78647.1|  korrigan                                                204   8e-59   Populus tomentosa [Chinese white poplar]
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg                202   2e-58   Erythranthe guttata [common monkey flower]
gb|KHN00484.1|  Endoglucanase 24                                        201   4e-58   Glycine soja [wild soybean]
gb|EPS64495.1|  hypothetical protein M569_10284                         202   5e-58   Genlisea aurea
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   201   8e-58   Glycine max [soybeans]
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    201   1e-57   Eucalyptus grandis [rose gum]
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     200   1e-57   Eucalyptus grandis [rose gum]
ref|XP_011100152.1|  PREDICTED: endoglucanase 24-like                   200   2e-57   
ref|XP_006435158.1|  hypothetical protein CICLE_v10003402mg             199   2e-57   
gb|AID55379.1|  glycoside hydrolase family 9 B7                         199   3e-57   Gossypium hirsutum [American cotton]
gb|KJB63540.1|  hypothetical protein B456_010G005200                    199   3e-57   Gossypium raimondii
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                    198   8e-57   Camelina sativa [gold-of-pleasure]
gb|KDO84821.1|  hypothetical protein CISIN_1g036398mg                   198   8e-57   Citrus sinensis [apfelsine]
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     198   8e-57   Medicago truncatula
ref|XP_003603741.1|  Endoglucanase                                      198   1e-56   
ref|XP_003629333.1|  Endoglucanase                                      198   1e-56   Medicago truncatula
ref|XP_007156152.1|  hypothetical protein PHAVU_003G262600g             198   1e-56   Phaseolus vulgaris [French bean]
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                         198   1e-56   
ref|XP_009103373.1|  PREDICTED: endoglucanase 2                         198   2e-56   Brassica rapa
emb|CDY66396.1|  BnaAnng22170D                                          198   2e-56   Brassica napus [oilseed rape]
emb|CDY43425.1|  BnaC07g14920D                                          197   2e-56   Brassica napus [oilseed rape]
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         197   3e-56   Brassica rapa
ref|XP_010539853.1|  PREDICTED: endoglucanase 10                        197   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_011462352.1|  PREDICTED: endoglucanase 2-like                    197   4e-56   Fragaria vesca subsp. vesca
emb|CDY29381.1|  BnaA06g14150D                                          196   6e-56   Brassica napus [oilseed rape]
ref|XP_009398708.1|  PREDICTED: endoglucanase 24-like                   194   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg             194   3e-55   
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                   194   3e-55   Citrus sinensis [apfelsine]
ref|XP_011043209.1|  PREDICTED: endoglucanase 2-like                    194   4e-55   Populus euphratica
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                   194   4e-55   Prunus mume [ume]
ref|NP_173423.1|  glycosyl hydrolase 9B5                                194   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KDP46724.1|  hypothetical protein JCGZ_06512                         194   5e-55   Jatropha curcas
ref|XP_004291374.1|  PREDICTED: endoglucanase 10-like                   193   7e-55   Fragaria vesca subsp. vesca
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   193   9e-55   Cicer arietinum [garbanzo]
ref|XP_010113364.1|  Endoglucanase 24                                   193   9e-55   
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                   193   1e-54   Elaeis guineensis
ref|XP_010649048.1|  PREDICTED: endoglucanase 24-like                   192   1e-54   Vitis vinifera
ref|XP_006840111.1|  hypothetical protein AMTR_s00224p00023160          185   1e-54   
ref|XP_007046716.1|  EG                                                 192   1e-54   
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             192   1e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    193   2e-54   Citrus sinensis [apfelsine]
ref|XP_009386441.1|  PREDICTED: endoglucanase 24-like                   192   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                    191   3e-54   Arabis alpina [alpine rockcress]
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                         191   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg             191   4e-54   Capsella rubella
emb|CDY44194.1|  BnaC05g15510D                                          196   9e-54   Brassica napus [oilseed rape]
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 190   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             190   2e-53   
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein                189   2e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                   188   5e-53   Phoenix dactylifera
ref|XP_010935039.1|  PREDICTED: endoglucanase 24-like                   188   5e-53   Elaeis guineensis
ref|XP_011083520.1|  PREDICTED: endoglucanase 10                        187   1e-52   Sesamum indicum [beniseed]
gb|AFZ78646.1|  korrigan                                                187   2e-52   Populus tomentosa [Chinese white poplar]
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    186   3e-52   Solanum tuberosum [potatoes]
gb|EEC84946.1|  hypothetical protein OsI_32163                          186   6e-52   Oryza sativa Indica Group [Indian rice]
gb|EEE70113.1|  hypothetical protein OsJ_30126                          185   7e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063771.1|  Os09g0533900                                       185   7e-52   
ref|XP_008788648.1|  PREDICTED: endoglucanase 24                        185   9e-52   Phoenix dactylifera
ref|XP_002462729.1|  hypothetical protein SORBIDRAFT_02g030990          184   2e-51   Sorghum bicolor [broomcorn]
gb|KJB43353.1|  hypothetical protein B456_007G195700                    184   2e-51   Gossypium raimondii
ref|XP_009128120.1|  PREDICTED: endoglucanase 10                        183   4e-51   Brassica rapa
ref|NP_001145749.1|  hypothetical protein                               182   8e-51   Zea mays [maize]
ref|XP_006661478.1|  PREDICTED: endoglucanase 24-like                   182   9e-51   
ref|XP_010530451.1|  PREDICTED: endoglucanase 2-like                    182   1e-50   
ref|XP_004957464.1|  PREDICTED: endoglucanase 24-like                   181   3e-50   Setaria italica
emb|CDY39048.1|  BnaA02g17370D                                          181   4e-50   Brassica napus [oilseed rape]
ref|XP_003578508.1|  PREDICTED: endoglucanase 24                        180   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    180   5e-50   Solanum lycopersicum
ref|XP_003563568.1|  PREDICTED: endoglucanase 18-like                   179   1e-49   Brachypodium distachyon [annual false brome]
gb|EAZ38281.1|  hypothetical protein OsJ_22659                          178   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058583.1|  Os06g0715300                                       178   2e-49   
gb|EAZ02358.1|  hypothetical protein OsI_24462                          178   3e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010416457.1|  PREDICTED: endoglucanase 10-like                   178   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006390284.1|  hypothetical protein EUTSA_v10018397mg             178   4e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006302134.1|  hypothetical protein CARUB_v10020139mg             178   5e-49   Capsella rubella
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    177   5e-49   Nicotiana tomentosiformis
gb|ABK24648.1|  unknown                                                 177   6e-49   Picea sitchensis
ref|XP_002530743.1|  endo-1,4-beta-glucanase, putative                  175   7e-49   
gb|EMT32027.1|  Endoglucanase 24                                        176   9e-49   
ref|XP_010471690.1|  PREDICTED: endoglucanase 10                        177   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002889037.1|  hypothetical protein ARALYDRAFT_895440             176   1e-48   Arabidopsis lyrata subsp. lyrata
ref|NP_177697.1|  glycosyl hydrolase 9B7                                176   1e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ93299.1|  predicted protein                                      176   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM63477.1|  endo-beta-1,4-glucanase, putative                       176   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428595.1|  PREDICTED: endoglucanase 10-like                   176   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002439027.1|  hypothetical protein SORBIDRAFT_10g030140          175   4e-48   Sorghum bicolor [broomcorn]
dbj|BAK04397.1|  predicted protein                                      174   7e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                    174   7e-48   Nicotiana sylvestris
gb|EMS54236.1|  Endoglucanase 18                                        173   1e-47   Triticum urartu
emb|CDY47506.1|  BnaAnng09040D                                          172   3e-47   Brassica napus [oilseed rape]
ref|XP_006656489.1|  PREDICTED: endoglucanase 18-like                   171   1e-46   Oryza brachyantha
ref|XP_004966453.1|  PREDICTED: endoglucanase 18-like                   170   4e-46   Setaria italica
ref|XP_009106216.1|  PREDICTED: endoglucanase 10-like                   169   6e-46   Brassica rapa
emb|CDX73186.1|  BnaC06g36340D                                          168   2e-45   
ref|NP_001288527.1|  uncharacterized protein LOC103626453 precursor     165   3e-44   Zea mays [maize]
ref|XP_002961546.1|  hypothetical protein SELMODRAFT_77612              165   4e-44   
ref|XP_002971269.1|  hypothetical protein SELMODRAFT_94888              165   4e-44   
ref|NP_001066668.2|  Os12g0428200                                       162   1e-43   
gb|ABA97969.1|  Glycosyl hydrolase family 9 protein, expressed          162   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ20312.1|  hypothetical protein OsJ_35923                          152   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001763275.1|  predicted protein                                  152   7e-40   
ref|XP_001781646.1|  predicted protein                                  148   1e-38   
ref|XP_002966695.1|  hypothetical protein SELMODRAFT_144066             142   4e-36   
ref|XP_002978046.1|  hypothetical protein SELMODRAFT_417952             142   7e-36   Selaginella moellendorffii
gb|KHN34290.1|  Endoglucanase 24                                        135   7e-34   Glycine soja [wild soybean]
gb|EPS65630.1|  hypothetical protein M569_09145                         132   2e-32   Genlisea aurea
ref|XP_010457267.1|  PREDICTED: endoglucanase 1-like                    124   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003611061.1|  Cellulase                                          130   5e-32   Medicago truncatula
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg                130   7e-32   Erythranthe guttata [common monkey flower]
gb|KEH24407.1|  glycosyl hydrolase family 9 protein                     125   1e-31   Medicago truncatula
gb|KEH27425.1|  endo-1,4-beta-glucanase                                 127   1e-31   Medicago truncatula
gb|KDP25211.1|  hypothetical protein JCGZ_20367                         129   2e-31   Jatropha curcas
gb|AFK41115.1|  unknown                                                 123   2e-31   Medicago truncatula
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                   129   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003611058.1|  Endo-1 4-beta-glucanase                            127   3e-31   
gb|KDP25379.1|  hypothetical protein JCGZ_20535                         127   5e-31   Jatropha curcas
gb|KEH27424.1|  endo-1,4-beta-glucanase                                 127   6e-31   Medicago truncatula
ref|XP_010231817.1|  PREDICTED: endoglucanase 14-like                   127   6e-31   
ref|XP_003611057.1|  Endo-1 4-beta-glucanase                            127   8e-31   Medicago truncatula
ref|XP_006847867.1|  hypothetical protein AMTR_s00029p00087270          128   8e-31   
ref|XP_010666165.1|  PREDICTED: endoglucanase 14-like                   127   9e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004511554.1|  PREDICTED: endoglucanase-like                      127   1e-30   Cicer arietinum [garbanzo]
ref|XP_010069895.1|  PREDICTED: endoglucanase 17                        127   1e-30   Eucalyptus grandis [rose gum]
ref|XP_009403726.1|  PREDICTED: endoglucanase 9-like isoform X1         125   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403727.1|  PREDICTED: endoglucanase 9-like isoform X2         126   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       126   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006836842.1|  hypothetical protein AMTR_s00099p00070580          126   2e-30   Amborella trichopoda
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                   127   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010531476.1|  PREDICTED: endoglucanase 23-like                   126   2e-30   Tarenaya hassleriana [spider flower]
dbj|BAL41418.1|  endo-1,4-beta-glucanase                                126   2e-30   Allium sativum f. pekinense
ref|XP_010088306.1|  Endoglucanase 17                                   126   2e-30   Morus notabilis
pir||JA0174  cellulase (EC 3.2.1.4) - kidney bean (fragment)            119   2e-30
ref|XP_002977531.1|  hypothetical protein SELMODRAFT_417347             125   2e-30   
ref|XP_006359861.1|  PREDICTED: endoglucanase 17-like                   125   2e-30   Solanum tuberosum [potatoes]
emb|CDY41954.1|  BnaA01g05260D                                          125   2e-30   Brassica napus [oilseed rape]
emb|CAF18445.1|  endo-1,4-beta-D-glucanase KORRIGAN                     122   3e-30   Pisum sativum [garden pea]
ref|NP_001051192.1|  Os03g0736300                                       126   3e-30   
ref|XP_010934144.1|  PREDICTED: endoglucanase 8-like                    125   3e-30   
gb|KHN38485.1|  Endoglucanase 11                                        125   3e-30   Glycine soja [wild soybean]
ref|XP_009334150.1|  PREDICTED: endoglucanase 11-like                   125   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_003519454.1|  PREDICTED: endoglucanase 11                        125   4e-30   
ref|XP_007142327.1|  hypothetical protein PHAVU_008G270900g             125   4e-30   Phaseolus vulgaris [French bean]
ref|XP_009144504.1|  PREDICTED: endoglucanase 23                        125   4e-30   Brassica rapa
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg                125   4e-30   Erythranthe guttata [common monkey flower]
ref|NP_001234882.1|  endo-1,4-beta-glucanase precursor                  125   4e-30   Solanum lycopersicum
ref|XP_006283596.1|  hypothetical protein CARUB_v10004652mg             125   4e-30   Capsella rubella
ref|XP_006388089.1|  hypothetical protein POPTR_0347s002202g            120   4e-30   
ref|XP_006411695.1|  hypothetical protein EUTSA_v10025010mg             125   4e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010436996.1|  PREDICTED: endoglucanase 23-like                   125   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003538279.1|  PREDICTED: endoglucanase                           125   5e-30   Glycine max [soybeans]
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                            125   5e-30   Medicago truncatula
ref|XP_002975128.1|  hypothetical protein SELMODRAFT_415162             124   5e-30   
ref|XP_003576683.2|  PREDICTED: endoglucanase 4-like                    124   6e-30   
ref|XP_010481246.1|  PREDICTED: endoglucanase 1                         124   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003616918.1|  Endoglucanase                                      124   6e-30   Medicago truncatula
ref|XP_010431848.1|  PREDICTED: endoglucanase 23                        124   6e-30   Camelina sativa [gold-of-pleasure]
gb|AFK38997.1|  unknown                                                 124   6e-30   Medicago truncatula
ref|NP_001142480.1|  uncharacterized protein LOC100274698               120   6e-30   
emb|CDY22400.1|  BnaA06g37220D                                          124   6e-30   Brassica napus [oilseed rape]
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   125   7e-30   Phoenix dactylifera
gb|AAA20082.1|  CMCase; cellulase; endo-1,4-beta-D-glucanase            122   7e-30   Glycine max [soybeans]
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                   124   7e-30   Pyrus x bretschneideri [bai li]
gb|AGV22124.1|  endo-1,4-beta-glucanase 2                               124   7e-30   Betula luminifera [liang ye hua]
gb|EPS73295.1|  hypothetical protein M569_01458                         124   7e-30   Genlisea aurea
gb|AGG19087.1|  cellulase                                               124   7e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008796892.1|  PREDICTED: endoglucanase 8-like                    124   8e-30   
dbj|BAA06877.1|  cellulase precursor                                    124   9e-30   Populus alba [abele]
ref|XP_002509863.1|  endo-1,4-beta-glucanase, putative                  124   9e-30   Ricinus communis
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    124   9e-30   
sp|P23666.1|GUN2_PERAE  RecName: Full=Endoglucanase 2; AltName: F...    117   1e-29   Persea americana
ref|XP_008385953.1|  PREDICTED: endoglucanase 11-like                   121   1e-29   
ref|XP_009101916.1|  PREDICTED: endoglucanase 22-like                   124   1e-29   Brassica rapa
ref|XP_004304093.1|  PREDICTED: endoglucanase 11                        124   1e-29   Fragaria vesca subsp. vesca
emb|CDY52780.1|  BnaCnng23250D                                          124   1e-29   Brassica napus [oilseed rape]
gb|AEO97200.1|  endo-1,4-beta-glucanase                                 124   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002301487.1|  hypothetical protein POPTR_0002s20350g             124   1e-29   Populus trichocarpa [western balsam poplar]
gb|ADQ73896.1|  endo-1,4-beta-glucanase                                 122   1e-29   Avena strigosa
gb|KHM99090.1|  Endoglucanase 11                                        124   1e-29   Glycine soja [wild soybean]
emb|CDY23486.1|  BnaC06g24550D                                          123   2e-29   Brassica napus [oilseed rape]
gb|KDP30800.1|  hypothetical protein JCGZ_13743                         124   2e-29   Jatropha curcas
ref|XP_009378750.1|  PREDICTED: endoglucanase 17                        123   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_004500768.1|  PREDICTED: endoglucanase 24-like isoform X3        122   2e-29   
ref|XP_002510937.1|  endo-1,4-beta-glucanase, putative                  123   2e-29   Ricinus communis
ref|XP_006858738.1|  hypothetical protein AMTR_s00066p00128970          124   2e-29   Amborella trichopoda
ref|XP_009595307.1|  PREDICTED: endoglucanase 18-like                   123   2e-29   Nicotiana tomentosiformis
ref|XP_011079628.1|  PREDICTED: endoglucanase 17                        123   2e-29   Sesamum indicum [beniseed]
gb|KCW73256.1|  hypothetical protein EUGRSUZ_E01717                     123   2e-29   Eucalyptus grandis [rose gum]
ref|XP_008369029.1|  PREDICTED: endoglucanase 17-like                   123   2e-29   
ref|XP_010058568.1|  PREDICTED: endoglucanase 14-like                   123   2e-29   Eucalyptus grandis [rose gum]
ref|XP_008386675.1|  PREDICTED: endoglucanase 17-like                   123   2e-29   
ref|XP_002278065.1|  PREDICTED: endoglucanase 25-like                   124   2e-29   Vitis vinifera
ref|XP_010676913.1|  PREDICTED: endoglucanase 1-like                    123   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009105740.1|  PREDICTED: endoglucanase 8                         123   2e-29   Brassica rapa
gb|EMT30810.1|  Endoglucanase 4                                         122   2e-29   
ref|XP_006418304.1|  hypothetical protein EUTSA_v10007402mg             123   2e-29   Eutrema salsugineum [saltwater cress]
emb|CBI36884.3|  unnamed protein product                                122   2e-29   Vitis vinifera
ref|XP_010259197.1|  PREDICTED: endoglucanase 8-like                    122   3e-29   Nelumbo nucifera [Indian lotus]
ref|XP_011047209.1|  PREDICTED: endoglucanase 11-like                   123   3e-29   Populus euphratica
ref|XP_008467115.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanase 8    122   3e-29   Cucumis melo [Oriental melon]
gb|KJB41903.1|  hypothetical protein B456_007G126900                    122   3e-29   Gossypium raimondii
gb|EMT00674.1|  Endoglucanase 10                                        123   3e-29   
ref|XP_007131339.1|  hypothetical protein PHAVU_011G005600g             122   3e-29   Phaseolus vulgaris [French bean]
gb|KHG30239.1|  hypothetical protein F383_11848                         122   3e-29   Gossypium arboreum [tree cotton]
ref|XP_002271736.1|  PREDICTED: endoglucanase 17                        122   3e-29   Vitis vinifera
ref|XP_004143969.1|  PREDICTED: endoglucanase-like                      122   3e-29   Cucumis sativus [cucumbers]
gb|EMS52550.1|  Endoglucanase 10                                        123   3e-29   Triticum urartu
gb|AID55376.1|  glycoside hydrolase family 9 B2                         122   3e-29   Gossypium hirsutum [American cotton]
ref|XP_010446419.1|  PREDICTED: endoglucanase 23                        122   3e-29   Camelina sativa [gold-of-pleasure]
gb|ACT54548.1|  endo-1,4-beta-glucanase                                 122   3e-29   Dimocarpus longan [longan]
gb|EYU42228.1|  hypothetical protein MIMGU_mgv1a004926mg                122   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_009104944.1|  PREDICTED: endoglucanase 8                         122   4e-29   Brassica rapa
emb|CDX68334.1|  BnaA07g23740D                                          122   4e-29   
ref|XP_003604007.1|  Endo-1 4-beta-glucanase                            122   4e-29   Medicago truncatula
ref|XP_010269597.1|  PREDICTED: endoglucanase 17-like                   122   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_011046752.1|  PREDICTED: endoglucanase 11-like                   122   4e-29   Populus euphratica
ref|XP_010906933.1|  PREDICTED: endoglucanase 17-like                   122   4e-29   
ref|XP_008366459.1|  PREDICTED: endoglucanase 11-like                   121   4e-29   
ref|XP_010259480.1|  PREDICTED: endoglucanase 17-like                   122   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_011029362.1|  PREDICTED: endoglucanase-like                      122   4e-29   Populus euphratica
ref|XP_006304674.1|  hypothetical protein CARUB_v10011914mg             122   4e-29   Capsella rubella
ref|XP_010660138.1|  PREDICTED: endoglucanase 1                         122   4e-29   Vitis vinifera
ref|XP_011026977.1|  PREDICTED: endoglucanase                           122   4e-29   Populus euphratica
dbj|BAJ94336.1|  predicted protein                                      123   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   123   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007131340.1|  hypothetical protein PHAVU_011G005600g             122   4e-29   Phaseolus vulgaris [French bean]
ref|XP_004500767.1|  PREDICTED: endoglucanase 24-like isoform X2        122   4e-29   
ref|XP_003521576.1|  PREDICTED: endoglucanase 17                        122   5e-29   Glycine max [soybeans]
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           123   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004171176.1|  PREDICTED: endoglucanase 17-like                   121   5e-29   
emb|CDY01915.1|  BnaC02g28120D                                          121   5e-29   
gb|AFW74700.1|  hypothetical protein ZEAMMB73_090741                    121   5e-29   
ref|XP_009764272.1|  PREDICTED: endoglucanase 18-like                   122   5e-29   
dbj|BAA77239.1|  endo-1,4-beta glucanase                                122   5e-29   
emb|CDY32480.1|  BnaA09g51160D                                          122   5e-29   
ref|XP_011026779.1|  PREDICTED: endoglucanase CX-like                   122   5e-29   
gb|AAC12684.1|  endo-beta-1,4-glucanase                                 122   5e-29   
ref|XP_006390849.1|  hypothetical protein EUTSA_v10018439mg             122   5e-29   
ref|XP_007212600.1|  hypothetical protein PRUPE_ppa016852mg             122   5e-29   
ref|XP_006286136.1|  hypothetical protein CARUB_v10007690mg             122   6e-29   
ref|XP_006367808.1|  PREDICTED: endoglucanase 8-like                    122   6e-29   
ref|XP_007215908.1|  hypothetical protein PRUPE_ppa004172mg             122   6e-29   
gb|AFZ78635.1|  korrigan                                                122   6e-29   
gb|KGN50329.1|  hypothetical protein Csa_5G167210                       121   6e-29   
ref|XP_008235122.1|  PREDICTED: endoglucanase 17                        122   6e-29   
ref|XP_004500766.1|  PREDICTED: endoglucanase 24-like isoform X1        122   6e-29   
ref|NP_001234867.1|  endo-1,4-beta-glucanase precursor                  121   6e-29   
gb|AFZ78645.1|  korrigan                                                122   6e-29   
emb|CDY22043.1|  BnaA09g00720D                                          122   6e-29   
gb|AEO97192.1|  endo-1,4-beta-glucanase                                 122   6e-29   
ref|XP_010456051.1|  PREDICTED: endoglucanase 17-like isoform X1        122   6e-29   
ref|XP_004292399.2|  PREDICTED: endoglucanase 9-like                    122   6e-29   
emb|CDY37459.1|  BnaC08g45970D                                          122   6e-29   
ref|XP_004159715.1|  PREDICTED: endoglucanase 1-like                    121   6e-29   
gb|KJB13746.1|  hypothetical protein B456_002G092400                    121   6e-29   
ref|XP_002300328.1|  hypothetical protein POPTR_0001s36600g             122   7e-29   
ref|XP_010422611.1|  PREDICTED: endoglucanase 17 isoform X1             122   7e-29   
ref|XP_004146136.1|  PREDICTED: endoglucanase 1-like                    121   7e-29   
gb|AEO97205.1|  endo-1,4-beta-glucanase                                 122   7e-29   
ref|XP_004491112.1|  PREDICTED: endoglucanase 11-like                   122   7e-29   
ref|XP_006355746.1|  PREDICTED: endoglucanase 14-like                   121   7e-29   
ref|XP_002298010.2|  hypothetical protein POPTR_0001s09910g             122   7e-29   
gb|KJB13747.1|  hypothetical protein B456_002G092400                    122   7e-29   
ref|XP_006396437.1|  hypothetical protein EUTSA_v10028585mg             121   7e-29   
ref|XP_004240228.2|  PREDICTED: endoglucanase 13-like                   121   7e-29   
emb|CDX72723.1|  BnaC07g47450D                                          121   7e-29   
ref|XP_009376856.1|  PREDICTED: endoglucanase 14-like                   121   7e-29   
ref|XP_004136012.1|  PREDICTED: endoglucanase 17-like isoform 2         121   8e-29   
ref|XP_003591494.1|  Endo-1 4-beta-glucanase                            121   8e-29   
emb|CAA67156.1|  endo-1,4-beta-glucanase                                121   8e-29   
gb|AGG19097.1|  cellulase                                               121   8e-29   
ref|NP_001234090.1|  endo-1,4-beta-glucanase precursor                  121   8e-29   
gb|ACZ82300.1|  beta-1,4 glycosidase                                    122   8e-29   
ref|XP_007131338.1|  hypothetical protein PHAVU_011G005500g             121   8e-29   
gb|AID55385.1|  glycoside hydrolase family 9 B8                         121   8e-29   
ref|XP_010999860.1|  PREDICTED: endoglucanase 9-like                    122   8e-29   
ref|XP_002982369.1|  hypothetical protein SELMODRAFT_116105             121   8e-29   
ref|XP_008227038.1|  PREDICTED: endoglucanase 11-like                   121   8e-29   
ref|XP_010930836.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    121   8e-29   
ref|XP_010053064.1|  PREDICTED: endoglucanase 1-like                    121   8e-29   
emb|CDP17109.1|  unnamed protein product                                121   8e-29   
emb|CDX72724.1|  BnaC07g47460D                                          120   8e-29   
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        122   8e-29   
ref|XP_008813788.1|  PREDICTED: endoglucanase 12-like                   122   8e-29   
ref|XP_010110634.1|  Endoglucanase 11                                   121   8e-29   
ref|XP_010429486.1|  PREDICTED: endoglucanase 17-like                   121   8e-29   
ref|XP_004136011.1|  PREDICTED: endoglucanase 17-like isoform 1         121   9e-29   
gb|AID55384.1|  glycoside hydrolase family 9 B11                        121   9e-29   
ref|XP_006302180.1|  hypothetical protein CARUB_v10020190mg             121   9e-29   
ref|XP_008230008.1|  PREDICTED: endoglucanase 11                        121   9e-29   
ref|XP_002888789.1|  hypothetical protein ARALYDRAFT_894888             121   9e-29   
ref|XP_007050983.1|  Glycosyl hydrolase 9B13                            121   9e-29   
gb|KDP22411.1|  hypothetical protein JCGZ_26242                         121   9e-29   
gb|KHG28140.1|  hypothetical protein F383_15365                         121   9e-29   
gb|AAC78504.1|  cellulase                                               121   9e-29   
ref|NP_177228.1|  endo-1,4-beta-glucanase                               121   9e-29   
ref|XP_008650181.1|  PREDICTED: endoglucanase 14-like                   121   9e-29   
emb|CAA67157.1|  endo-1,4-beta-glucanase                                121   9e-29   
gb|EYU29517.1|  hypothetical protein MIMGU_mgv1a003302mg                122   9e-29   
ref|XP_004143674.1|  PREDICTED: endoglucanase 8-like                    121   9e-29   
ref|XP_002966526.1|  hypothetical protein SELMODRAFT_85183              121   1e-28   
ref|XP_002527779.1|  endo-1,4-beta-glucanase, putative                  121   1e-28   
ref|XP_007199651.1|  hypothetical protein PRUPE_ppa004387mg             121   1e-28   
ref|XP_008366122.1|  PREDICTED: endoglucanase 14-like                   121   1e-28   
gb|KEH29369.1|  glycosyl hydrolase family 9 protein                     120   1e-28   
ref|XP_002892125.1|  ATCEL2                                             121   1e-28   
gb|AFZ78642.1|  korrigan                                                121   1e-28   
ref|XP_004167915.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    121   1e-28   
ref|XP_010471073.1|  PREDICTED: endoglucanase 8-like                    121   1e-28   
ref|XP_010427855.1|  PREDICTED: endoglucanase 8                         120   1e-28   
ref|XP_008795297.1|  PREDICTED: endoglucanase 9-like isoform X1         120   1e-28   
ref|XP_002299423.1|  hypothetical protein POPTR_0001s11430g             120   1e-28   
emb|CDY11552.1|  BnaC06g31870D                                          120   1e-28   
ref|XP_008448558.1|  PREDICTED: endoglucanase CX-like                   120   1e-28   
ref|NP_001289234.1|  endoglucanase 8                                    121   1e-28   
ref|XP_008451546.1|  PREDICTED: endoglucanase 17-like                   120   1e-28   
gb|KDP28191.1|  hypothetical protein JCGZ_13962                         121   1e-28   
gb|KHN07637.1|  Endoglucanase 1                                         120   1e-28   
gb|AIW39765.1|  putative endoglucanase 4 precursor                      121   1e-28   
ref|XP_007039376.1|  Endoglucanase 1                                    120   1e-28   
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   122   1e-28   
emb|CAA65828.1|  endo-beta-1,4-glucanase                                120   1e-28   
ref|XP_003579470.1|  PREDICTED: endoglucanase 13                        122   1e-28   
emb|CAB59900.1|  endo-beta-1,4-glucanase                                120   1e-28   
ref|XP_006447630.1|  hypothetical protein CICLE_v10014884mg             121   1e-28   
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        122   1e-28   
ref|XP_009118744.1|  PREDICTED: endoglucanase 1 isoform X1              120   1e-28   
ref|XP_009101910.1|  PREDICTED: endoglucanase 23-like                   120   1e-28   
ref|XP_009351522.1|  PREDICTED: endoglucanase 8                         120   1e-28   
ref|XP_010252537.1|  PREDICTED: endoglucanase 11-like                   121   1e-28   
emb|CAA65827.1|  cellulase                                              120   1e-28   
ref|XP_006448205.1|  hypothetical protein CICLE_v10014994mg             120   1e-28   
gb|EAZ21561.1|  hypothetical protein OsJ_05189                          120   1e-28   
ref|XP_008795298.1|  PREDICTED: endoglucanase 9-like isoform X2         120   2e-28   
ref|XP_008236849.1|  PREDICTED: endoglucanase 24-like                   120   2e-28   
gb|KHN33715.1|  Endoglucanase 23                                        120   2e-28   
ref|XP_008437724.1|  PREDICTED: endoglucanase-like                      120   2e-28   
ref|XP_007201772.1|  hypothetical protein PRUPE_ppa025159mg             120   2e-28   
dbj|BAB39482.1|  endo-1,4-beta glucanase                                120   2e-28   
ref|XP_006287533.1|  hypothetical protein CARUB_v10000741mg             120   2e-28   
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        122   2e-28   
ref|XP_007158534.1|  hypothetical protein PHAVU_002G160200g             120   2e-28   
gb|KGN52827.1|  hypothetical protein Csa_4G001940                       120   2e-28   
ref|XP_009761220.1|  PREDICTED: endoglucanase 17-like                   120   2e-28   
ref|XP_009784759.1|  PREDICTED: endoglucanase CX-like                   120   2e-28   
ref|XP_002872847.1|  glycosyl hydrolase family 9 protein                120   2e-28   
gb|EPS69947.1|  hypothetical protein M569_04812                         120   2e-28   
ref|XP_004150120.1|  PREDICTED: endoglucanase 8-like                    120   2e-28   
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                122   2e-28   
emb|CDP12078.1|  unnamed protein product                                120   2e-28   
emb|CDY04737.1|  BnaC05g18520D                                          120   2e-28   
ref|XP_008364782.1|  PREDICTED: endoglucanase 11-like                   120   2e-28   
ref|XP_006596588.1|  PREDICTED: endoglucanase 11-like                   120   2e-28   
gb|KDP38092.1|  hypothetical protein JCGZ_04735                         120   2e-28   
ref|NP_001045737.1|  Os02g0123700                                       120   2e-28   
ref|XP_009610441.1|  PREDICTED: endoglucanase 17-like                   120   2e-28   
emb|CDX97262.1|  BnaA02g20530D                                          120   2e-28   
ref|XP_010658407.1|  PREDICTED: endoglucanase-like                      120   2e-28   
ref|XP_010676410.1|  PREDICTED: endoglucanase-like isoform X1           120   2e-28   
ref|XP_008454321.1|  PREDICTED: endoglucanase 17                        120   2e-28   
ref|XP_009144579.1|  PREDICTED: endoglucanase 17                        120   2e-28   
ref|XP_010100207.1|  Endoglucanase 1                                    120   2e-28   
ref|XP_006469217.1|  PREDICTED: endoglucanase 8-like                    120   2e-28   
emb|CDY42597.1|  BnaC01g00090D                                          120   2e-28   
gb|KFK42632.1|  hypothetical protein AALP_AA1G020500                    120   2e-28   
ref|XP_006403190.1|  hypothetical protein EUTSA_v10003366mg             120   2e-28   
ref|XP_003552557.1|  PREDICTED: endoglucanase 1                         120   2e-28   
ref|XP_004152241.1|  PREDICTED: endoglucanase 17-like                   120   2e-28   
gb|ABK28672.1|  unknown                                                 120   2e-28   
gb|ABD62082.1|  endo-1,4-beta-glucancase precursor                      120   2e-28   
gb|EEE70095.1|  hypothetical protein OsJ_30098                          120   2e-28   
ref|XP_006843615.1|  hypothetical protein AMTR_s00007p00145080          116   2e-28   
ref|XP_009365103.1|  PREDICTED: endoglucanase 11 isoform X1             120   2e-28   
gb|AIF27792.1|  endo-1,4-beta-glucanase                                 120   2e-28   
ref|XP_008342129.1|  PREDICTED: endoglucanase 11-like                   120   2e-28   
ref|XP_010935663.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    121   2e-28   
gb|AET00580.2|  glycosyl hydrolase family 9 protein                     120   2e-28   
gb|AES72416.2|  glycosyl hydrolase family 9 protein                     121   2e-28   
gb|AAQ63883.1|  cellulase                                               121   2e-28   
gb|KFK30818.1|  hypothetical protein AALP_AA6G030100                    120   2e-28   
ref|XP_011022406.1|  PREDICTED: endoglucanase 1-like isoform X2         120   2e-28   
ref|XP_009115552.1|  PREDICTED: endoglucanase 4                         120   2e-28   
ref|NP_195611.1|  glycosyl hydrolase 9B17                               120   2e-28   
ref|XP_011465378.1|  PREDICTED: endoglucanase 9-like isoform X2         120   2e-28   
gb|AFZ78636.1|  korrigan                                                120   2e-28   
gb|AEO97202.1|  endo-1,4-beta-glucanase                                 120   2e-28   
ref|XP_008795766.1|  PREDICTED: endoglucanase 3 isoform X1              120   2e-28   
gb|KFK41496.1|  hypothetical protein AALP_AA2G137600                    120   2e-28   
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 121   3e-28   
ref|NP_001063747.1|  Os09g0530200                                       120   3e-28   
ref|XP_006849270.1|  hypothetical protein AMTR_s00027p00246860          120   3e-28   
gb|AFL65037.1|  endoglucanase                                           119   3e-28   
ref|XP_010318000.1|  PREDICTED: endoglucanase 8-like                    120   3e-28   
ref|XP_006385809.1|  hypothetical protein POPTR_0003s14740g             120   3e-28   
ref|XP_007137548.1|  hypothetical protein PHAVU_009G135900g             120   3e-28   
ref|XP_003518530.1|  PREDICTED: endoglucanase 11-like                   120   3e-28   
ref|XP_006480002.1|  PREDICTED: endoglucanase 17-like                   120   3e-28   
ref|XP_010932580.1|  PREDICTED: endoglucanase 17-like                   120   3e-28   
gb|KHN38252.1|  Endoglucanase 11                                        120   3e-28   
ref|XP_003602165.1|  Endoglucanase                                      121   3e-28   
ref|XP_003518974.1|  PREDICTED: endoglucanase 17                        120   3e-28   
ref|XP_004495939.1|  PREDICTED: endoglucanase 17-like                   120   3e-28   
ref|XP_006843611.1|  hypothetical protein AMTR_s00007p00143890          114   3e-28   
ref|XP_003523510.1|  PREDICTED: endoglucanase 24-like                   119   3e-28   
ref|XP_007145197.1|  hypothetical protein PHAVU_007G218400g             120   3e-28   
ref|XP_003594425.1|  Endoglucanase                                      121   3e-28   
ref|XP_010912745.1|  PREDICTED: endoglucanase 12-like                   119   3e-28   
gb|ABR15471.1|  endoglucanase                                           121   3e-28   
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    119   3e-28   
ref|XP_004510305.1|  PREDICTED: endoglucanase 1-like                    115   3e-28   
ref|XP_011022404.1|  PREDICTED: endoglucanase 1-like isoform X1         120   3e-28   
gb|KFK30485.1|  hypothetical protein AALP_AA7G267500                    122   3e-28   
ref|XP_009412845.1|  PREDICTED: endoglucanase 3-like                    119   3e-28   
ref|XP_004502591.1|  PREDICTED: endoglucanase 25-like                   120   3e-28   
ref|XP_010271277.1|  PREDICTED: endoglucanase 8-like                    119   3e-28   
ref|XP_002321149.2|  hypothetical protein POPTR_0014s15590g             120   4e-28   
ref|XP_010445170.1|  PREDICTED: endoglucanase 20-like                   119   4e-28   
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   120   4e-28   
gb|ABR16291.1|  unknown                                                 120   4e-28   
ref|XP_010238418.1|  PREDICTED: endoglucanase 23-like                   119   4e-28   
ref|XP_006650552.1|  PREDICTED: endoglucanase 10-like                   120   4e-28   
ref|XP_001775325.1|  predicted protein                                  120   4e-28   
gb|AFZ78643.1|  korrigan                                                120   4e-28   
gb|AEO97204.1|  endo-1,4-beta-glucanase                                 120   4e-28   
ref|XP_002321833.1|  cellulase family protein                           119   4e-28   
gb|KHN30675.1|  Endoglucanase 17                                        119   4e-28   
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  120   4e-28   
ref|XP_003536878.1|  PREDICTED: endoglucanase 17-like                   119   4e-28   
ref|XP_006444400.1|  hypothetical protein CICLE_v10019602mg             120   4e-28   
gb|KDP27644.1|  hypothetical protein JCGZ_19649                         119   4e-28   
ref|XP_003617621.1|  Endoglucanase                                      120   4e-28   
ref|XP_006411694.1|  hypothetical protein EUTSA_v10027420mg             119   4e-28   
gb|ACF87544.1|  unknown                                                 119   4e-28   
ref|XP_006837249.1|  hypothetical protein AMTR_s00112p00047400          119   4e-28   
ref|XP_004290812.1|  PREDICTED: endoglucanase 17                        119   4e-28   
ref|XP_011080903.1|  PREDICTED: endoglucanase 20-like                   119   4e-28   
gb|AFW73286.1|  hypothetical protein ZEAMMB73_816336                    115   4e-28   
ref|XP_010555263.1|  PREDICTED: endoglucanase 24-like                   120   4e-28   
ref|XP_009625038.1|  PREDICTED: endoglucanase 1-like                    119   5e-28   
gb|EPS68604.1|  endo-1,4-beta-glucanase                                 119   5e-28   
ref|XP_007020721.1|  Glycosyl hydrolase 9B8                             119   5e-28   
ref|XP_002523114.1|  endo-1,4-beta-glucanase, putative                  119   5e-28   
ref|XP_002868877.1|  glycosyl hydrolase family 9 protein                119   5e-28   
ref|XP_002269618.1|  PREDICTED: endoglucanase 14-like                   119   5e-28   
ref|XP_002451429.1|  hypothetical protein SORBIDRAFT_04g001960          119   5e-28   
ref|XP_006843371.1|  hypothetical protein AMTR_s00053p00085940          119   5e-28   
tpg|DAA36812.1|  TPA: hypothetical protein ZEAMMB73_340402              119   5e-28   
ref|XP_011010934.1|  PREDICTED: endoglucanase 8-like                    119   5e-28   
ref|XP_011041734.1|  PREDICTED: endoglucanase 4-like                    119   5e-28   
emb|CAA65826.1|  cellulase                                              119   5e-28   
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          120   5e-28   
ref|XP_011014628.1|  PREDICTED: endoglucanase 12-like isoform X3        119   5e-28   
ref|XP_011041733.1|  PREDICTED: endoglucanase 8-like                    119   5e-28   



>ref|XP_009610927.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=525

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC+G  YTPSDLRKFA+SQADYVLGDNP KMSYLVGYGDNYP+YVHHRGASIP DA 
Sbjct  394  AKITCNGDAYTPSDLRKFAISQADYVLGDNPSKMSYLVGYGDNYPQYVHHRGASIPKDAD  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCKDG+KWL+ST+PNPNVA G LVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLSG
Sbjct  454  TGCKDGWKWLDSTEPNPNVATGALVGGPFLNETYIDSRNNSMQAEPTTYNSAVIVGLLSG  513

Query  235  L  233
            L
Sbjct  514  L  514



>ref|XP_009783020.1| PREDICTED: endoglucanase 2 [Nicotiana sylvestris]
Length=525

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC+G  YTPSDLRKFA+SQADYVLGDNP KMSYLVGYGDNYP+YVHHRGASIP DA 
Sbjct  394  AKITCNGDAYTPSDLRKFAISQADYVLGDNPSKMSYLVGYGDNYPQYVHHRGASIPEDAD  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            T CKDG+KWL+ST+PNPNVA G LVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLSG
Sbjct  454  TSCKDGWKWLDSTEPNPNVATGALVGGPFLNETYIDSRNNSMQAEPTTYNSAVIVGLLSG  513

Query  235  L  233
            L
Sbjct  514  L  514



>ref|XP_011074667.1| PREDICTED: endoglucanase 10-like [Sesamum indicum]
Length=525

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKI+CDG Y+ PSDLRKFAMSQADYVLGDNPMKMSYLVGYGD YP+YVHHRGASIP DAT
Sbjct  394  AKISCDGHYFRPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDKYPQYVHHRGASIPADAT  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCKDGF+WL+S +PNPN+A+G LVGGPFLNE+++DSRNNSMQ EP+TYNSA+IVGLLS 
Sbjct  454  TGCKDGFQWLKSDKPNPNIAMGALVGGPFLNESFVDSRNNSMQTEPSTYNSAVIVGLLSS  513

Query  235  L  233
            L
Sbjct  514  L  514



>gb|KHF97947.1| hypothetical protein F383_10892 [Gossypium arboreum]
Length=526

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC    + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DAT
Sbjct  395  AKITCGDHSFKPSDLRKFAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADAT  454

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+STQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS 
Sbjct  455  TGCTDGFKWLDSTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSS  514

Query  235  L  233
            L
Sbjct  515  L  515



>gb|AID55377.1| glycoside hydrolase family 9 B5 [Gossypium hirsutum]
Length=526

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC    + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DAT
Sbjct  395  AKITCGDHSFKPSDLRKFAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADAT  454

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS 
Sbjct  455  TGCTDGFKWLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSS  514

Query  235  L  233
            L
Sbjct  515  L  515



>gb|ADU15552.1| EG [Gossypium hirsutum]
Length=526

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC    + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DAT
Sbjct  395  AKITCGDHSFKPSDLRKFAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADAT  454

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS 
Sbjct  455  TGCTDGFKWLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSS  514

Query  235  L  233
            L
Sbjct  515  L  515



>ref|XP_010061046.1| PREDICTED: endoglucanase 10-like [Eucalyptus grandis]
 gb|KCW67943.1| hypothetical protein EUGRSUZ_F01640 [Eucalyptus grandis]
Length=528

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKI+C G+ Y PSDLRKFA SQADYVLGDNP+KMSYLVGYGDNYP+YVHHRGASIP +A 
Sbjct  397  AKISCSGQTYRPSDLRKFAQSQADYVLGDNPIKMSYLVGYGDNYPQYVHHRGASIPVNAK  456

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL ST PNPNVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLSG
Sbjct  457  TGCTDGFKWLNSTDPNPNVATGALVGGPFLNETYIDSRNNSMQTEPSTYNSALIVGLLSG  516

Query  235  L  233
            L
Sbjct  517  L  517



>emb|CDP07412.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A+I+CD   +TP+DLRKFAMSQADYVLG+NP K+SYLVGYGDNYPK+VHHRGASIP DA 
Sbjct  395  AEISCDSDSFTPADLRKFAMSQADYVLGNNPAKLSYLVGYGDNYPKFVHHRGASIPMDAK  454

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCKDGF+WL+S +PNPNVAVG LVGGPF+NETYIDSRNNSMQAEP+TYNSA+IV LLSG
Sbjct  455  TGCKDGFQWLDSDKPNPNVAVGALVGGPFMNETYIDSRNNSMQAEPSTYNSAVIVALLSG  514

Query  235  L  233
            L
Sbjct  515  L  515



>gb|KJB58121.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=393

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC    + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DAT
Sbjct  262  AKITCGDHSFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADAT  321

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS 
Sbjct  322  TGCTDGFKWLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSS  381

Query  235  L  233
            L
Sbjct  382  L  382



>ref|XP_010244092.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
 ref|XP_010244093.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
Length=527

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A ITC G+ +TP+DLR FA+SQADYVLGDNP+KMSYLVGYG  YPKYVHHRGASIP DA 
Sbjct  396  ASITCGGEAFTPADLRNFAISQADYVLGDNPLKMSYLVGYGSKYPKYVHHRGASIPADAD  455

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL S++PNPNVA+GGLVGGPFLNETYIDSRNNSMQ EPTTYNSA+IVGLLSG
Sbjct  456  TGCTDGFKWLSSSKPNPNVAMGGLVGGPFLNETYIDSRNNSMQGEPTTYNSALIVGLLSG  515

Query  235  L  233
            L
Sbjct  516  L  516



>gb|KJB58119.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=424

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC    + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DAT
Sbjct  293  AKITCGDHSFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADAT  352

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS 
Sbjct  353  TGCTDGFKWLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSS  412

Query  235  L  233
            L
Sbjct  413  L  413



>ref|XP_006342034.1| PREDICTED: endoglucanase 10-like [Solanum tuberosum]
Length=519

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+TCDG  YTPSDLRKFAMSQA+YVLGDNP KMSYLVGYGD YP+YVHHRGASIPTDA T
Sbjct  389  KMTCDGNEYTPSDLRKFAMSQANYVLGDNPAKMSYLVGYGDKYPQYVHHRGASIPTDADT  448

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             CK+G+K+L+ST+PNPNVA G LVGGPFLNETYIDSRNNS+Q EPTTYNSA+IVGLLSGL
Sbjct  449  NCKEGWKYLDSTEPNPNVATGALVGGPFLNETYIDSRNNSIQGEPTTYNSAVIVGLLSGL  508



>ref|XP_004238345.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
 ref|XP_010320423.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=519

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+TCDG  YTPSDLRKFAMSQA+YVLGDNP KMSYLVGYGD YP+YVHHRGASIPTDA T
Sbjct  389  KMTCDGNEYTPSDLRKFAMSQANYVLGDNPAKMSYLVGYGDKYPQYVHHRGASIPTDANT  448

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             CK+G+K+L+ST+PNPNVA G LVGGPFLNETYIDSRNNS+Q EPTTYNSA++V LLSGL
Sbjct  449  NCKEGWKYLDSTEPNPNVATGALVGGPFLNETYIDSRNNSVQGEPTTYNSAVVVALLSGL  508



>ref|XP_010667385.1| PREDICTED: endoglucanase 2-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A+I+C+G  Y PS+LRKFA+SQADYVLG+NPMKMS+LVGYGD YP++VHHRGASIP DA 
Sbjct  392  ARISCNGNSYKPSELRKFALSQADYVLGNNPMKMSFLVGYGDKYPQFVHHRGASIPADAK  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL ST+PNPNVAVG LVGGPFLNET+ID RNNSMQ EPTTYN+A++VGLLSG
Sbjct  452  TGCDDGFKWLNSTEPNPNVAVGALVGGPFLNETFIDDRNNSMQTEPTTYNNALVVGLLSG  511

Query  235  L  233
            L
Sbjct  512  L  512



>gb|KJB58120.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=522

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC    + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DAT
Sbjct  391  AKITCGDHSFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADAT  450

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS 
Sbjct  451  TGCTDGFKWLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSS  510

Query  235  L  233
            L
Sbjct  511  L  511



>gb|KJB58118.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=526

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKITC    + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DAT
Sbjct  395  AKITCGDHSFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADAT  454

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS 
Sbjct  455  TGCTDGFKWLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSS  514

Query  235  L  233
            L
Sbjct  515  L  515



>ref|XP_006473639.1| PREDICTED: endoglucanase 10-like [Citrus sinensis]
Length=524

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A++TCDG  + PSDLR FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DAT
Sbjct  393  AELTCDGHSFKPSDLRDFAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADAT  452

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC+DGFKWL+S +PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS 
Sbjct  453  TGCRDGFKWLDSKKPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSS  512

Query  235  L  233
            L
Sbjct  513  L  513



>gb|KDO84820.1| hypothetical protein CISIN_1g009846mg [Citrus sinensis]
Length=524

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A++TCDG  + PSDLR FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DAT
Sbjct  393  AELTCDGHSFKPSDLRDFAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADAT  452

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC+DGFKWL+S +PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS 
Sbjct  453  TGCRDGFKWLDSKKPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSS  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_006435157.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
 gb|ESR48397.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
Length=524

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A++TCDG  + PSDLR FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DAT
Sbjct  393  AELTCDGHSFKPSDLRDFAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADAT  452

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC+DGFKWL+S +PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS 
Sbjct  453  TGCRDGFKWLDSKKPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSS  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_010104437.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC00970.1| Endoglucanase 24 [Morus notabilis]
Length=525

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++C GK +TP+D+RKF  SQADYVLG+NPMKMS+LVGYGD YP+YVHHRGASIP DA 
Sbjct  394  AKVSCSGKSFTPADIRKFVRSQADYVLGENPMKMSFLVGYGDKYPQYVHHRGASIPVDAK  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+ST+PNPNVA+G LVGGPF NET+IDSRNNSMQ EP+TYNSA++VGLLS 
Sbjct  454  TGCTDGFKWLDSTEPNPNVAIGALVGGPFQNETFIDSRNNSMQVEPSTYNSAVMVGLLSS  513

Query  235  L  233
            L
Sbjct  514  L  514



>ref|XP_007017776.1| EG isoform 2 [Theobroma cacao]
 gb|EOY15001.1| EG isoform 2 [Theobroma cacao]
Length=526

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ C    + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATT
Sbjct  396  KLKCGDDSFKPSDLRKFAKSQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPADATT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL+ST+PNPNVA+G L+GGPFLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  456  GCKDGFKWLDSTKPNPNVAIGALLGGPFLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>ref|XP_002510516.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF52703.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=523

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++CDG  + PSDLRKFA SQADYVLG NPMKMSYLVGYGD YP+YVHHRGASIP DAT
Sbjct  392  AKLSCDGTSFKPSDLRKFAKSQADYVLGKNPMKMSYLVGYGDKYPQYVHHRGASIPADAT  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCKDG+KWL++ +PNPNVA G  VGGPFLNE+Y+DSRNNSMQ EP+TYNSA+IVGLLS 
Sbjct  452  TGCKDGWKWLDAEEPNPNVAYGAFVGGPFLNESYVDSRNNSMQGEPSTYNSAVIVGLLSS  511

Query  235  L  233
            L
Sbjct  512  L  512



>ref|XP_007017775.1| EG isoform 1 [Theobroma cacao]
 gb|EOY15000.1| EG isoform 1 [Theobroma cacao]
Length=533

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ C    + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATT
Sbjct  396  KLKCGDDSFKPSDLRKFAKSQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPADATT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL+ST+PNPNVA+G L+GGPFLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  456  GCKDGFKWLDSTKPNPNVAIGALLGGPFLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>gb|EYU36779.1| hypothetical protein MIMGU_mgv1a004472mg [Erythranthe guttata]
Length=525

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A+I+C+G  + PSDLRKFA+SQADYVLGDNPMKMSYLVGYGD YP+YVHHRGASIP D  
Sbjct  394  ARISCNGNNFRPSDLRKFAISQADYVLGDNPMKMSYLVGYGDKYPQYVHHRGASIPADDK  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            + CK+GFKWL+S +PNPNVA+G LVGGPFLNE+++DSRNNSMQ EP+TYNSA+IVGLLSG
Sbjct  454  SDCKEGFKWLDSKEPNPNVAIGALVGGPFLNESFVDSRNNSMQTEPSTYNSAVIVGLLSG  513

Query  235  L  233
            L
Sbjct  514  L  514



>ref|XP_002300715.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE79988.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97188.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97215.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++C+G  Y PSDLRKFA SQADYVLG+NPMKMS+LVGYG+NYP+YVHHRGASIP DA 
Sbjct  392  AKLSCNGYSYKPSDLRKFAKSQADYVLGNNPMKMSFLVGYGENYPQYVHHRGASIPADAK  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCKDG+ WLE  +PNPNVA G LVGGPFLNET++D RNNSMQAEPTTYN A+IVGLLSG
Sbjct  452  TGCKDGWTWLERKEPNPNVATGALVGGPFLNETFVDDRNNSMQAEPTTYNGAVIVGLLSG  511

Query  235  L  233
            L
Sbjct  512  L  512



>emb|CDP04111.1| unnamed protein product [Coffea canephora]
Length=138

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C+G  Y P DLR FA+SQA+YVLG NPMKMSYLVGY  +YPKYVHHRGASIP DA TG
Sbjct  9    LYCNGDQYEPMDLRSFAISQANYVLGSNPMKMSYLVGYSSDYPKYVHHRGASIPADANTG  68

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGFKWL S  PNPN+A G LVGGPFLN+TYIDSRNNS+QAEPTTYNSA IVGLLSGL
Sbjct  69   CKDGFKWLRSPSPNPNIATGALVGGPFLNDTYIDSRNNSIQAEPTTYNSAFIVGLLSGL  127



>ref|XP_004136389.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 ref|XP_004162553.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 gb|KGN60025.1| hypothetical protein Csa_3G872070 [Cucumis sativus]
Length=523

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK +C+G  YTP+DLRKFA SQADYVLG+NP+KMSYLVGYGD +P+YVHHRGASIP DA 
Sbjct  392  AKFSCNGDTYTPADLRKFAKSQADYVLGNNPLKMSYLVGYGDKFPQYVHHRGASIPADAK  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            T CKDGFKWL+ST+PNPN+A G LVGGPFLN+TYIDSRNNSMQ EP+TYNSA++VGLLS 
Sbjct  452  TKCKDGFKWLDSTEPNPNIAYGALVGGPFLNDTYIDSRNNSMQGEPSTYNSALVVGLLSS  511

Query  235  L  233
            L
Sbjct  512  L  512



>ref|XP_008466493.1| PREDICTED: endoglucanase 10 [Cucumis melo]
Length=523

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK +C+G  YTP+DLRKFA SQADYVLG+NP+KMSYLVGYGD +P+YVHHRGASIP DA 
Sbjct  392  AKFSCNGDSYTPADLRKFAKSQADYVLGNNPLKMSYLVGYGDKFPQYVHHRGASIPADAK  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            T CKDGFKWL+ST+PNPN+A G LVGGPFLN+TYIDSRNNSMQ EP+TYNSA++VGLLS 
Sbjct  452  TKCKDGFKWLDSTEPNPNIAYGALVGGPFLNDTYIDSRNNSMQGEPSTYNSALVVGLLSS  511

Query  235  L  233
            L
Sbjct  512  L  512



>dbj|BAF42037.1| cellulase2 [Pyrus communis]
Length=526

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ CDG  Y PSD+RKF  SQADYVLGDNPMKMSYLVGYGD YPKYVHHRGASIP +  T
Sbjct  396  KLECDGDTYKPSDIRKFVRSQADYVLGDNPMKMSYLVGYGDKYPKYVHHRGASIPANQKT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFK+L+ST PNPN+AVG LVGGPFLNETYID+RNNS QAEP+TYNSA+IVGLLS L
Sbjct  456  GCKDGFKYLDSTDPNPNIAVGALVGGPFLNETYIDARNNSKQAEPSTYNSAVIVGLLSSL  515



>ref|XP_009378180.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
 ref|XP_009378181.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=537

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + CDGK Y P DLRKFA+SQADYVLG+NPM+MSYLVGYG +YP+YVHHRGASIP DA TG
Sbjct  408  LYCDGKSYNPVDLRKFAISQADYVLGENPMRMSYLVGYGSSYPQYVHHRGASIPVDAETG  467

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C DGFKWL+S  PNPNVAVG LVGGPF+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  468  CSDGFKWLDSPNPNPNVAVGALVGGPFMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>ref|XP_011028991.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=523

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++C+G  Y PSDLRKFA SQADYVLG+NPMKMS+LVGYG+NYP+YVHHRGASIP DA 
Sbjct  392  AKLSCNGYSYKPSDLRKFAKSQADYVLGNNPMKMSFLVGYGENYPQYVHHRGASIPADAK  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCKDG+ WLE  +PNPNVA G LVGGPF NE ++D RNNSMQAEPTTYN A+IVGLLSG
Sbjct  452  TGCKDGWTWLERKEPNPNVATGALVGGPFFNEKFVDDRNNSMQAEPTTYNGAVIVGLLSG  511

Query  235  L  233
            L
Sbjct  512  L  512



>gb|AGV22125.1| endo-1,4-beta-glucanase 3 [Betula luminifera]
Length=527

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++C+GK ++ +DL+ FA SQADYVLGDNP+KMS+LVGYGD YP++VHHRGASIP DA 
Sbjct  396  AKLSCNGKSFSAADLQDFAKSQADYVLGDNPLKMSFLVGYGDKYPQFVHHRGASIPIDAK  455

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            T C +GF+WL+STQPNPNVAVGGLVGGPF NETY+DSRNNSMQ EPTTYN+A++VGLLSG
Sbjct  456  TNCTEGFQWLDSTQPNPNVAVGGLVGGPFQNETYLDSRNNSMQGEPTTYNNAVLVGLLSG  515

Query  235  L  233
            L
Sbjct  516  L  516



>ref|XP_003527686.1| PREDICTED: endoglucanase 10-like [Glycine max]
 gb|KHN09095.1| Endoglucanase 24 [Glycine soja]
Length=529

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ CD   +TPSDLR FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA T
Sbjct  399  KLKCDSDSFTPSDLRDFAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKT  458

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGF+WLES+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  459  GCKDGFQWLESSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>ref|XP_008241905.1| PREDICTED: endoglucanase 24-like [Prunus mume]
Length=533

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + CDGK+Y P+DLR FA+SQ DYVLG+NPM+MSYLVGYG  YP+YVHHRG+SIP DA TG
Sbjct  404  LYCDGKFYKPTDLRNFAISQVDYVLGENPMEMSYLVGYGSKYPQYVHHRGSSIPADAHTG  463

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C+DGFKWL S+ PNPNVAVG LVGGPFLNETYID+RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  464  CQDGFKWLNSSNPNPNVAVGALVGGPFLNETYIDNRNNSMQGEPSTYNSALIVALLSGL  522



>ref|XP_011045112.1| PREDICTED: endoglucanase 2 [Populus euphratica]
Length=523

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AKI+C+G  Y PSDLRKFA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPTDAT
Sbjct  391  AKISCNGDSYKPSDLRKFAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTDAT  450

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLS  239
            TGCKDG+ WL+S +PNPN A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLS
Sbjct  451  TGCKDGWTWLKSKEPNPNEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLS  510

Query  238  GL  233
            GL
Sbjct  511  GL  512



>gb|KDP36939.1| hypothetical protein JCGZ_08230 [Jatropha curcas]
Length=523

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C G+ Y PSDLRKFA SQADYVLG NPMKMSYLVGYGD YP+YVHHRGASIP DATT
Sbjct  392  ELSCSGESYKPSDLRKFAKSQADYVLGKNPMKMSYLVGYGDKYPQYVHHRGASIPADATT  451

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDG+KWLES  PNPNVA G LVGGPF NE+++DSRNNS Q EP+TYNSA+IVGLLS L
Sbjct  452  GCKDGWKWLESEDPNPNVATGALVGGPFQNESFVDSRNNSKQGEPSTYNSAVIVGLLSSL  511



>ref|XP_007136082.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
 gb|ESW08076.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
Length=529

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ CD   YTPSDLR FA SQADYVLG NPM MS+LVGYGD +P++VHHRGASIP DA T
Sbjct  399  KLKCDSDSYTPSDLRDFAKSQADYVLGKNPMDMSFLVGYGDKFPQFVHHRGASIPADAKT  458

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL+S+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  459  GCKDGFKWLDSSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>ref|XP_002276739.1| PREDICTED: endoglucanase 10 [Vitis vinifera]
 emb|CBI19843.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++CDG  Y PSDLR FA+SQ +YVLG+NPMKMSYLVGYGD YP+YVHHRGASIP DAT
Sbjct  394  AKLSCDGDSYKPSDLRHFAISQVNYVLGENPMKMSYLVGYGDKYPQYVHHRGASIPADAT  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGFKWL+S  PNPNVA G LVGGPF NE+++DSRNNSMQ EP+TYN A+IVGLLS 
Sbjct  454  TGCSDGFKWLKSKDPNPNVATGALVGGPFKNESFVDSRNNSMQVEPSTYNGAVIVGLLSS  513

Query  235  L  233
            L
Sbjct  514  L  514



>ref|XP_008372790.1| PREDICTED: endoglucanase 24-like [Malus domestica]
Length=537

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  404
            CDGK Y P DLRKFA+SQADYVLG+NPM+MSYLVGYG +YP+YVHHRGASIP  A TGC 
Sbjct  410  CDGKSYNPVDLRKFAISQADYVLGENPMRMSYLVGYGSSYPQYVHHRGASIPVGAETGCI  469

Query  403  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            DGFKWL+S  PNPNVAVG LVGGPF+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  470  DGFKWLDSPNPNPNVAVGALVGGPFMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>gb|KJB14408.1| hypothetical protein B456_002G123700 [Gossypium raimondii]
Length=529

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK+TC    + PSDLRKFA  QADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP +AT
Sbjct  392  AKLTCGDHSFEPSDLRKFAKLQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPVNAT  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC DGF+WL ST+PNPNVAVG LVGGPFLNET+ DSRNN+MQ EPTTYNSA+IVGLLS 
Sbjct  452  TGCTDGFQWLNSTKPNPNVAVGALVGGPFLNETFFDSRNNTMQTEPTTYNSAVIVGLLSS  511

Query  235  L  233
            L
Sbjct  512  L  512



>ref|XP_008364934.1| PREDICTED: endoglucanase 10-like [Malus domestica]
Length=526

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ CDG  Y PSD+RKF  SQADYVLGDNPMKMS+LVGYGD YP+YVHHRGASIP +  T
Sbjct  396  KLECDGDTYKPSDIRKFVRSQADYVLGDNPMKMSFLVGYGDKYPEYVHHRGASIPANQKT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFK+L ST+PNPN+AVG LVGGPFLNETYID RNNS Q EP+TYNSA+IVGLLS L
Sbjct  456  GCKDGFKYLNSTEPNPNIAVGALVGGPFLNETYIDDRNNSKQGEPSTYNSAVIVGLLSSL  515



>ref|XP_003523541.1| PREDICTED: endoglucanase 10 [Glycine max]
Length=529

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ C    +TPSDLR FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA T
Sbjct  399  KLKCGSDSFTPSDLRDFAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKT  458

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGF+WLES+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  459  GCKDGFQWLESSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>ref|XP_009335173.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=526

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ CDG+ Y PSD+RKF  SQA+YVLGDNPMKMSYLVGYGD YPKYVHHRGASIP +  T
Sbjct  396  KLECDGETYKPSDIRKFVRSQANYVLGDNPMKMSYLVGYGDKYPKYVHHRGASIPANKKT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             CK+GFK+L+ST+PNPNVAVG LVGGPFLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  456  SCKEGFKYLDSTKPNPNVAVGALVGGPFLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>gb|KHN45917.1| Endoglucanase 2 [Glycine soja]
Length=570

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ C    +TPSDLR FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA T
Sbjct  440  KLKCGSDSFTPSDLRDFAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKT  499

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGF+WLES+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  500  GCKDGFQWLESSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  559



>ref|XP_004500948.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=528

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI CD   +TPSDLR FA SQADYVLG NPM MS+LVGYG  +P++VHHRGASIP DA+T
Sbjct  398  KIECDSDSFTPSDLRDFARSQADYVLGKNPMHMSFLVGYGKKFPQFVHHRGASIPADAST  457

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGF+WL+S+ PNPNVA G LVGGPFLNETYIDSRNNS QAEP+TYNSA++VGLLS L
Sbjct  458  GCKDGFQWLDSSDPNPNVATGALVGGPFLNETYIDSRNNSEQAEPSTYNSAVLVGLLSSL  517



>ref|XP_010536354.1| PREDICTED: endoglucanase 10-like [Tarenaya hassleriana]
Length=524

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K++C GK +  SDLRKFA SQA+Y+LG NPM+MS+LVGYGD YP+YVHHRGASIP DATT
Sbjct  394  KLSCSGKTFRASDLRKFAKSQAEYMLGKNPMEMSFLVGYGDKYPQYVHHRGASIPADATT  453

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL S  PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  454  GCKDGFKWLNSEDPNPNVAYGALVGGPFLNETFIDSRNNSMQNEPSTYNSALVVGLLSSL  513



>ref|XP_008387935.1| PREDICTED: endoglucanase 2 [Malus domestica]
Length=526

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K+ CDG+ Y PSD+RKF  SQA+YVLGDNPMKMSYLVGYGD YP+YVHHRGASIP +  T
Sbjct  396  KLECDGETYKPSDIRKFVRSQANYVLGDNPMKMSYLVGYGDKYPEYVHHRGASIPANKKT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             CK+GFK+L+ST+PNPNVAVG LVGGPFLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  456  SCKEGFKYLDSTKPNPNVAVGALVGGPFLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>ref|XP_002307711.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE94707.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97189.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97216.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++C+G  Y PS+LRKFA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPT A 
Sbjct  391  AKLSCNGDSYKPSELRKFAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTGAK  450

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLS  239
            TGCKDG+ WLES +PNPN A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLS
Sbjct  451  TGCKDGWTWLESKEPNPNEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLS  510

Query  238  GL  233
            GL
Sbjct  511  GL  512



>gb|AFZ78647.1| korrigan [Populus tomentosa]
Length=523

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK++C+G  Y PS+LRKFA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPT A 
Sbjct  391  AKLSCNGDSYKPSELRKFAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTGAK  450

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLS  239
            TGCKDG+ WLES +PNPN A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLS
Sbjct  451  TGCKDGWTWLESKEPNPNEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLS  510

Query  238  GL  233
            GL
Sbjct  511  GL  512



>gb|EYU38839.1| hypothetical protein MIMGU_mgv1a004578mg [Erythranthe guttata]
Length=519

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K++CDG  +  SDLR+FA++QA+YVLG+NPMKMSYLVG+G+ YP+YVHHRGAS+P D   
Sbjct  389  KLSCDGDNFKASDLREFAITQANYVLGNNPMKMSYLVGFGNKYPEYVHHRGASVPGDENP  448

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL+S  PNPNVA G LVGGPFLNE+Y+DSRNNSMQ EPTTYNSA IVGLLSGL
Sbjct  449  GCKDGFKWLDSDDPNPNVATGALVGGPFLNESYVDSRNNSMQGEPTTYNSAFIVGLLSGL  508



>gb|KHN00484.1| Endoglucanase 24 [Glycine soja]
Length=509

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTG
Sbjct  381  LYCSGKLYKPVDLRKFAISQADYVLGENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTG  440

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGFKW +S  PNPNVA G LVGGPF +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  441  CKDGFKWFDSPHPNPNVAFGALVGGPFFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  499



>gb|EPS64495.1| hypothetical protein M569_10284, partial [Genlisea aurea]
Length=530

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA--  419
            K++CD + + PSDLRKFA SQADYVLG NPMKMSYLVGYGD+YP+YVHHRGASIP  A  
Sbjct  399  KLSCDARDFAPSDLRKFAASQADYVLGSNPMKMSYLVGYGDSYPQYVHHRGASIPVGAKN  458

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
             TGCKDGF WL S QPNPNVA GGLVGGPFLN +++D+RNNSMQ EPTTYNSA+++GLLS
Sbjct  459  NTGCKDGFAWLTSAQPNPNVAAGGLVGGPFLNGSFVDTRNNSMQNEPTTYNSALVIGLLS  518

Query  238  GL  233
             L
Sbjct  519  AL  520



>ref|XP_003519870.1| PREDICTED: endoglucanase 24-like [Glycine max]
Length=535

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTG
Sbjct  407  LYCSGKLYKPVDLRKFAISQADYVLGENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTG  466

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGFKW +S  PNPNVA G LVGGPF +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  467  CKDGFKWFDSPHPNPNVAFGALVGGPFFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  525



>ref|XP_010029690.1| PREDICTED: endoglucanase 2-like [Eucalyptus grandis]
Length=527

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C  + YTP +LR FA+SQ DYVLG+NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTG
Sbjct  398  LFCSERSYTPGNLRDFAISQVDYVLGENPMKLSYLVGFGENYPQYVHHRGSSIPADATTG  457

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGFKWL S+ PNPNVAVG LVGGPF NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  458  CKDGFKWLNSSAPNPNVAVGALVGGPFRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  516



>gb|KCW56649.1| hypothetical protein EUGRSUZ_I02356 [Eucalyptus grandis]
Length=523

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C  + YTP +LR FA+SQ DYVLG+NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTG
Sbjct  394  LFCSERSYTPGNLRDFAISQVDYVLGENPMKLSYLVGFGENYPQYVHHRGSSIPADATTG  453

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGFKWL S+ PNPNVAVG LVGGPF NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  454  CKDGFKWLNSSAPNPNVAVGALVGGPFRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  512



>ref|XP_011100152.1| PREDICTED: endoglucanase 24-like [Sesamum indicum]
Length=528

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + CDG+ Y P DLR  A+ QADYVLG+NPM MSYLVGYG +YP+YVHHRGASIPTDA TG
Sbjct  399  LYCDGELYEPMDLRNLAIMQADYVLGNNPMNMSYLVGYGSSYPQYVHHRGASIPTDAKTG  458

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C DGF WL ST PNPNVA+G LVGGPF N++YIDSRNN+ QAEPTTYNSA++VGLLSGL
Sbjct  459  CSDGFMWLSSTAPNPNVAIGALVGGPFQNDSYIDSRNNTAQAEPTTYNSAVLVGLLSGL  517



>ref|XP_006435158.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
 gb|ESR48398.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
Length=480

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + CD K +   DLR+FA  QADYVLGDNP  MSYLVGY   +PK+VHHRGASIP DATTG
Sbjct  350  LECDEKTFKSEDLREFAKKQADYVLGDNPNSMSYLVGYSKKFPKFVHHRGASIPADATTG  409

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDG++WLEST+PNPN A G LVGGPF+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  410  CKDGYQWLESTKPNPNEATGALVGGPFMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  468



>gb|AID55379.1| glycoside hydrolase family 9 B7 [Gossypium hirsutum]
Length=525

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            ++C    + PSDLRKFA SQADYVLGDNPM +SYLVGYG  YP++VHHRGASIP DATTG
Sbjct  394  LSCGDDSFEPSDLRKFAQSQADYVLGDNPMDISYLVGYGGKYPEFVHHRGASIPVDATTG  453

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C +GFKWL S +PNPNVA+G LVGGPF NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  454  CSEGFKWLSSKKPNPNVAIGALVGGPFKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>gb|KJB63540.1| hypothetical protein B456_010G005200 [Gossypium raimondii]
Length=525

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            ++C    + PSDLRKFA SQADYVLGDNPM +SYLVGYG  YP++VHHRGASIP DATTG
Sbjct  394  LSCGDDSFEPSDLRKFAQSQADYVLGDNPMDISYLVGYGGKYPEFVHHRGASIPVDATTG  453

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C +GFKWL S +PNPNVA+G LVGGPF NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  454  CSEGFKWLSSKKPNPNVAIGALVGGPFKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>ref|XP_010477219.1| PREDICTED: endoglucanase 2-like [Camelina sativa]
Length=517

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++CD + + PSDLR FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA T
Sbjct  388  ELSCDDQSFKPSDLRTFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANT  447

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  448  GCKDGFKWLNSDEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>gb|KDO84821.1| hypothetical protein CISIN_1g036398mg [Citrus sinensis]
Length=514

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + CD K +   DLR+FA  QADYVLGDNP  MSYLVGY   +PK+VHHRGASIP DATTG
Sbjct  384  LECDEKTFKSEDLREFAKKQADYVLGDNPNSMSYLVGYSKKFPKFVHHRGASIPADATTG  443

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDG++WLEST+PNPN A G LVGGPF+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  444  CKDGYQWLESTKPNPNEATGALVGGPFMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  502



>gb|AES73992.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=529

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            I CD   + PSDLR FA SQADYVLG NP  MS+LVGYG N+P++VHHRGASIP +A TG
Sbjct  400  IKCDSDSFKPSDLRDFARSQADYVLGKNPQHMSFLVGYGKNFPQFVHHRGASIPANAKTG  459

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDG++WL+S+ PNPNVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  460  CKDGWQWLDSSDPNPNVATGALVGGPFLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  518



>ref|XP_003603741.1| Endoglucanase [Medicago truncatula]
Length=535

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            I CD   + PSDLR FA SQADYVLG NP  MS+LVGYG N+P++VHHRGASIP +A TG
Sbjct  406  IKCDSDSFKPSDLRDFARSQADYVLGKNPQHMSFLVGYGKNFPQFVHHRGASIPANAKTG  465

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDG++WL+S+ PNPNVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  466  CKDGWQWLDSSDPNPNVATGALVGGPFLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  524



>ref|XP_003629333.1| Endoglucanase [Medicago truncatula]
 gb|AET03809.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=534

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQ +YVLG+NPMKMS+LVGYG NYPKY+HHRG+SIP +A TG
Sbjct  406  LYCSGKMYKPVDLRKFAISQVEYVLGENPMKMSFLVGYGSNYPKYIHHRGSSIPVNAKTG  465

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGFKW +S QPNPNVA G +VGGPF NETY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  466  CKDGFKWYDSPQPNPNVAFGAIVGGPFFNETYNDFRNNSMQAEPTTYSNALLVALLSGL  524



>ref|XP_007156152.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
 gb|ESW28146.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
Length=534

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQADYVLG+NPMKMSYLVGYG + P Y+HHRG+SIP +ATTG
Sbjct  406  LYCGGKLYKPVDLRKFAISQADYVLGENPMKMSYLVGYGTHNPNYIHHRGSSIPVNATTG  465

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGFKWL S  PNPNVA+G LVGGPFLNETY D RNNSMQ EPTTYNSA+ V LLSGL
Sbjct  466  CKDGFKWLYSPYPNPNVALGALVGGPFLNETYNDFRNNSMQGEPTTYNSALFVALLSGL  524



>ref|XP_010501531.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=517

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++CD + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA T
Sbjct  388  ELSCDDQSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANT  447

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            GCKDGFKWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLL
Sbjct  448  GCKDGFKWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLL  504



>ref|XP_009103373.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=533

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K++C    + PSDLRKFA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA T
Sbjct  403  KLSCGDTSFKPSDLRKFARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANT  462

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  463  GCKDGFKWLNSEEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>emb|CDY66396.1| BnaAnng22170D [Brassica napus]
Length=533

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K++C    + PSDLRKFA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA T
Sbjct  403  KLSCGDTSFKPSDLRKFARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANT  462

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  463  GCKDGFKWLNSEEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>emb|CDY43425.1| BnaC07g14920D [Brassica napus]
Length=533

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K++C    + PSDLRKFA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA T
Sbjct  403  KLSCGDTSFKPSDLRKFARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANT  462

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  463  GCKDGFKWLNSDEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>ref|XP_009149490.1| PREDICTED: endoglucanase 2 [Brassica rapa]
 ref|XP_009149491.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=525

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C    + PSDLRKFA SQADY+LG NP KMSYLVGYGD YP+YVHHRGASIP DA TG
Sbjct  396  LACGDTSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGDKYPEYVHHRGASIPADANTG  455

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGF+WL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  456  CKDGFEWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  514



>ref|XP_010539853.1| PREDICTED: endoglucanase 10 [Tarenaya hassleriana]
Length=524

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K++C GK +  SDLRKFA SQADY+LG NP  MS+LVG+G+ YPK +HHRGASIP DATT
Sbjct  394  KLSCSGKTFRASDLRKFAKSQADYMLGKNPTGMSFLVGFGEKYPKNIHHRGASIPADATT  453

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGFKWL S  PNPN+A G LVGGPFLNET++DSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  454  GCKDGFKWLTSEDPNPNIAYGALVGGPFLNETFVDSRNNSMQNEPSTYNSALVVGLLSSL  513



>ref|XP_011462352.1| PREDICTED: endoglucanase 2-like [Fragaria vesca subsp. vesca]
Length=531

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + CDGK Y P DLR FA+SQADY LG NPMKMSYLVGYG NYP+ VHHRG+SIP DA TG
Sbjct  403  LYCDGKIYNPEDLRSFAISQADYALGKNPMKMSYLVGYGSNYPQQVHHRGSSIPVDADTG  462

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C DGFKWL S  PNPNVAVG LVGGPF N++Y+D RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  463  CSDGFKWLYSPDPNPNVAVGALVGGPFQNDSYMDIRNNSMQGEPSTYNSALIVALLSGL  521



>emb|CDY29381.1| BnaA06g14150D [Brassica napus]
Length=548

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C    + PSDLRKFA SQADY+LG NP KMSYLVGYGD YP+YVHHRGASIP DA TG
Sbjct  389  LACGDTSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGDKYPEYVHHRGASIPADANTG  448

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGF+WL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  449  CKDGFEWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>ref|XP_009398708.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            ++I C GK +TPSDLR FA SQADY+LG+NPMK+SYLVGYG +YP+ VHHRGASIP +A 
Sbjct  394  SEIDCSGKTFTPSDLRDFATSQADYILGNNPMKLSYLVGYGSSYPQQVHHRGASIPANAK  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGC +GF+WL ST PNPNVA+G LVGGPF N++YIDSRNNSMQ EP+TYNSA++VGLLSG
Sbjct  454  TGC-NGFQWLSSTDPNPNVAMGALVGGPFQNDSYIDSRNNSMQGEPSTYNSAVLVGLLSG  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_006426144.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
 gb|ESR39384.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
Length=550

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP DA TG
Sbjct  421  LYCSGKSYQPHDLRKFAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTG  480

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            C DGFKWLES  PNPNVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  481  CTDGFKWLESESPNPNVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  530



>gb|KDO78852.1| hypothetical protein CISIN_1g048736mg [Citrus sinensis]
Length=550

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP DA TG
Sbjct  421  LYCSGKSYQPHDLRKFAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTG  480

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            C DGFKWLES  PNPNVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  481  CTDGFKWLESESPNPNVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  530



>ref|XP_011043209.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=530

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + + C GK Y+P+DLR F++SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA 
Sbjct  399  STLYCHGKSYSPADLRDFSISQADYILGNNPMKMSYLVGYGSNYPQKVHHRGASIPVDAN  458

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  254
            T CKDGF WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYNSA++
Sbjct  459  TTCKDGFTWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYNSALV  512



>ref|XP_008221286.1| PREDICTED: endoglucanase 10-like [Prunus mume]
Length=526

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            +K+ CDG  Y  SD+RKFA SQA+YVLG+NP+KMSYLVGYGD YPKYVHHRGASIP +  
Sbjct  395  SKLECDGDSYKASDIRKFARSQANYVLGENPLKMSYLVGYGDKYPKYVHHRGASIPANKK  454

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
              C++GF++L +  PNPNVAVG LVGGPFLNETY+D+RNNS Q EP+TYNSA+IVGLLSG
Sbjct  455  PNCREGFEYLNTKDPNPNVAVGALVGGPFLNETYVDARNNSRQGEPSTYNSALIVGLLSG  514

Query  235  L  233
            L
Sbjct  515  L  515



>ref|NP_173423.1| glycosyl hydrolase 9B5 [Arabidopsis thaliana]
 sp|Q9FXI9.1|GUN2_ARATH RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12562.1|AC007797_22 Similar to endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAK82507.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AAM47371.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AEE29915.1| probably endoglucanase [Arabidopsis thaliana]
Length=515

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C  + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DATT
Sbjct  386  ELSCSDQSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADATT  445

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            GCKDGFKWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  446  GCKDGFKWLNSDEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  500



>gb|KDP46724.1| hypothetical protein JCGZ_06512 [Jatropha curcas]
Length=538

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C G  Y+P++LR FA+SQADY+LG NPM+MS+LVGYG+ YP+YVHHRG+SIP DA TG
Sbjct  409  LYCSGILYSPTELRSFAISQADYILGKNPMEMSFLVGYGNEYPQYVHHRGSSIPVDAKTG  468

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            CKDGF+WL+S  PNPN+AVG LVGGPFLNETY DSR N +QAE TTYN A+IVGLLSGL
Sbjct  469  CKDGFEWLDSPNPNPNIAVGALVGGPFLNETYNDSRRNIIQAEATTYNGALIVGLLSGL  527



>ref|XP_004291374.1| PREDICTED: endoglucanase 10-like [Fragaria vesca subsp. vesca]
Length=529

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            AK+TC+G  + P+D+RKFA+SQ +YVLG+NPMKMSYLVGYGDNYPKYVHHRGASIP DA 
Sbjct  393  AKLTCNGDSFKPADIRKFAISQIEYVLGNNPMKMSYLVGYGDNYPKYVHHRGASIPADAK  452

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
              C DGFK+ +S+ PNPNVA G LVGGPFLNETY D R+N+ Q EP+TYNSA++VGLLS 
Sbjct  453  PSCSDGFKYFKSSDPNPNVATGALVGGPFLNETYHDIRDNARQGEPSTYNSAVLVGLLSS  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_004509346.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=533

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQ +YVLG+NPM+MS++VGYG+ YPKY HHRG+SIP DA TG
Sbjct  405  LYCSGKMYKPVDLRKFAISQVEYVLGENPMRMSFVVGYGNEYPKYTHHRGSSIPFDAKTG  464

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C+DGFKW +S QPNPNVA G LVGGPF N+TY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  465  CRDGFKWYDSPQPNPNVAFGALVGGPFFNDTYNDFRNNSMQAEPTTYSNALLVALLSGL  523



>ref|XP_010113364.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC35371.1| Endoglucanase 24 [Morus notabilis]
Length=544

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + CDG+ YTP DLRKFAMSQ DYVLG NPM+MSYLVGYG+NYP+ VHHRG+SIP DA TG
Sbjct  415  LYCDGQSYTPEDLRKFAMSQVDYVLGQNPMEMSYLVGYGNNYPQQVHHRGSSIPVDAKTG  474

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            CKDGF+WL S +PNPN+A+G LVGGPFLNETY+D RNNSM +EP+TYN+A++V 
Sbjct  475  CKDGFEWLYSPKPNPNLAIGALVGGPFLNETYVDYRNNSMLSEPSTYNNALLVA  528



>ref|XP_010941260.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941261.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941262.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941263.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941264.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=524

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            +++ C+G+ YTP DLRKFAMSQADY+LGDNPMKMSYLVGYG +YP+ VHHRGASIP +A 
Sbjct  394  SEVQCNGETYTPLDLRKFAMSQADYILGDNPMKMSYLVGYGSSYPQQVHHRGASIPANAN  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK G++WL S  PNPN+A G LVGGPF N++YID RNNSMQ+EP+TYNSA +VGLLSG
Sbjct  454  TGCK-GWQWLSSPNPNPNIATGALVGGPFQNDSYIDLRNNSMQSEPSTYNSASLVGLLSG  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_010649048.1| PREDICTED: endoglucanase 24-like [Vitis vinifera]
 emb|CBI17386.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  404
            C GK+Y P+DLRKFA+SQ +YVLG+NPM M YLVG+G NYP+YVHHRGASIP DA TGC 
Sbjct  399  CSGKHYKPADLRKFAISQTEYVLGNNPMNMCYLVGHGSNYPQYVHHRGASIPVDAETGCH  458

Query  403  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            DGFKWLES  PNPN+AVG LVGGPFLNETYIDSRNN+MQ EP+TYNSA
Sbjct  459  DGFKWLESLDPNPNLAVGALVGGPFLNETYIDSRNNTMQGEPSTYNSA  506



>ref|XP_006840111.1| hypothetical protein AMTR_s00224p00023160 [Amborella trichopoda]
 gb|ERN01786.1| hypothetical protein AMTR_s00224p00023160 [Amborella trichopoda]
Length=233

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  404
            C+ K  +P DLR FA+SQADYVLGDNP K+S+LVGYG NYPK VHHRGASIP +A TGCK
Sbjct  107  CNNKANSPIDLRTFAISQADYVLGDNPTKLSFLVGYGTNYPKQVHHRGASIPVNANTGCK  166

Query  403  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             GF+WL+ T  NPNVAVG LVGGPF N++YID RNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  167  -GFQWLDLTADNPNVAVGALVGGPFQNDSYIDFRNNSMQGEPSTYNSAVIVGLLSGL  222



>ref|XP_007046716.1| EG [Theobroma cacao]
 gb|EOX90873.1| EG [Theobroma cacao]
Length=527

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  404
            C G  Y P DLRKFAMSQADYVLG NPMK+SYLVGYG +YP+YVHHRGASIP DA TGCK
Sbjct  400  CSGNSYKPEDLRKFAMSQADYVLGTNPMKISYLVGYGSSYPQYVHHRGASIPVDADTGCK  459

Query  403  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            DGF+WL S  PNPN+A G LVGGP LN++Y+DSR N  Q EP+TYN+A+IVGLLSGL
Sbjct  460  DGFRWLNSDDPNPNIAFGALVGGPSLNDSYLDSRKNVKQGEPSTYNTALIVGLLSGL  516



>ref|XP_006416450.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
 gb|ESQ34803.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
Length=523

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            + +C    + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA T
Sbjct  393  QFSCGDTSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANT  452

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            GCKDGFKWL+S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  453  GCKDGFKWLQSEEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVG  507



>ref|XP_006466419.1| PREDICTED: endoglucanase 2-like [Citrus sinensis]
Length=551

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C GK Y P DLRKFA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP +A TG
Sbjct  422  LYCSGKSYQPHDLRKFAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPANANTG  481

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            C DGFKWLES  PNPNVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  482  CTDGFKWLESESPNPNVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  531



>ref|XP_009386441.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=523

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +I C GK +TP+DLR FA SQADY+LG+NPMK+SYLVGYG +YP+ VHHRGASIP +  T
Sbjct  394  EIRCSGKSFTPTDLRNFATSQADYILGNNPMKLSYLVGYGSSYPQQVHHRGASIPANLDT  453

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCK GFKWL S  PNPNVA GGLVGGPF N+++IDSRNNSMQ EP+TYNSA++VGLLSGL
Sbjct  454  GCK-GFKWLTSIAPNPNVATGGLVGGPFKNDSFIDSRNNSMQTEPSTYNSAVLVGLLSGL  512



>gb|KFK44119.1| hypothetical protein AALP_AA1G218000 [Arabis alpina]
Length=517

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            K++C  + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA  
Sbjct  387  KLSCSDQDFKPSDLRKFAKSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPGDANV  446

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            GCKDGFKWL S +PNPNVA G LVGGPF+NET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  447  GCKDGFKWLNSEEPNPNVAYGALVGGPFMNETFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_010459672.1| PREDICTED: endoglucanase 2 [Camelina sativa]
 ref|XP_010459674.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=518

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++CD + +  SDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA T
Sbjct  388  ELSCDDQSFKSSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANT  447

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            GCKDGFKWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  448  GCKDGFKWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  502



>ref|XP_006307252.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
 gb|EOA40150.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
Length=517

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            + +C  + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA T
Sbjct  387  EFSCSDQSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANT  446

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            GCKDGFKWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  447  GCKDGFKWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  501



>emb|CDY44194.1| BnaC05g15510D [Brassica napus]
Length=1131

 Score =   196 bits (497),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            ++C    + PSDLRKF+ SQADY+LG NP KMSYLVGYGD YP++VHHRGASIP DA TG
Sbjct  411  LSCGDTSFKPSDLRKFSRSQADYMLGKNPEKMSYLVGYGDKYPEFVHHRGASIPADANTG  470

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
            CKDGFKWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS
Sbjct  471  CKDGFKWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLS  527



>gb|AEO97190.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97217.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=530

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + + C GK Y+P+DLR FA+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA 
Sbjct  399  STLYCQGKSYSPADLRNFAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDAN  458

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  266
            T CKDGF WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  459  TTCKDGFTWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006383120.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
 gb|ERP60917.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
Length=530

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + + C GK Y+P+DLR FA+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA 
Sbjct  399  STLYCHGKSYSPADLRNFAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDAN  458

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  266
            T CKDGF WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  459  TTCKDGFTWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_002893081.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69340.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C  + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA T
Sbjct  387  ELSCSDQSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANT  446

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            GCKDGFKWL+S + NPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  447  GCKDGFKWLDSDEQNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_008799407.1| PREDICTED: endoglucanase 24-like [Phoenix dactylifera]
Length=524

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            +++ C+G+ ++P DLRKFAM+QADY+LGDNPMKMSYLVGYG NYP+ VHHRGASIP +A 
Sbjct  394  SEMHCNGETFSPLDLRKFAMAQADYILGDNPMKMSYLVGYGSNYPQQVHHRGASIPANAN  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK G++WL+S  PNPNVA G LVGGPF N+++ID RNNSMQ+EP+TY+SA +VGLLSG
Sbjct  454  TGCK-GWQWLKSPNPNPNVATGALVGGPFQNDSFIDLRNNSMQSEPSTYSSASLVGLLSG  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_010935039.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=520

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A++ C+G+ +TP DLRKFA+SQADYVLGDNPM+MSYLVGYG +YP+ VHHRGASIP +A 
Sbjct  390  AEVQCNGESFTPMDLRKFAISQADYVLGDNPMEMSYLVGYGSSYPQQVHHRGASIPANAN  449

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            +GCK G++WL S  PNPNVA G LVGGPF N++YID RNNSMQAEPTTY+SA +V LLSG
Sbjct  450  SGCK-GWQWLSSPDPNPNVATGALVGGPFKNDSYIDLRNNSMQAEPTTYSSASLVALLSG  508

Query  235  L  233
            L
Sbjct  509  L  509



>ref|XP_011083520.1| PREDICTED: endoglucanase 10 [Sesamum indicum]
Length=518

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A I+C G  + PSDLR FA++QA+YVLGDNPM++SY+VGYGDNYP+ VHHRGASIP D  
Sbjct  387  AHISCSGSTFKPSDLRDFAITQANYVLGDNPMQLSYIVGYGDNYPQQVHHRGASIPADEN  446

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
              CKDGFKWLE+  PNPN+A G LVGGPFLNETYID RNNSMQ EP+TYNSA
Sbjct  447  PSCKDGFKWLEADTPNPNIATGALVGGPFLNETYIDVRNNSMQGEPSTYNSA  498



>gb|AFZ78646.1| korrigan [Populus tomentosa]
Length=530

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + + C GK Y+P+D+R  A+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA 
Sbjct  399  STLYCHGKSYSPADMRDLAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDAN  458

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  266
            T CKDGF WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  459  TTCKDGFTWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006340729.1| PREDICTED: endoglucanase 2-like [Solanum tuberosum]
Length=526

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + + C GK Y P++LR FA+SQ DY+LG+NPM+MSYLVGYG  YP+ VHHRGASIP +A 
Sbjct  393  SNLYCSGKLYEPTELRNFAVSQLDYILGNNPMEMSYLVGYGSRYPQQVHHRGASIPVNAN  452

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            + C DGFKWL +  PNPNVAVG LVGGP L++TY+DSRNN  Q+EPTTYNSA+IVGL+SG
Sbjct  453  SNCSDGFKWLHTRHPNPNVAVGALVGGPSLSDTYMDSRNNISQSEPTTYNSALIVGLISG  512

Query  235  L  233
            L
Sbjct  513  L  513



>gb|EEC84946.1| hypothetical protein OsI_32163 [Oryza sativa Indica Group]
Length=528

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKYY+P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA 
Sbjct  398  AAVQCSGKYYSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAK  457

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L ST PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSG
Sbjct  458  TGCK-GFQYLHSTSPNPNVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSG  516

Query  235  L  233
            L
Sbjct  517  L  517



>gb|EEE70113.1| hypothetical protein OsJ_30126 [Oryza sativa Japonica Group]
Length=528

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKYY+P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA 
Sbjct  398  AAVQCSGKYYSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAK  457

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L ST PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSG
Sbjct  458  TGCK-GFQYLHSTSPNPNVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSG  516

Query  235  L  233
            L
Sbjct  517  L  517



>ref|NP_001063771.1| Os09g0533900 [Oryza sativa Japonica Group]
 sp|Q69SG5.1|GUN24_ORYSJ RecName: Full=Endoglucanase 24; AltName: Full=Endo-1,4-beta glucanase 
24; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD33331.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF25685.1| Os09g0533900 [Oryza sativa Japonica Group]
 dbj|BAG94612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30395.1| cellulase [Oryza sativa]
Length=528

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKYY+P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA 
Sbjct  398  AAVQCSGKYYSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAK  457

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L ST PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSG
Sbjct  458  TGCK-GFQYLHSTSPNPNVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSG  516

Query  235  L  233
            L
Sbjct  517  L  517



>ref|XP_008788648.1| PREDICTED: endoglucanase 24 [Phoenix dactylifera]
Length=524

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A++ C G+ +T  DLRKFA+SQADY+LGDNPMKMSYLVGYG +YP+ VHHRGASIP +A 
Sbjct  394  AEVQCSGETFTLMDLRKFAISQADYILGDNPMKMSYLVGYGSSYPRQVHHRGASIPVNAN  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK G++WL S  PNPNVA G +VGGPF N++YID RNNSMQ EP+TY+SA +VGLLSG
Sbjct  454  TGCK-GWQWLSSADPNPNVATGAVVGGPFKNDSYIDLRNNSMQGEPSTYSSASLVGLLSG  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_002462729.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
 gb|EER99250.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
Length=525

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA 
Sbjct  395  AAVQCSGKYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAK  454

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L S+ PNPNVAVG LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSG
Sbjct  455  TGCK-GFQYLHSSDPNPNVAVGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSG  513

Query  235  L  233
            L
Sbjct  514  L  514



>gb|KJB43353.1| hypothetical protein B456_007G195700, partial [Gossypium raimondii]
Length=521

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  404
            C G  Y P DLR FA+SQADYVLG+NPMKMSYLVGYG  YP YVHHRG+SIP +A T C+
Sbjct  399  CSGNSYKPDDLRNFAISQADYVLGENPMKMSYLVGYGSRYPLYVHHRGSSIPVNADTSCQ  458

Query  403  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            DGFKWL S  PNPN+AVG LVGGP LN++Y D+R+N  Q+EP+TYNSA++VGLLSGL
Sbjct  459  DGFKWLYSDDPNPNIAVGALVGGPSLNDSYSDTRDNVKQSEPSTYNSALLVGLLSGL  515



>ref|XP_009128120.1| PREDICTED: endoglucanase 10 [Brassica rapa]
 ref|XP_009128121.1| PREDICTED: endoglucanase 10 [Brassica rapa]
Length=526

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+C+GK +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATT
Sbjct  396  KISCNGKIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPEDATT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC DGF++  ST+PNPN+A G LVGGPFLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  456  GCLDGFEYFNSTKPNPNIAYGALVGGPFLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>ref|NP_001145749.1| hypothetical protein [Zea mays]
 gb|ACL52523.1| unknown [Zea mays]
 tpg|DAA62473.1| TPA: hypothetical protein ZEAMMB73_855274 [Zea mays]
Length=526

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YPK VHHRGASIP DA 
Sbjct  396  AAVQCSGKYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPKQVHHRGASIPADAK  455

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L S  PNPNVA G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSG
Sbjct  456  TGCK-GFEYLHSPSPNPNVATGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSG  514

Query  235  L  233
            L
Sbjct  515  L  515



>ref|XP_006661478.1| PREDICTED: endoglucanase 24-like [Oryza brachyantha]
Length=498

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKYY+P+D+R FA+SQ +Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA 
Sbjct  368  AAVQCSGKYYSPTDIRNFAISQVNYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAK  427

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L S+ PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VG+LSG
Sbjct  428  TGCK-GFQYLHSSSPNPNVAMGALVGGPFQNDTFVDSRDNALQTESSTYNSGTLVGVLSG  486

Query  235  L  233
            L
Sbjct  487  L  487



>ref|XP_010530451.1| PREDICTED: endoglucanase 2-like [Tarenaya hassleriana]
Length=501

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  410
            + C G+ + PS+L+ FA SQ DYVLG NPM MSYLVGYGD+YP+ VHHRGASIP +ATTG
Sbjct  382  LLCGGQSFDPSELKSFAKSQVDYVLGQNPMNMSYLVGYGDSYPRQVHHRGASIPANATTG  441

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            C DGF WL S +PNPNVAVG LVGGPFLNETY+D RNN+MQAEPTTYN+A
Sbjct  442  CTDGFVWLMSEEPNPNVAVGALVGGPFLNETYVDDRNNTMQAEPTTYNTA  491



>ref|XP_004957464.1| PREDICTED: endoglucanase 24-like [Setaria italica]
Length=528

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGASIP DA 
Sbjct  398  AAVQCSGKYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSVYPQQVHHRGASIPADAK  457

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L S  PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSG
Sbjct  458  TGCK-GFQYLHSPDPNPNVAMGALVGGPFQNDTFVDSRDNALQTESSTYNSGTLVGLLSG  516

Query  235  L  233
            L
Sbjct  517  L  517



>emb|CDY39048.1| BnaA02g17370D [Brassica napus]
Length=526

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+C+GK +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATT
Sbjct  396  KISCNGKIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPEDATT  455

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC DGF++  ST+PNPN+A G LV GPFLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  456  GCLDGFEYFNSTKPNPNIAYGALVRGPFLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>ref|XP_003578508.1| PREDICTED: endoglucanase 24 [Brachypodium distachyon]
Length=529

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKY++P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA 
Sbjct  399  AAVQCSGKYFSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAK  458

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L S+ PNPNVA+G LVGGPF N++++DSR+N++Q E +TYNS  +VGLL+G
Sbjct  459  TGCK-GFEYLHSSSPNPNVAMGALVGGPFQNDSFVDSRDNAVQTESSTYNSGTLVGLLAG  517

Query  235  L  233
            L
Sbjct  518  L  518



>ref|XP_004232483.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=526

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + + C GK Y P++LR FA+SQ DY+LG+N M+MSYLVGYG  YP+ VHHRGASIP +A 
Sbjct  393  SNLYCSGKLYEPTELRNFAVSQLDYILGNNSMEMSYLVGYGSRYPQQVHHRGASIPVNAN  452

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            + C DGFKWL +   NPNVAVG LVGGP L++TY+DSRNN  Q+EPTTYNSA+IVGL+SG
Sbjct  453  SNCSDGFKWLHTRHSNPNVAVGALVGGPSLSDTYMDSRNNISQSEPTTYNSALIVGLISG  512

Query  235  L  233
            L
Sbjct  513  L  513



>ref|XP_003563568.1| PREDICTED: endoglucanase 18-like [Brachypodium distachyon]
Length=516

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C  + ++P+DLRKFA SQADYVLG+NPMK+SYLVGYGD+YP+ VHHRGASIP D  T
Sbjct  387  ELSCGSQTFSPADLRKFAKSQADYVLGENPMKVSYLVGYGDSYPQQVHHRGASIPADVDT  446

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC  G +WLES +PNPNVA G LVGGPF N++++D R+N MQ E TTYNSA+IVGLLSG+
Sbjct  447  GCG-GQEWLESPEPNPNVATGALVGGPFRNDSFVDKRDNVMQNEATTYNSALIVGLLSGI  505



>gb|EAZ38281.1| hypothetical protein OsJ_22659 [Oryza sativa Japonica Group]
Length=494

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C G+ ++P+DLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  T
Sbjct  365  ELSCSGQGFSPADLRKFAKSQADYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDT  424

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC DG KWLE+++PNPNVA G LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  425  GC-DGHKWLETSKPNPNVATGALVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  483



>ref|NP_001058583.1| Os06g0715300 [Oryza sativa Japonica Group]
 sp|Q5Z9P8.1|GUN18_ORYSJ RecName: Full=Endoglucanase 18; AltName: Full=Endo-1,4-beta glucanase 
18 [Oryza sativa Japonica Group]
 dbj|BAD53575.1| putative endo-beta-1,4-D-glucanase [Oryza sativa Japonica Group]
 dbj|BAF20497.1| Os06g0715300 [Oryza sativa Japonica Group]
Length=518

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C G+ ++P+DLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  T
Sbjct  389  ELSCSGQGFSPADLRKFAKSQADYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDT  448

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC DG KWLE+++PNPNVA G LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  449  GC-DGHKWLETSKPNPNVATGALVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>gb|EAZ02358.1| hypothetical protein OsI_24462 [Oryza sativa Indica Group]
Length=518

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C G+ ++P+DLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  T
Sbjct  389  ELSCSGQGFSPADLRKFAKSQADYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDT  448

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC DG KWLE+++PNPNVA G LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  449  GC-DGHKWLETSKPNPNVATGALVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>ref|XP_010416457.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIPTDATT
Sbjct  395  KISCDGKIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPTDATT  454

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFKW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  455  GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_006390284.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
 gb|ESQ27570.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
Length=524

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NPM MS++VGYGD YP++VHHRGASIP DATT
Sbjct  394  KISCDGKIFKATELRDFAKSQADYMLGKNPMGMSFVVGYGDKYPEFVHHRGASIPADATT  453

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFK+  ST+PNPN+A G LVGGPF NET++DSR+N MQ EPTTYN+A
Sbjct  454  GCLDGFKYFNSTKPNPNIAYGALVGGPFFNETFLDSRDNPMQNEPTTYNNA  504



>ref|XP_006302134.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
 gb|EOA35032.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
Length=525

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATT
Sbjct  395  KISCDGKIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATT  454

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFKW  ST+PNPN+A G LVGGPFLNET+ DSR N MQ EPTTYN+A
Sbjct  455  GCLDGFKWFNSTKPNPNIAYGALVGGPFLNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_009624009.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=527

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  404
            C G+ Y P++LR FA+ Q DY+LG+NPM+MSYLVGYG  YP+ VHHRGASIP D  + C 
Sbjct  398  CIGELYEPTELRNFAVLQLDYILGNNPMEMSYLVGYGSRYPQQVHHRGASIPVDVNSNCS  457

Query  403  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            DGFKWL + +PNPNVAVG LVGGP L++TY+DSRNN  Q+E TTYN+A+IVGL+SGL
Sbjct  458  DGFKWLHTREPNPNVAVGALVGGPSLSDTYMDSRNNISQSETTTYNTALIVGLISGL  514



>gb|ABK24648.1| unknown [Picea sitchensis]
Length=532

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-  413
            I C  K + P DLRKFA SQ DY+LG+NPMKMSYLVG+G NYPK VHHRGASIP DA+T 
Sbjct  401  IKCGDKDFAPEDLRKFAFSQVDYILGENPMKMSYLVGFGGNYPKQVHHRGASIPADASTV  460

Query  412  -GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
              C  GF W +S  PNPNV  G LVGGPFLN+++ID R+N MQ EP+TYNSA +VGLLSG
Sbjct  461  YDCNSGFVWFKSKSPNPNVVTGALVGGPFLNDSFIDIRSNPMQNEPSTYNSAALVGLLSG  520

Query  235  L  233
            L
Sbjct  521  L  521



>ref|XP_002530743.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF31649.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=414

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 95/122 (78%), Gaps = 3/122 (2%)
 Frame = -3

Query  589  ITCDGKYYTP---SDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA  419
            + C G++Y     + LR     QADYVLG NPM+MS+LVGYG N+P+YVHHRG+SIP DA
Sbjct  284  LYCSGQFYRQMIFAALRFRRCFQADYVLGKNPMEMSFLVGYGLNFPRYVHHRGSSIPVDA  343

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
             TGCKDGF WL S  PNPNV VG LVGGPFLNETY+DSRNN+  AEPTTY+SA+ VGLLS
Sbjct  344  RTGCKDGFMWLHSQNPNPNVPVGALVGGPFLNETYVDSRNNTDIAEPTTYSSALFVGLLS  403

Query  238  GL  233
             L
Sbjct  404  AL  405



>gb|EMT32027.1| Endoglucanase 24 [Aegilops tauschii]
Length=504

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKY++P+D+R FA+SQA+YVLGDNPMK+SYLVGYG +YP+ VHHRGASIP DA 
Sbjct  374  AAVECSGKYFSPTDIRNFAISQANYVLGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAK  433

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L S+ PNPNVA G +VGGPF N++++D R+N++Q E +TYNS   VGLL+G
Sbjct  434  TGCK-GFEYLHSSSPNPNVATGAVVGGPFQNDSFVDLRDNAVQTESSTYNSGTFVGLLAG  492

Query  235  L  233
            L
Sbjct  493  L  493



>ref|XP_010471690.1| PREDICTED: endoglucanase 10 [Camelina sativa]
Length=525

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATT
Sbjct  395  KISCDGKIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPADATT  454

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFKW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  455  GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_002889037.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65296.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATT
Sbjct  395  KISCDGKIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATT  454

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFKW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  455  GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|NP_177697.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
 sp|Q8LCP6.2|GUN10_ARATH RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87112.1|AC006434_8 F10A5.13 [Arabidopsis thaliana]
 gb|AAK64042.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAN12892.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AEE35745.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
Length=525

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATT
Sbjct  395  KISCDGKIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATT  454

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFKW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  455  GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>dbj|BAJ93299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C GKY++P+D+R FA+SQA+YVLGDN MK+SYLVGYG NYP+ VHHRGASIP DA 
Sbjct  401  AAVECSGKYFSPTDIRNFAISQANYVLGDNTMKLSYLVGYGSNYPQQVHHRGASIPADAK  460

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            TGCK GF++L S+ PNPNVA+G +VGGPF N+T++D R+N++Q E +TYNS   VGLL+G
Sbjct  461  TGCK-GFEYLHSSSPNPNVAMGAVVGGPFQNDTFVDLRDNAVQTESSTYNSGTFVGLLAG  519

Query  235  L  233
            L
Sbjct  520  L  520



>gb|AAM63477.1| endo-beta-1,4-glucanase, putative [Arabidopsis thaliana]
Length=525

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATT
Sbjct  395  KISCDGKIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATT  454

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFKW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  455  GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010428595.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+CDGK +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATT
Sbjct  395  KISCDGKIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPADATT  454

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFKW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  455  GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_002439027.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
 gb|EER90394.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Length=522

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            +++TC GK +T  DLRKFA SQADYVLGDNPMK+SYLVG+GD YP+ VHHRGASIP D  
Sbjct  392  SELTCSGKSFTALDLRKFAKSQADYVLGDNPMKLSYLVGFGDTYPQRVHHRGASIPADVD  451

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            TGC DG KWL+S  PNPNVA G LVGGPF N++++D R N  Q EPTTYNSA++VG
Sbjct  452  TGC-DGQKWLKSPDPNPNVATGALVGGPFKNDSFVDDRENVQQNEPTTYNSALVVG  506



>dbj|BAK04397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            ++TC G+ ++P+DLRKFA SQADYVLGDNPMK+SYLVGYGD+YP+ VHHRGASIP+D  T
Sbjct  389  ELTCGGQSFSPADLRKFAQSQADYVLGDNPMKLSYLVGYGDSYPQRVHHRGASIPSDVNT  448

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  251
            GC  G +WLES  PNPNVA G LVGGPF N++++D R N MQ E TTYNSA+IV
Sbjct  449  GCG-GQEWLESPDPNPNVATGALVGGPFKNDSFVDERQNVMQNEATTYNSALIV  501



>ref|XP_009803640.1| PREDICTED: endoglucanase 2-like [Nicotiana sylvestris]
Length=527

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + + C G+ Y P++LR FA+SQ DY+LG+N M++SYLVGYG  YP+ VHHRGASIP D  
Sbjct  394  SNLYCSGELYEPTELRNFAVSQLDYILGNNRMEISYLVGYGSRYPQQVHHRGASIPVDDN  453

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
            + C DGFKWL + +PNPNVAVG LVGGP L++TY+D RNN  Q+E TTYNSA+IVGL+SG
Sbjct  454  SNCSDGFKWLHTREPNPNVAVGALVGGPSLSDTYMDFRNNISQSETTTYNSALIVGLISG  513

Query  235  L  233
            L
Sbjct  514  L  514



>gb|EMS54236.1| Endoglucanase 18 [Triticum urartu]
Length=485

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            ++TC G+ ++P+DLRKFA SQADYVLGDNPMK+SYLVGYGD+YP+ VHHRGASIP D  T
Sbjct  355  ELTCGGQSFSPADLRKFAQSQADYVLGDNPMKLSYLVGYGDSYPQRVHHRGASIPADVNT  414

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  251
            GC  G +WLES  PNPNVA G LVGGPF N++++D R N MQ E TTYNSA+IV
Sbjct  415  GCG-GQEWLESPDPNPNVAAGALVGGPFKNDSFVDERQNVMQNEATTYNSALIV  467



>emb|CDY47506.1| BnaAnng09040D [Brassica napus]
Length=499

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+C+GK +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATT
Sbjct  369  KISCNGKIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPADATT  428

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFK+  ST+PNPN+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  429  GCLDGFKYFNSTKPNPNIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  479



>ref|XP_006656489.1| PREDICTED: endoglucanase 18-like [Oryza brachyantha]
Length=519

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +++C G+ ++P+DLRKFA SQADYVLG NPMK+SYLVGYGD YP+ VHHRGASIP D  T
Sbjct  390  ELSCGGQSFSPADLRKFAKSQADYVLGSNPMKISYLVGYGDRYPQRVHHRGASIPADVDT  449

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
            GC DG KWLES++ NPNVA G LVGGPF N+T+ D R+N MQ E TTYNSA++ G
Sbjct  450  GC-DGHKWLESSKDNPNVATGALVGGPFKNDTFSDKRDNVMQNEATTYNSALVAG  503



>ref|XP_004966453.1| PREDICTED: endoglucanase 18-like [Setaria italica]
Length=521

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            ++TC GK +T +DLRKFA SQADYVLGDNPMK+SYLVG+GD+YP+ VHHRGASIP D  T
Sbjct  392  ELTCSGKSFTAADLRKFAKSQADYVLGDNPMKLSYLVGFGDSYPQRVHHRGASIPADVDT  451

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  254
            GC DG +WL+S +PNPNVA G LVGGPF N+++ID R N  Q E TTYNSA+I
Sbjct  452  GC-DGQEWLKSPKPNPNVATGALVGGPFKNDSFIDDRENVRQNEATTYNSALI  503



>ref|XP_009106216.1| PREDICTED: endoglucanase 10-like [Brassica rapa]
Length=527

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+C+GK +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATT
Sbjct  397  KISCNGKIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPADATT  456

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC D FK+  ST+PNPN+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  457  GCLDEFKYFNSTKPNPNIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  507



>emb|CDX73186.1| BnaC06g36340D [Brassica napus]
Length=527

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            KI+C+GK +  ++LR FA SQADY+LG N M MS++VGYGD YP+++HHRGASIP DATT
Sbjct  397  KISCNGKIFKATELRDFAKSQADYILGKNSMGMSFVVGYGDKYPEFIHHRGASIPADATT  456

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            GC DGFK+  ST+PNPN+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  457  GCLDGFKYFNSTKPNPNIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  507



>ref|NP_001288527.1| uncharacterized protein LOC103626453 precursor [Zea mays]
 gb|AFW69494.1| hypothetical protein ZEAMMB73_138975 [Zea mays]
 gb|AGG19095.1| cellulase [Zea mays]
Length=521

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            +++TC GK +T  DLR+FA SQADYVLGDNPMK+SYLVG+GD+YP+ VHHRGASIP    
Sbjct  391  SELTCSGKSFTALDLRRFAKSQADYVLGDNPMKLSYLVGFGDSYPQRVHHRGASIPAGVD  450

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  260
            TGC DG +WL+S +PNPNVA G LVGGPF N++++D R N  Q EPTTYNSA
Sbjct  451  TGC-DGQEWLKSPEPNPNVATGALVGGPFKNDSFVDDRENVQQNEPTTYNSA  501



>ref|XP_002961546.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
 gb|EFJ36806.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
Length=562

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +  C G  +   DLR FA SQADY+LG+NPM  SYLVGYG N+P+ +HHR ASIP DA T
Sbjct  432  QFRCSGNSFAAKDLRAFAASQADYILGENPMSKSYLVGYGANFPQQLHHREASIPLDAAT  491

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGF+WL ++ PNP+VA G LVGGPF N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  492  GCKDGFRWLHASAPNPHVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  551



>ref|XP_002971269.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
 gb|EFJ27867.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
Length=561

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            +  C G  +   DLR FA SQADY+LG+NPM  SYLVGYG N+P+ +HHR ASIP DA T
Sbjct  431  QFRCSGNSFAAKDLRAFAASQADYILGENPMSKSYLVGYGANFPQQLHHREASIPLDAAT  490

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GCKDGF+WL ++ PNP+VA G LVGGPF N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  491  GCKDGFRWLHASAPNPHVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  550



>ref|NP_001066668.2| Os12g0428200 [Oryza sativa Japonica Group]
 dbj|BAF29687.2| Os12g0428200 [Oryza sativa Japonica Group]
Length=471

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            ++TC G+ ++PSDLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  T
Sbjct  235  ELTCSGQGFSPSDLRKFAKSQADYLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDT  294

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC D  KWLE+++PNPNV    LVGG + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  295  GC-DSHKWLETSKPNPNVTTDALVGGLYKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  353



>gb|ABA97969.1| Glycosyl hydrolase family 9 protein, expressed [Oryza sativa 
Japonica Group]
Length=694

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            ++TC G+ ++PSDLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  T
Sbjct  413  ELTCSGQGFSPSDLRKFAKSQADYLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDT  472

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            GC D  KWLE+++PNPNV    LVGG + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  473  GC-DSHKWLETSKPNPNVTTDALVGGLYKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  531



>gb|EAZ20312.1| hypothetical protein OsJ_35923 [Oryza sativa Japonica Group]
Length=392

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  413
            ++TC G+ ++PSDLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  T
Sbjct  235  ELTCSGQGFSPSDLRKFAKSQADYLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDT  294

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAI  257
            GC D  KWLE+++PNPNV    LVGG + N +++D R+N M  E TTYN A+
Sbjct  295  GC-DSHKWLETSKPNPNVTTDALVGGLYKNNSFVDERDNVMHNEATTYNCAL  345



>ref|XP_001763275.1| predicted protein [Physcomitrella patens]
 gb|EDQ71805.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-  413
            I+C G  +TP++LR FA SQADYVLG NP+  S++VGYG  YP+ +HHRGASIP + T  
Sbjct  343  ISCSGISFTPAELRSFAASQADYVLGANPLSTSFMVGYGAEYPQKLHHRGASIPVNPTVY  402

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             CK GF W +STQPNPN+A G +VGGPF NETY D+R+N +Q E +T+NSA +  L +GL
Sbjct  403  DCKGGFIWFDSTQPNPNIAHGAIVGGPFKNETYSDTRDNILQNEASTHNSAAMASLTAGL  462



>ref|XP_001781646.1| predicted protein [Physcomitrella patens]
 gb|EDQ53532.1| predicted protein [Physcomitrella patens]
Length=474

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT-T  413
            ITC GK +T + LR FA SQA+YVLG+NP+  S++VGYG+ +PKY+HHRGASIP D   T
Sbjct  342  ITCSGKSFTHAQLRAFASSQANYVLGNNPLSTSFMVGYGEKHPKYLHHRGASIPVDQIKT  401

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             C   + W +S +PNPN+A G +VGGPF NETY D+R N MQ E + Y SA   GL +GL
Sbjct  402  DCAHSWGWYDSKEPNPNIAYGAVVGGPFKNETYTDARTNIMQNEASVYTSAAFAGLSAGL  461



>ref|XP_002966695.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
 gb|EFJ32722.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
Length=472

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATT  413
            ++C GK +    LR+ A  QADY+LG NPM MSY+VGYG  YP  +HHR ASIP T +  
Sbjct  338  LSCSGKIFQVEHLRELAGFQADYILGKNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEV  397

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             CK+GF++L ++ PNPN+A G LVGGPF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  398  ECKEGFQYLHTSTPNPNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  457



>ref|XP_002978046.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
 gb|EFJ20703.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
Length=551

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATT  413
            ++C GK +    LR+ A  QADY+LG NPM MSY+VGYG  YP  +HHR ASIP T +  
Sbjct  417  LSCSGKIFEVEHLRELAGFQADYILGKNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEV  476

Query  412  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             CK+GF++L ++ PNPN+A G LVGGPF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  477  ECKEGFQYLHTSTPNPNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  536



>gb|KHN34290.1| Endoglucanase 24 [Glycine soja]
Length=516

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQ--ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            + C GK Y P DLRKF++SQ  ADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SI  +AT
Sbjct  417  LYCSGKLYKPVDLRKFSISQFQADYVLGENPMKMSYLVGYGTQYPKYLHHRGSSIAVNAT  476

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVG  338
            TGCKDGFKW ES  PNPNVA G L+ 
Sbjct  477  TGCKDGFKWFESPHPNPNVAFGALIA  502



>gb|EPS65630.1| hypothetical protein M569_09145, partial [Genlisea aurea]
Length=483

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = -3

Query  595  AKITC-DGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA  419
            A + C DG+   P DL  FA SQADY+LG NPM +SYLVGYGD+YP  VHHRGASIP+ +
Sbjct  356  AVVNCPDGRQLQPLDLLNFARSQADYILGKNPMSLSYLVGYGDHYPIRVHHRGASIPSTS  415

Query  418  T----TGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  254
                  GC +G++ W  S++ NPNV  GGLVGGP  N+ + D R+N  Q EPT   +A +
Sbjct  416  VLRSAVGCAEGYEVWYGSSKGNPNVIFGGLVGGPDENDEFTDERSNYEQNEPTLSGTAPM  475

Query  253  VGLLSGL  233
            VGLLS L
Sbjct  476  VGLLSKL  482



>ref|XP_010457267.1| PREDICTED: endoglucanase 1-like [Camelina sativa]
Length=150

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----  416
            C G   TP+ LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+ A     
Sbjct  27   CGGSVVTPARLRSIAKKQVDYLLGDNPLKMSYMVGYGPKYPRRIHHRGSSLPSVAAHPSK  86

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
              C DGF    S  PNPNV VG +VGGP  N+ + D R++  ++EP TY +A +VG L+ 
Sbjct  87   IQCHDGFSMFISQSPNPNVLVGAVVGGPDQNDQFPDERSDYGRSEPATYINAPLVGALAY  146

Query  235  L  233
            L
Sbjct  147  L  147



>ref|XP_003611061.1| Cellulase [Medicago truncatula]
 gb|AES94019.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=504

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C   +++PS++R FA  Q DY+LG+NPMKMSY+VGYG  YPK +HHRG+SIP+     
Sbjct  369  IHCGSAHFSPSEIRAFAKLQVDYILGNNPMKMSYMVGYGSKYPKQLHHRGSSIPSIKVHQ  428

Query  421  ATTGCKDG-FKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DG   +  S+ PNPN+ VG +VGGP  N+ Y D+R++   AEPTTY +A  VG 
Sbjct  429  TKVGCNDGQSNYFSSSNPNPNIHVGAIVGGPNSNDQYNDARSDYSHAEPTTYMNAAFVGS  488

Query  244  LSGL  233
            ++ L
Sbjct  489  VAAL  492



>gb|EYU26799.1| hypothetical protein MIMGU_mgv1a020424mg [Erythranthe guttata]
Length=458

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---  425
            A + C G    P+DL  FA SQ DY+LG+NP ++SY+VG+G NYPK VHHRGASI +   
Sbjct  331  ATLRCAGGAVGPNDLISFARSQVDYILGNNPKRLSYMVGFGSNYPKRVHHRGASIVSIKK  390

Query  424  DAT-TGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  251
            D T  GC+DGF  W      NPNV  G +VGGP  ++ Y D+RNN  QAEP+T N+A +V
Sbjct  391  DRTRVGCQDGFNNWYNRNADNPNVITGAIVGGPDQSDQYTDARNNYQQAEPSTANNAPLV  450

Query  250  GLLSGL  233
            G+L+ L
Sbjct  451  GVLARL  456



>gb|KEH24407.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=224

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   TP  L+  A  Q DY+LGDNP+KMSY+VG+G  YP+ +HHRG+S+P+ A   
Sbjct  76   VNCGGTIITPKSLKTIAKQQVDYLLGDNPLKMSYMVGFGTRYPQRIHHRGSSLPSIAVHP  135

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C +GF  ++S  PNPN+ VG +VGGP L++++ D R++  Q+EP TY +A +VG L
Sbjct  136  GKIQCSEGFSVMDSQSPNPNILVGTVVGGPDLHDSFPDERSDYEQSEPATYINAPLVGAL  195

Query  241  SGL  233
            + L
Sbjct  196  AYL  198



>gb|KEH27425.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=333

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C    +T S+++ FA SQ DY+LG+NPMKMSY+VGYG  YPK +HHRG+SIP+     
Sbjct  201  IHCGSTNFTSSEIKAFAKSQVDYILGNNPMKMSYMVGYGSKYPKQLHHRGSSIPSIKVHQ  260

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DG+  +  S+ PNPN+ VG +VGGP  N+ + D+R++   +EPTTY +A  +G 
Sbjct  261  TKVGCNDGYTDYFYSSNPNPNIHVGAIVGGPDFNDQFNDARSDYSHSEPTTYMNAAFIGS  320

Query  244  LSGL  233
            ++ L
Sbjct  321  VAAL  324



>gb|KDP25211.1| hypothetical protein JCGZ_20367 [Jatropha curcas]
Length=495

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   T   L   A  Q DY+LGDNP KMSY+VG+G+ YP++VHHRG+S+P+  T  
Sbjct  369  VKCGGSVVTAESLESAAKKQVDYILGDNPAKMSYMVGFGNKYPQHVHHRGSSVPSIHTHP  428

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C DGF++ +ST PNPNV VG ++GGP   + + D RNN  Q+EP TY +A  VG L
Sbjct  429  ERISCNDGFQYFKSTSPNPNVLVGAIIGGPDNQDNFADDRNNYQQSEPATYINAPFVGAL  488

Query  241  SGL  233
            + L
Sbjct  489  AFL  491



>gb|AFK41115.1| unknown [Medicago truncatula]
Length=159

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   TP  LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+ A   
Sbjct  30   VRCGGTIVTPKRLRTLAKKQVDYLLGDNPLKMSYMVGYGPRYPQRIHHRGSSLPSMAVHP  89

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C  GF  + S  PNPN+ VG +VGGP  ++ + D R++  Q+EP TY +A +VG L
Sbjct  90   GKIQCSAGFSVMSSQSPNPNILVGAVVGGPDQHDRFPDKRSDYEQSEPATYVNAPLVGTL  149

Query  241  SGL  233
            + L
Sbjct  150  AYL  152



>ref|XP_009405235.1| PREDICTED: endoglucanase 13-like [Musa acuminata subsp. malaccensis]
Length=481

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---  425
            A ++C     +P DL  FA SQ DY+LG NP  MSY+VG+G N+P  VHHRGASI +   
Sbjct  356  ATLSCPQGSVSPQDLISFATSQVDYILGANPKAMSYMVGFGSNFPVQVHHRGASIVSIKA  415

Query  424  -DATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
               + GCK+GF W     PNPNV  G LVGGP  N+ Y DSR+N  QAEP    +A ++G
Sbjct  416  DPKSIGCKEGFDWFNRNSPNPNVLDGALVGGPDANDAYTDSRSNYQQAEPAIATNAALIG  475

Query  247  LLSGL  233
            +L+ L
Sbjct  476  VLARL  480



>ref|XP_003611058.1| Endo-1 4-beta-glucanase [Medicago truncatula]
 gb|AES94016.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=401

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C    +T S+++ FA SQ DY+LG+NPMKMSY+VGYG  YPK +HHRG+SIP+     
Sbjct  269  IHCGSTNFTSSEIKAFAKSQVDYILGNNPMKMSYMVGYGSKYPKQLHHRGSSIPSIKVHQ  328

Query  421  ATTGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DG+  +  S+ PNPN+ VG +VGGP  N+ + D+R++   +EPTTY +A  +G 
Sbjct  329  TKVGCNDGYTDYFYSSNPNPNIHVGAIVGGPDFNDQFNDARSDYSHSEPTTYMNAAFIGS  388

Query  244  LSGL  233
            ++ L
Sbjct  389  VAAL  392



>gb|KDP25379.1| hypothetical protein JCGZ_20535 [Jatropha curcas]
Length=509

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C   +++ S +R FA SQ DY+LG+NPMKMSY+VG+G+ YP  +HHRGASIP+     
Sbjct  361  IQCGSAHFSASQIRSFAKSQVDYMLGNNPMKMSYMVGFGNKYPTQLHHRGASIPSIRVHS  420

Query  421  ATTGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DGF  +  S +PNPN  +G +VGGP  N+ Y D R    +AEPTTY +A  VG 
Sbjct  421  DKVGCNDGFSMYFNSNRPNPNTHIGAVVGGPDSNDQYKDLRTEYSRAEPTTYMNAAFVGS  480

Query  244  LSGL  233
            +S L
Sbjct  481  VSAL  484



>gb|KEH27424.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=428

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C    +T S+++ FA SQ DY+LG+NPMKMSY+VGYG  YPK +HHRG+SIP+     
Sbjct  296  IHCGSTNFTSSEIKAFAKSQVDYILGNNPMKMSYMVGYGSKYPKQLHHRGSSIPSIKVHQ  355

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DG+  +  S+ PNPN+ VG +VGGP  N+ + D+R++   +EPTTY +A  +G 
Sbjct  356  TKVGCNDGYTDYFYSSNPNPNIHVGAIVGGPDFNDQFNDARSDYSHSEPTTYMNAAFIGS  415

Query  244  LSGL  233
            ++ L
Sbjct  416  VAAL  419



>ref|XP_010231817.1| PREDICTED: endoglucanase 14-like [Brachypodium distachyon]
Length=497

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP----TD  422
            + C G    P+ L  FA SQ DY+LG NP K+SY+VGYGD YP+ VHHRGAS+P    + 
Sbjct  372  LQCGGVKLPPAQLVSFARSQVDYILGKNPQKISYMVGYGDRYPEQVHHRGASLPSIKASP  431

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A  GC DG  +  + +PN NV VG +VGGP  N+ Y DSR N +Q E +TY  A IVG+L
Sbjct  432  AKIGCSDGSGYFHTAKPNENVIVGAIVGGPDANDRYNDSRGNYVQGETSTYTVAPIVGVL  491

Query  241  SGL  233
            + L
Sbjct  492  ARL  494



>ref|XP_003611057.1| Endo-1 4-beta-glucanase [Medicago truncatula]
 gb|AES94015.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=502

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C    +T S+++ FA SQ DY+LG+NPMKMSY+VGYG  YPK +HHRG+SIP+     
Sbjct  370  IHCGSTNFTSSEIKAFAKSQVDYILGNNPMKMSYMVGYGSKYPKQLHHRGSSIPSIKVHQ  429

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DG+  +  S+ PNPN+ VG +VGGP  N+ + D+R++   +EPTTY +A  +G 
Sbjct  430  TKVGCNDGYTDYFYSSNPNPNIHVGAIVGGPDFNDQFNDARSDYSHSEPTTYMNAAFIGS  489

Query  244  LSGL  233
            ++ L
Sbjct  490  VAAL  493



>ref|XP_006847867.1| hypothetical protein AMTR_s00029p00087270 [Amborella trichopoda]
 gb|ERN09448.1| hypothetical protein AMTR_s00029p00087270 [Amborella trichopoda]
Length=617

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 81/126 (64%), Gaps = 5/126 (4%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            A + C      PS+L  FA SQADY+LG NP  MSYLVG+G NYP  VHHRGASI + A 
Sbjct  360  APLNCPEAQLHPSNLISFAQSQADYILGKNPRAMSYLVGFGPNYPTRVHHRGASIVSKAV  419

Query  415  T----GCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  251
            +     C +GF+ W    Q +PN+ VG LVGGP  N+ +ID R+N  Q EPTTYN A ++
Sbjct  420  SPAPVRCLEGFESWFNREQRDPNILVGALVGGPDRNDRFIDERSNYEQTEPTTYNVAPLI  479

Query  250  GLLSGL  233
            GL + L
Sbjct  480  GLFAKL  485



>ref|XP_010666165.1| PREDICTED: endoglucanase 14-like [Beta vulgaris subsp. vulgaris]
Length=484

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---DA  419
            + C      P DL  FA SQ DY+LG NP   SY+VGYG NYP+ VHHRG+SI +   D 
Sbjct  360  LNCPSSLVNPPDLIAFAKSQVDYILGANPKNTSYMVGYGSNYPQQVHHRGSSIVSIKKDP  419

Query  418  T-TGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
            T  GCKDGF  W    QPNPNV VG +VGGP  N+ Y+D R++   AEP T NSA +VG+
Sbjct  420  TPVGCKDGFTNWFNKNQPNPNVLVGAIVGGPDKNDNYVDQRSDYQLAEPATANSAGLVGV  479

Query  244  LSGL  233
            L+ +
Sbjct  480  LARI  483



>ref|XP_004511554.1| PREDICTED: endoglucanase-like [Cicer arietinum]
Length=530

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 83/124 (67%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C   +++PS++  FA SQ DY+LG NPMKMSY+VGYG  YPK +HHRG+SIP+     
Sbjct  384  IHCGSSHFSPSEISAFAKSQVDYILGKNPMKMSYMVGYGSKYPKQLHHRGSSIPSIKVHP  443

Query  421  ATTGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DG   +  S+ PNPN+ VG +VGGP  N+ + D+R++   +EPTTY +A  +G 
Sbjct  444  TKVGCNDGHSDYFSSSNPNPNIHVGAIVGGPDSNDQFSDARSDYSHSEPTTYMNAAFIGS  503

Query  244  LSGL  233
            ++ L
Sbjct  504  VAAL  507



>ref|XP_010069895.1| PREDICTED: endoglucanase 17 [Eucalyptus grandis]
 gb|KCW58410.1| hypothetical protein EUGRSUZ_H01095 [Eucalyptus grandis]
Length=507

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 84/123 (68%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G  +TPS LR  A  Q DY+LGDNP++MSY+VGYG  YP+ +HHRG+S+P+ A+  
Sbjct  378  VNCGGTTFTPSRLRNIAKKQVDYLLGDNPLRMSYMVGYGPRYPQRIHHRGSSLPSVASHP  437

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C  GF ++ S  PNPN+ VG +VGGP  ++ + D R++  Q+EP+TY +A +VG L
Sbjct  438  AKIQCSSGFDFMNSESPNPNIHVGAIVGGPDQHDRFPDQRSDYEQSEPSTYMNAPLVGTL  497

Query  241  SGL  233
            + L
Sbjct  498  AYL  500



>ref|XP_009403726.1| PREDICTED: endoglucanase 9-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 82/123 (67%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
             TC    +T S LR  A  Q DY+LG+NP+KMSY+VG+G  +P+ +HHR AS+P+ AT  
Sbjct  260  FTCGNLLFTASSLRSLAKKQVDYILGENPLKMSYMVGFGARFPQKIHHRAASLPSLATYP  319

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GC+ GF++L+S+ PNPN+  G +VGGP  N+ + D R +   AEP TY +A +VG L
Sbjct  320  GHIGCQAGFQYLDSSSPNPNILTGAVVGGPDQNDAFTDDRKDFSHAEPATYINAPLVGSL  379

Query  241  SGL  233
            + L
Sbjct  380  AYL  382



>ref|XP_009403727.1| PREDICTED: endoglucanase 9-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=401

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 82/123 (67%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
             TC    +T S LR  A  Q DY+LG+NP+KMSY+VG+G  +P+ +HHR AS+P+ AT  
Sbjct  272  FTCGNLLFTASSLRSLAKKQVDYILGENPLKMSYMVGFGARFPQKIHHRAASLPSLATYP  331

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GC+ GF++L+S+ PNPN+  G +VGGP  N+ + D R +   AEP TY +A +VG L
Sbjct  332  GHIGCQAGFQYLDSSSPNPNILTGAVVGGPDQNDAFTDDRKDFSHAEPATYINAPLVGSL  391

Query  241  SGL  233
            + L
Sbjct  392  AYL  394



>gb|ABF98747.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
Length=497

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GC  407
            C   +YT   LRKFA SQ DYVLG NP+KMSY+VG+G+ YPK  HHRGASIP +    GC
Sbjct  346  CGPTFYTTEVLRKFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGC  405

Query  406  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPT-TYNSAIIVGLLS  239
            K GFKW E+ +PNPN+ +G LV GP  ++ + D R N    EPT   N+ ++  L+S
Sbjct  406  KGGFKWRETKKPNPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALIS  462



>ref|XP_006836842.1| hypothetical protein AMTR_s00099p00070580 [Amborella trichopoda]
 gb|ERM99695.1| hypothetical protein AMTR_s00099p00070580 [Amborella trichopoda]
Length=485

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
             TC     TP+ LR+ A SQ DYVLGDNP  MSY+VGYGD +P+++HHRG+S+P+     
Sbjct  358  FTCGSLVVTPALLREVAKSQVDYVLGDNPRGMSYMVGYGDKFPQHIHHRGSSLPSITINT  417

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GC  GF+ L+ + PNPN+ +G +VGGP   +++ D RNN  Q EPTTY +A +VG L
Sbjct  418  QRIGCDAGFQSLKDSNPNPNLLLGAIVGGPDKFDSFTDDRNNYAQTEPTTYINAPLVGPL  477

Query  241  SGL  233
            + L
Sbjct  478  AYL  480



>ref|XP_010264780.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=628

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 81/126 (64%), Gaps = 5/126 (4%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---  425
            A I C G    PSDL  F  SQA+Y+LG NP  MSY+VG+G +YP+ VHHRGASI +   
Sbjct  502  ATIQCQGGRVGPSDLISFVRSQANYILGSNPKGMSYMVGFGSSYPQMVHHRGASIVSIKK  561

Query  424  DAT-TGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  251
            D T   CK G+  W     PNPNV VG +VGGP  N+ Y DSR+N  QAEP T N+A  V
Sbjct  562  DRTPVTCKGGYDMWFNRNAPNPNVLVGAIVGGPDQNDAYTDSRSNFQQAEPATVNTAPFV  621

Query  250  GLLSGL  233
            G+L+ L
Sbjct  622  GVLAKL  627



>ref|XP_010531476.1| PREDICTED: endoglucanase 23-like [Tarenaya hassleriana]
Length=498

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 81/121 (67%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-  413
            + CD    +P DLR+ A  Q DY+LGDNPMK+SY++GYG  +P+ +HHRG+SIP      
Sbjct  369  LHCDSLVISPDDLRRIAKKQVDYILGDNPMKISYMMGYGGRFPEQIHHRGSSIPCVKAHP  428

Query  412  ---GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GCK G++  +   PNPNV  G +VGGP  ++ ++  RNN+ Q+EPTTY +A  VG+L
Sbjct  429  KPFGCKAGWELFKKPGPNPNVLTGAVVGGPDGDDKFVGGRNNATQSEPTTYTNAPFVGVL  488

Query  241  S  239
            S
Sbjct  489  S  489



>dbj|BAL41418.1| endo-1,4-beta-glucanase [Allium sativum f. pekinense]
Length=501

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   TP  LR  A  Q DY+LGDNP KMSY+VGYG  YPK++HHRG+S+P+ A+  
Sbjct  372  VNCGGVTITPKKLRSIAKRQVDYLLGDNPEKMSYMVGYGSRYPKHIHHRGSSLPSVASHP  431

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C  GF  L S+ PNPNV VG +VGGP  ++ + D RN+  Q+EP TY +A +VG L
Sbjct  432  GKIQCSSGFAALTSSAPNPNVLVGAVVGGPDAHDQFGDQRNDYEQSEPATYINAPLVGSL  491

Query  241  SGL  233
            + L
Sbjct  492  AYL  494



>ref|XP_010088306.1| Endoglucanase 17 [Morus notabilis]
 gb|EXB33531.1| Endoglucanase 17 [Morus notabilis]
Length=504

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 82/123 (67%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   TP  LR  A  Q DY+LGDNP++MSY+VGYG  YP+ +HHRG+S+P+     
Sbjct  375  VVCGGTTVTPKRLRTIAKKQVDYLLGDNPLRMSYMVGYGPRYPQRIHHRGSSLPSVAKHP  434

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   C  GF +++S  PNPNV VG ++GGP L++ + D R++  Q+EP TY +A +VG L
Sbjct  435  AKIQCSAGFNFMKSQSPNPNVLVGAVIGGPDLHDRFPDQRSDYEQSEPATYTNAPLVGAL  494

Query  241  SGL  233
            + L
Sbjct  495  AYL  497



>pir||JA0174 cellulase (EC 3.2.1.4) - kidney bean (fragment)
Length=137

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 79/124 (64%), Gaps = 6/124 (5%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C   ++T S +R FA +Q +Y+LG NPMKMSY+VG+G  YPK +HHRG+SIP+     
Sbjct  11   INCGSSHFTASQIRGFAKTQVEYILGKNPMKMSYMVGFGSKYPKQLHHRGSSIPSIKVHP  70

Query  421  ATTGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
            A  GC  G   +  S  PNPN  VG +VGGP +  T+ D+R++   AEPTTY +A  V  
Sbjct  71   AKVGCNAGLSDYYNSANPNPNTHVGAIVGGP-IQMTFHDARSDYSHAEPTTYINAAFVAS  129

Query  244  LSGL  233
            +S L
Sbjct  130  ISAL  133



>ref|XP_002977531.1| hypothetical protein SELMODRAFT_417347 [Selaginella moellendorffii]
 gb|EFJ21535.1| hypothetical protein SELMODRAFT_417347 [Selaginella moellendorffii]
Length=467

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 4/117 (3%)
 Frame = -3

Query  577  GKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----G  410
            G  + P++L  FA  Q DY+LG+NP KMSY+VG+G  +P++VHHRG+S+P+  T      
Sbjct  348  GSNFKPNELITFAKRQIDYILGNNPRKMSYMVGFGAKFPQHVHHRGSSLPSIHTQPQRIS  407

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
            CKDGF WL +  PNPN+ +G +VGGP  N+ Y D+R++  Q+EP+TY +A +VG L+
Sbjct  408  CKDGFNWLHTPNPNPNLLIGAVVGGPDQNDNYADNRDDYSQSEPSTYINAGLVGALA  464



>ref|XP_006359861.1| PREDICTED: endoglucanase 17-like [Solanum tuberosum]
Length=510

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 82/123 (67%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   TP  LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+     
Sbjct  381  VKCGGVVITPKRLRNVAKKQVDYLLGDNPLKMSYMVGYGARYPQRIHHRGSSLPSVANHP  440

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   C+DGF  ++S  PNPNV VG +VGGP  ++ + D R++  Q+EP TY +A +VG L
Sbjct  441  AKIQCRDGFSVMKSQSPNPNVLVGAVVGGPDEHDRFPDERSDYEQSEPATYINAPLVGTL  500

Query  241  SGL  233
            + L
Sbjct  501  TYL  503



>emb|CDY41954.1| BnaA01g05260D [Brassica napus]
Length=467

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 79/122 (65%), Gaps = 4/122 (3%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            +++C    + P  LR+    Q DY+LGDNPM +SY+VGYGD YP+ VHHRG+SIP+    
Sbjct  337  QLSCGNLKFQPDSLRRIVKRQVDYILGDNPMHVSYMVGYGDQYPRQVHHRGSSIPSVKVQ  396

Query  424  DATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
                GC  G+    S  PNPN+ VG +VGGP +++T+I  R N+   EPTTY +A +VG+
Sbjct  397  STAFGCTQGWNIFHSDNPNPNILVGAVVGGPNVDDTFIGKRTNATDTEPTTYINAPLVGV  456

Query  244  LS  239
             +
Sbjct  457  FA  458



>emb|CAF18445.1| endo-1,4-beta-D-glucanase KORRIGAN [Pisum sativum]
Length=229

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGC  407
            C   +Y+   LR+FA +Q DY+LG NP KMSY+VG+G++YPK+VHHRGASIP T     C
Sbjct  86   CGPNFYSTDKLREFARTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKTKVKYNC  145

Query  406  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            K G+KW ++++PNPN+ VG +V GP  ++ + D R+N    EPT   +A +V  L  L
Sbjct  146  KGGWKWRDTSKPNPNILVGAMVAGPDRHDGFHDVRSNYNYTEPTLAGNAGLVAALVAL  203



>ref|NP_001051192.1| Os03g0736300 [Oryza sativa Japonica Group]
 sp|Q84R49.1|GUN10_ORYSJ RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; AltName: Full=OsGLU2 [Oryza sativa Japonica Group]
 gb|AAP03405.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|AAR07086.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|ABF98746.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13106.1| Os03g0736300 [Oryza sativa Japonica Group]
 dbj|BAG91933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76139.1| hypothetical protein OsI_13426 [Oryza sativa Indica Group]
 gb|EEE59884.1| hypothetical protein OsJ_12485 [Oryza sativa Japonica Group]
Length=620

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GC  407
            C   +YT   LRKFA SQ DYVLG NP+KMSY+VG+G+ YPK  HHRGASIP +    GC
Sbjct  469  CGPTFYTTEVLRKFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGC  528

Query  406  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPT-TYNSAIIVGLLS  239
            K GFKW E+ +PNPN+ +G LV GP  ++ + D R N    EPT   N+ ++  L+S
Sbjct  529  KGGFKWRETKKPNPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALIS  585



>ref|XP_010934144.1| PREDICTED: endoglucanase 8-like [Elaeis guineensis]
Length=434

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 84/121 (69%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + CDG   +PS L +   SQADY+LG NP+ MSY+VGYG+ +P+ +HHRG+S+P+ +   
Sbjct  308  VNCDGVQASPSRLIEVVKSQADYILGSNPLSMSYMVGYGNKFPQRIHHRGSSLPSISQHP  367

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GCKDG  + +S  PNPN+ VG +VGGP + + Y DSR  S+++EP TY +A +VG+ 
Sbjct  368  GHIGCKDGTPYFQSEAPNPNLLVGAIVGGPNITDAYADSRPYSVESEPITYINAPMVGIF  427

Query  241  S  239
            +
Sbjct  428  A  428



>gb|KHN38485.1| Endoglucanase 11 [Glycine soja]
Length=514

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 77/123 (63%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            K+ C G      ++  FA SQADY+LG NPM MSYLVGYG NYPK VHHRGASI +    
Sbjct  369  KLNCHGGTVDHEEILNFAKSQADYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKN  428

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W  S  PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +VG
Sbjct  429  KGFIGCTQGYDNWYGSQAPNPNVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVG  488

Query  247  LLS  239
            + +
Sbjct  489  VFA  491



>ref|XP_009334150.1| PREDICTED: endoglucanase 11-like [Pyrus x bretschneideri]
Length=509

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            +TCD    +P ++  FA SQ DY+LG NPM MSYLVGYG  YP+ VHHRGASI +     
Sbjct  368  LTCDKGQVSPQEILSFAKSQVDYILGSNPMAMSYLVGYGPKYPQRVHHRGASIDSYKKNK  427

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC  G+  W     PNPNV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+
Sbjct  428  GFIGCTQGYDSWYGKQGPNPNVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGV  487

Query  244  LSGL  233
            L+ L
Sbjct  488  LAKL  491



>ref|XP_003519454.1| PREDICTED: endoglucanase 11 [Glycine max]
Length=524

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 77/123 (63%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            K+ C G      ++  FA SQADY+LG NPM MSYLVGYG NYPK VHHRGASI +    
Sbjct  379  KLNCHGGTVDHEEILNFAKSQADYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKN  438

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W  S  PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +VG
Sbjct  439  KGFIGCTQGYDNWYGSQAPNPNVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVG  498

Query  247  LLS  239
            + +
Sbjct  499  VFA  501



>ref|XP_007142327.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
 gb|ESW14321.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
Length=515

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 76/125 (61%), Gaps = 5/125 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT-  416
            K+ C      P  +  FA SQ DY+LG NPM MSYLVGYG N+PK VHHRGASI +    
Sbjct  373  KLQCHRGEVGPHQMFAFAKSQVDYILGSNPMAMSYLVGYGPNFPKRVHHRGASIESSKEN  432

Query  415  ---TGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W    QPNPNV +G LVGGP   + + D R N +Q EP TYN+A +VG
Sbjct  433  KGFIGCVQGYDTWYGRVQPNPNVLIGALVGGPDRKDQFKDERQNYIQTEPCTYNTAALVG  492

Query  247  LLSGL  233
            + + L
Sbjct  493  VFARL  497



>ref|XP_009144504.1| PREDICTED: endoglucanase 23 [Brassica rapa]
Length=513

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 79/122 (65%), Gaps = 4/122 (3%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            +++C    + P  LR+    Q DY+LGDNPM +SY+VGYGD YP+ VHHRG+SIP+    
Sbjct  383  QLSCGNLKFQPDSLRRIVKRQVDYILGDNPMHVSYMVGYGDQYPRQVHHRGSSIPSVKVQ  442

Query  424  DATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
                GC  G+    S  PNPN+ VG +VGGP +++T+I  R N+   EPTTY +A +VG+
Sbjct  443  STAFGCTQGWNIFHSDNPNPNILVGAVVGGPNVDDTFIGKRTNATDTEPTTYINAPLVGV  502

Query  244  LS  239
             +
Sbjct  503  FA  504



>gb|EYU26800.1| hypothetical protein MIMGU_mgv1a019325mg [Erythranthe guttata]
Length=474

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C      P+DL  FA SQ DY+LG NP  MSY+VG+G NYPK VHHRGASI +     
Sbjct  349  IQCASGIVGPNDLMAFAKSQVDYMLGSNPKNMSYMVGFGSNYPKQVHHRGASIVSIKKDS  408

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
                C++GF +W  + Q NPNV  G +VGGP  ++ Y D+R+N  QAEP+T N+A +VG+
Sbjct  409  RPMSCQEGFEEWFHNNQENPNVLTGAIVGGPDRSDQYTDARDNYQQAEPSTANNAPLVGV  468

Query  244  LSGL  233
            L+ L
Sbjct  469  LARL  472



>ref|NP_001234882.1| endo-1,4-beta-glucanase precursor [Solanum lycopersicum]
 gb|AAA80495.1| endo-1,4-beta-glucanase precursor [Solanum lycopersicum]
Length=510

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   TP  LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+     
Sbjct  381  VKCGGVVITPKRLRNVAKKQVDYLLGDNPLKMSYMVGYGARYPQRIHHRGSSLPSVANHP  440

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   C+DGF  + S  PNPNV VG +VGGP  ++ + D R++  Q+EP TY +A +VG L
Sbjct  441  AKIQCRDGFSVMNSQSPNPNVLVGAVVGGPDEHDRFPDERSDYEQSEPATYINAPLVGTL  500

Query  241  SGL  233
            + L
Sbjct  501  TYL  503



>ref|XP_006283596.1| hypothetical protein CARUB_v10004652mg [Capsella rubella]
 gb|EOA16494.1| hypothetical protein CARUB_v10004652mg [Capsella rubella]
Length=496

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 84/121 (69%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA---  419
            + C      P  LR+ A  Q DY+LG+NPM +SY+VGYG+ YPK +HHRG+S+P+ A   
Sbjct  367  LNCGTLTVPPDYLRRLAKKQVDYILGENPMGLSYMVGYGERYPKRIHHRGSSLPSIADHP  426

Query  418  -TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GCKDG  +  ST+PNPNV +G +VGGP  ++TY D+R++  ++EPTTY +A  VG+L
Sbjct  427  GAIGCKDGSLYFNSTEPNPNVLIGAVVGGPGEDDTYDDNRSDFRKSEPTTYINAPFVGVL  486

Query  241  S  239
            +
Sbjct  487  A  487



>ref|XP_006388089.1| hypothetical protein POPTR_0347s002202g, partial [Populus trichocarpa]
 gb|ERP47003.1| hypothetical protein POPTR_0347s002202g, partial [Populus trichocarpa]
Length=199

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 82/121 (68%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C  K  +P+ L++ A  Q DY+LGDNP++MSY+VGYG  YP+ +HHRG+S+P+     
Sbjct  73   VPCGEKTASPALLKQLAKRQVDYILGDNPLRMSYMVGYGPRYPQRIHHRGSSLPSVRAHP  132

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   CK+G ++  S   NPNV VG +VGGP + + + DSR    ++EPTTY +A +VGLL
Sbjct  133  ARIRCKEGSRYFLSPNANPNVHVGAVVGGPNVTDAFPDSRPFFQESEPTTYINAPLVGLL  192

Query  241  S  239
            +
Sbjct  193  A  193



>ref|XP_006411695.1| hypothetical protein EUTSA_v10025010mg [Eutrema salsugineum]
 gb|ESQ53148.1| hypothetical protein EUTSA_v10025010mg [Eutrema salsugineum]
Length=493

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 78/122 (64%), Gaps = 4/122 (3%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            ++ C    + P  LR+ A  Q DYVLGDNPMK+SY++GYGD YP+ +HHRGASIP+    
Sbjct  363  RLNCGNLKFQPDSLRRIAKRQVDYVLGDNPMKLSYMIGYGDKYPRQIHHRGASIPSVKAH  422

Query  424  DATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
                GC  G+    S  P+PN+ VG ++GGP +++ +I  R N+   EPTTY +A  VGL
Sbjct  423  PKAFGCVQGWNIFASPNPDPNILVGAVIGGPDVDDKFIGKRTNASHTEPTTYINAPFVGL  482

Query  244  LS  239
             +
Sbjct  483  FA  484



>ref|XP_010436996.1| PREDICTED: endoglucanase 23-like [Camelina sativa]
Length=493

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 81/122 (66%), Gaps = 4/122 (3%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            +++C    + P  LR+    Q DYVLGDNPMK+SY++GYG+ YP+ +HHRG+S+P+    
Sbjct  363  QLSCGNLKFQPDSLRRIVKRQVDYVLGDNPMKLSYMIGYGERYPRLIHHRGSSVPSVTIH  422

Query  424  DATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
                GC  G+K   S  PNPN+ +G ++GGP +++ +I  R N+ + EPTTY +A  VG+
Sbjct  423  PTAFGCLQGWKIFSSPNPNPNILIGAVIGGPDVDDKFIGGRTNASETEPTTYINAPFVGI  482

Query  244  LS  239
            L+
Sbjct  483  LA  484



>ref|XP_003538279.1| PREDICTED: endoglucanase [Glycine max]
 gb|KHN35046.1| Endoglucanase [Glycine soja]
Length=511

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 80/125 (64%), Gaps = 5/125 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            +I C    +TPS +R FA +Q DY+LG NPMKMSY+VG+G  YPK +HHRG+SIP+    
Sbjct  367  RIHCGSALFTPSQIRAFAKTQVDYILGSNPMKMSYMVGFGSKYPKQLHHRGSSIPSINVH  426

Query  424  DATTGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC DG   +  S  PNPN  VG +VGGP  N+ + D+R++   +EPTTY +A  V 
Sbjct  427  PTKVGCNDGLSVYYNSANPNPNTHVGAIVGGPDSNDRFSDARSDYSHSEPTTYMNAAFVA  486

Query  247  LLSGL  233
             +S L
Sbjct  487  SVSAL  491



>ref|XP_003601448.1| Endo-1 4-beta-glucanase [Medicago truncatula]
 ref|XP_003628828.1| Endo-1 4-beta-glucanase [Medicago truncatula]
 gb|AES71699.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=499

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            ++C     T  +L K A  Q DY+LGDNP KMSY+VG+G+ YPK++HHRG+S+P+     
Sbjct  371  VSCGTSKITEQNLIKLAKKQVDYILGDNPTKMSYMVGFGEKYPKHIHHRGSSLPSIRVQP  430

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C +GF++L S  PNPNV VG +VGGP  ++ + D RNN  Q+EP TY +A  VG L
Sbjct  431  QQISCNNGFQYLHSGSPNPNVLVGAIVGGPDSSDNFSDDRNNYQQSEPATYINAPFVGAL  490

Query  241  S  239
            +
Sbjct  491  A  491



>ref|XP_002975128.1| hypothetical protein SELMODRAFT_415162 [Selaginella moellendorffii]
 gb|EFJ23913.1| hypothetical protein SELMODRAFT_415162 [Selaginella moellendorffii]
Length=468

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = -3

Query  577  GKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTG  410
            G  + P++L  FA  Q DY+LG+NP KMSY+VG+G  +P++VHHRG+S+P+         
Sbjct  349  GSNFKPNELITFAKRQIDYILGNNPRKMSYMVGFGAKFPQHVHHRGSSLPSIHAQPQRIS  408

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
            CKDGF WL +  PNPN+ +G +VGGP  N+ Y D+R++  Q+EP+TY +A +VG L+
Sbjct  409  CKDGFNWLHTPNPNPNLLIGAVVGGPDQNDNYADNRDDYSQSEPSTYINAGLVGALA  465



>ref|XP_003576683.2| PREDICTED: endoglucanase 4-like [Brachypodium distachyon]
Length=407

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 79/120 (66%), Gaps = 4/120 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DA  419
            +C     TPS L   A  Q DY+LG NP  MSY+VG+G  YP+ VHHRGAS+P+     A
Sbjct  276  SCGSTTVTPSTLVSLAKKQVDYILGANPAGMSYMVGFGARYPRRVHHRGASMPSLRDRPA  335

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
              GC  GF++L S++P+ NV VG +VGGP   + Y DSR+N  QAEP+TY +A +VG L+
Sbjct  336  RIGCDQGFRYLRSSEPDQNVLVGAVVGGPDQRDAYSDSRDNYAQAEPSTYTNAPLVGALA  395



>ref|XP_010481246.1| PREDICTED: endoglucanase 1 [Camelina sativa]
Length=501

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----  416
            C G   TP+ LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+ A     
Sbjct  378  CGGSVVTPARLRSIARKQVDYLLGDNPLKMSYMVGYGPKYPRRIHHRGSSLPSVAAHPSK  437

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
              C DGF    S  PNPNV VG +VGGP  N+ Y D R++  ++EP TY +A +VG L+ 
Sbjct  438  IQCHDGFSMFISQSPNPNVLVGAVVGGPDQNDQYPDERSDYGRSEPATYINAPLVGALAY  497

Query  235  L  233
            L
Sbjct  498  L  498



>ref|XP_003616918.1| Endoglucanase [Medicago truncatula]
 gb|AES99876.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=517

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 74/123 (60%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PT  425
            K+TC G      ++  FA SQ DY+LG NPM MSYLVGYG +YPK VHHRGASI      
Sbjct  372  KLTCHGGILDHKEILSFAKSQVDYILGSNPMNMSYLVGYGPSYPKRVHHRGASIMSYKEN  431

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W     PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +V 
Sbjct  432  KGFIGCTQGYDNWYSKEDPNPNVLVGALVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVA  491

Query  247  LLS  239
            L +
Sbjct  492  LFA  494



>ref|XP_010431848.1| PREDICTED: endoglucanase 23 [Camelina sativa]
Length=493

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 81/122 (66%), Gaps = 4/122 (3%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA--  419
            +++C    + P  LR+    Q DYVLGDNPMK+SY++GYG+ YP+ +HHRG+SIP+ A  
Sbjct  363  QLSCGNLKFQPDSLRRIVKRQVDYVLGDNPMKLSYMIGYGERYPRLIHHRGSSIPSVAIH  422

Query  418  --TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
                GC  G+    S  PNPN+ +G ++GGP +++ +I  R N+ + EPTTY +A  VG+
Sbjct  423  PTAFGCLQGWTIFSSPNPNPNILIGAVIGGPDVDDKFIGGRTNASETEPTTYINAPFVGI  482

Query  244  LS  239
            L+
Sbjct  483  LA  484



>gb|AFK38997.1| unknown [Medicago truncatula]
Length=517

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 74/123 (60%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PT  425
            K+TC G      ++  FA SQ DY+LG NPM MSYLVGYG +YPK VHHRGASI      
Sbjct  372  KLTCHGGILDHKEILSFAKSQVDYILGSNPMNMSYLVGYGPSYPKRVHHRGASIMSYKEN  431

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W     PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +V 
Sbjct  432  KGFIGCTQGYDNWYSKEDPNPNVLVGALVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVA  491

Query  247  LLS  239
            L +
Sbjct  492  LFA  494



>ref|NP_001142480.1| uncharacterized protein LOC100274698 [Zea mays]
 gb|ACG24268.1| hypothetical protein [Zea mays]
Length=198

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GC  407
            C   +YT   LRKFA SQ DY+LG NP+KMSY+VG+G+ YPK  HHRGASIP +    GC
Sbjct  46   CGPNFYTTEVLRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGC  105

Query  406  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPT-TYNSAIIVGLLS  239
            K G+KW ++ + NPN+ VG +V GP   + Y D R N    EPT   N+ ++  L+S
Sbjct  106  KGGYKWRDTKKANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALIS  162



>emb|CDY22400.1| BnaA06g37220D [Brassica napus]
Length=465

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 82/122 (67%), Gaps = 4/122 (3%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA--  419
            ++ C      P  LR  A  Q DY+LGDNPMKMSY++GYG++YP+ +HHRGAS P+ A  
Sbjct  336  QLHCGSVKIHPESLRHLAKRQVDYILGDNPMKMSYMIGYGNHYPRKIHHRGASSPSIATH  395

Query  418  --TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
              T  C +G+    S +P+PN+ VG +VGGP +++ ++  RNN+ + EPTTY +A  VGL
Sbjct  396  PKTIKCLEGWNIFASPKPDPNILVGAVVGGPNVDDKFVGGRNNASETEPTTYINAPFVGL  455

Query  244  LS  239
            L+
Sbjct  456  LA  457



>ref|XP_008801082.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GC  407
            C   Y++ S LR FA SQ DY+LGDNP KMSY+VGYG NYPK+VHHRGASIP +     C
Sbjct  468  CGPYYFSTSSLRSFAASQVDYILGDNPKKMSYVVGYGKNYPKHVHHRGASIPDNGVKYSC  527

Query  406  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
              G KWL +  PNPNV  G +VGGP  ++ ++D R N    EPT   +A +V  L  L
Sbjct  528  TGGRKWLNAKSPNPNVITGAMVGGPDRSDGFVDVRKNYGYTEPTLAGNAGLVAALVSL  585



>gb|AAA20082.1| CMCase; cellulase; endo-1,4-beta-D-glucanase, partial [Glycine 
max]
Length=299

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 79/125 (63%), Gaps = 5/125 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            +I C    +TPS +R FA +Q DY+LG NPMKMSY+VG+G  YPK +HHRG+SIP+    
Sbjct  155  RIHCGSALFTPSQIRAFAKTQVDYILGSNPMKMSYMVGFGSKYPKQLHHRGSSIPSINVH  214

Query  424  DATTGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC DG   +  S  PNPN  VG +VGGP  N+ + D+R++   + PTTY +A  V 
Sbjct  215  PTKVGCNDGLSVYYNSANPNPNTHVGAIVGGPDSNDRFSDARSDYSHSGPTTYMNAAFVA  274

Query  247  LLSGL  233
             +S L
Sbjct  275  SVSAL  279



>ref|XP_009360195.1| PREDICTED: endoglucanase CX-like [Pyrus x bretschneideri]
Length=495

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 78/122 (64%), Gaps = 4/122 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DA  419
            TC     T   L   A  Q DY+LGDNP KMSY+VG+GD +P++VHHRG+S+P+      
Sbjct  369  TCGSSKVTAETLISEAKKQVDYILGDNPAKMSYMVGFGDKFPQHVHHRGSSLPSVHQHPD  428

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
              GC DGF++L S  PNPNV VG +VGGP   + + D RNN  Q+EP TY +A  VG L+
Sbjct  429  RLGCNDGFQYLNSGSPNPNVLVGAVVGGPDSKDNFADDRNNYQQSEPATYINAPFVGALA  488

Query  238  GL  233
             L
Sbjct  489  FL  490



>gb|AGV22124.1| endo-1,4-beta-glucanase 2 [Betula luminifera]
Length=498

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 78/122 (64%), Gaps = 4/122 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DA  419
            TC G   T  +L   A  Q DY+LGDNP KMSY+VG+G+ YP+++HHRG+S+P+      
Sbjct  370  TCGGSKVTAENLITQAKKQVDYILGDNPAKMSYMVGFGEKYPQHIHHRGSSVPSIHAHPG  429

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
               C DGF++L S  PNPNV VG +VGGP   + + D RNN  Q EP TY +A  VG L+
Sbjct  430  RIACNDGFQYLNSGSPNPNVLVGAIVGGPDSGDKFADDRNNYQQFEPATYINAPFVGALA  489

Query  238  GL  233
             L
Sbjct  490  FL  491



>gb|EPS73295.1| hypothetical protein M569_01458 [Genlisea aurea]
Length=490

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKY-YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  416
            ++ C G+   TPS L+  A  Q DY+LGDNPM MSY+VGYG  YP+ +HHRG+S+P+ A 
Sbjct  362  RVPCGGQTPATPSLLKTLARRQVDYILGDNPMGMSYMVGYGARYPRRIHHRGSSLPSVAA  421

Query  415  ----TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                 GCKDG ++  S  PNPNV VG +VGGP  ++ + DSR    ++EPTTY +A +VG
Sbjct  422  HPWRIGCKDGTRYYLSQNPNPNVLVGAVVGGPNCSDAFPDSRPFFQESEPTTYINAPLVG  481

Query  247  LLS  239
            LL+
Sbjct  482  LLA  484



>gb|AGG19087.1| cellulase [Hordeum vulgare subsp. vulgare]
Length=476

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 4/120 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DA  419
            +C     TPS L   A  Q DY+LG NP  MSY+VG+G  YP+ VHHRGAS+P+     A
Sbjct  349  SCGSTAVTPSTLVSLAKKQVDYILGANPAGMSYMVGFGARYPRRVHHRGASMPSVRDHPA  408

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
              GC +GF++L S+ P+ NV VG +VGGP  +++Y DSR+N  QAEP+TY +A +VG L+
Sbjct  409  RIGCDEGFRYLHSSDPDRNVLVGAVVGGPDQSDSYSDSRDNYAQAEPSTYTNAPLVGALA  468



>ref|XP_008796892.1| PREDICTED: endoglucanase 8-like [Phoenix dactylifera]
Length=499

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 83/121 (69%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            ++C+G   +P  L + A +QADY+LG NP+ MSYLVGYG+ +P+ +HHRG+S+P+     
Sbjct  373  VSCNGVLASPQRLIELAKTQADYILGSNPLSMSYLVGYGNKFPQRIHHRGSSLPSVGQHP  432

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GCKDG  + +S  PNPN+ VG +VGGP  N+ Y DSR +  Q+EPTTY  A +VG+ 
Sbjct  433  GHIGCKDGTPYFQSEGPNPNLLVGAIVGGPNNNDAYADSRPDFAQSEPTTYIVAPMVGVF  492

Query  241  S  239
            +
Sbjct  493  A  493



>dbj|BAA06877.1| cellulase precursor [Populus alba]
Length=494

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 4/119 (3%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT--DATTG  410
            C G   T   L   A  Q DY+LGDNP +MSY+VG+G+ YP++VHHRG+S+P+  D   G
Sbjct  370  CGGSTVTAESLIAQAKKQVDYILGDNPARMSYMVGFGNRYPQHVHHRGSSVPSIHDTRIG  429

Query  409  --CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
              C DGF++L S+ PNPNV VG ++GGP   + + DSRNN  Q+EP TY +A  VG L+
Sbjct  430  ISCNDGFQFLYSSSPNPNVLVGAIIGGPDNRDNFADSRNNYQQSEPATYINAPFVGALA  488



>ref|XP_002509863.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF51250.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=518

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 80/124 (65%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C    ++   +R FA SQ DY+LG NPMKMSY+VG+G  YP  +HHRGASIP+     
Sbjct  369  VQCGSARFSAFQIRAFAKSQVDYILGKNPMKMSYMVGFGSKYPTQIHHRGASIPSVKVHP  428

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
            A  GC DGF  +  S +PNPN+ VG +VGGP  N+ Y D R+   +AEPTTY +A  +G 
Sbjct  429  AKVGCNDGFSSYYHSDKPNPNIHVGAIVGGPDSNDQYKDLRSEYSRAEPTTYINAAFLGS  488

Query  244  LSGL  233
            ++ L
Sbjct  489  VAAL  492



>ref|XP_008374126.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase CX-like [Malus 
domestica]
Length=495

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DA  419
            TC     T   L   A  Q DY+LGDNP KMSY+VG+GD +P++VHHRG+S+P+      
Sbjct  369  TCGSSKITAETLISEAKKQVDYILGDNPAKMSYMVGFGDKFPQHVHHRGSSLPSVHQHPG  428

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
              GC DGF++L S  PNPNV VG +VGGP   + + D RNN  Q+EP TY +A  VG L+
Sbjct  429  RLGCNDGFQYLNSGSPNPNVLVGAVVGGPDSKDNFADDRNNYQQSEPATYINAPFVGALA  488



>sp|P23666.1|GUN2_PERAE RecName: Full=Endoglucanase 2; AltName: Full=Abscission cellulase 
2; AltName: Full=Endo-1,4-beta-glucanase 2, partial [Persea 
americana]
 emb|CAA39314.1| cellulase [Persea americana]
Length=130

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 4/120 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT---  416
            +C     T  +L   A  Q DY+LG+NP KMSY+VG+G+ YP++VHHRG+S+P+      
Sbjct  2    SCGSTTVTAKNLISLAKKQVDYILGENPAKMSYMVGFGERYPQHVHHRGSSLPSVHAHPN  61

Query  415  -TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
               C  GF++L S+ PNPN+ VG ++GGP   +++ D RNN  Q+EP TY +A +VG L+
Sbjct  62   PIPCNAGFQYLYSSSPNPNILVGAILGGPDSRDSFSDDRNNYQQSEPATYINAPLVGALA  121



>ref|XP_008385953.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=286

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 76/124 (61%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            +TCD    +P ++  FA SQ DY+LG NPM MSYL GYG  YP+ VHHRGASI +     
Sbjct  145  LTCDKGQVSPQEILSFAKSQVDYILGSNPMAMSYLXGYGPKYPQRVHHRGASIDSYKKNK  204

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC  G+  W     PNPNV  G LVGGP  N+ + D R N MQ E  TYN+A +VG+
Sbjct  205  GFIGCTQGYDSWYGRQGPNPNVLXGALVGGPDGNDGFXDERWNYMQTEACTYNTATLVGV  264

Query  244  LSGL  233
            L+ L
Sbjct  265  LAKL  268



>ref|XP_009101916.1| PREDICTED: endoglucanase 22-like [Brassica rapa]
Length=490

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 82/122 (67%), Gaps = 4/122 (3%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA--  419
            ++ C      P  LR  A  Q DY+LGDNPMKMSY++GYG++YP+ +HHRGAS P+ A  
Sbjct  361  QLHCGSVKIHPESLRHLAKRQMDYILGDNPMKMSYMIGYGNHYPRKIHHRGASSPSIATH  420

Query  418  --TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
              T  C +G+    S +P+PN+ VG +VGGP +++ ++  RNN+ + EPTTY +A  VGL
Sbjct  421  PKTIKCLEGWNIFASPKPDPNILVGAVVGGPNVDDKFVGGRNNASETEPTTYINAPFVGL  480

Query  244  LS  239
            L+
Sbjct  481  LA  482



>ref|XP_004304093.1| PREDICTED: endoglucanase 11 [Fragaria vesca subsp. vesca]
Length=517

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 79/123 (64%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            K++C G      ++  FA SQ DY+LG NP  MSYLVGYG NYP+ VHHRGAS+ +    
Sbjct  372  KLSCHGGTVAHQEILSFAKSQVDYILGSNPSNMSYLVGYGSNYPQRVHHRGASVVSYREN  431

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
             A  GC  G+  W    +PNPNV VG LVGGP  ++ ++D R+N MQ E  TYN+A +VG
Sbjct  432  KAFIGCTQGYDNWYGRLEPNPNVLVGALVGGPDSHDNFLDQRDNYMQTEACTYNTAPLVG  491

Query  247  LLS  239
            + +
Sbjct  492  VFA  494



>emb|CDY52780.1| BnaCnng23250D [Brassica napus]
Length=518

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G  YTP  LR  A  Q DY+LGDNP++MSY+VGYG  +P+ +HHRG+S+P  A+  
Sbjct  389  VHCGGSVYTPGRLRSIAKKQVDYLLGDNPLRMSYMVGYGPKFPRRIHHRGSSLPCVASHP  448

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C +GF  L S  PNPN+ VG +VGGP  ++ + D R +  Q+EP TY +A +VG L
Sbjct  449  AKVQCHEGFSILNSQSPNPNILVGAVVGGPDQHDRFPDERTDYEQSEPATYINAPLVGAL  508

Query  241  S  239
            +
Sbjct  509  A  509



>gb|AEO97200.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97227.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=489

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   TP  LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+ AT  
Sbjct  351  VNCGGTVVTPKRLRTIAKKQVDYLLGDNPLKMSYMVGYGPRYPQRIHHRGSSLPSIATHP  410

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C  GF  + S  PNPNV VG +VGGP  ++ + D R++  Q+EP TY +A +VG L
Sbjct  411  GKIQCTSGFSVMNSQSPNPNVLVGAIVGGPDEHDRFPDERSDYEQSEPATYINAPLVGAL  470

Query  241  SGL  233
            + L
Sbjct  471  AYL  473



>ref|XP_002301487.1| hypothetical protein POPTR_0002s20350g [Populus trichocarpa]
 gb|EEE80760.1| hypothetical protein POPTR_0002s20350g [Populus trichocarpa]
Length=520

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   TP  LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+ AT  
Sbjct  382  VNCGGTVVTPKRLRTIAKKQVDYLLGDNPLKMSYMVGYGPRYPQRIHHRGSSLPSIATHP  441

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C  GF  + S  PNPNV VG +VGGP  ++ + D R++  Q+EP TY +A +VG L
Sbjct  442  GKIQCTSGFSVMNSQSPNPNVLVGAIVGGPDEHDRFPDERSDYEQSEPATYINAPLVGAL  501

Query  241  SGL  233
            + L
Sbjct  502  AYL  504



>gb|ADQ73896.1| endo-1,4-beta-glucanase [Avena strigosa]
Length=338

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GC  407
            C   +Y    LRKFA SQ DY+LG NP KMSY+VGYG  YPK VHHRGASIP +    GC
Sbjct  185  CGPNFYKTDVLRKFAKSQIDYILGKNPQKMSYVVGYGKKYPKRVHHRGASIPHNGVHYGC  244

Query  406  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPT-TYNSAIIVGLLS  239
            K GFKW ES + NPN+ VG +V GP  ++ + D R N    EPT   N+ ++  L+S
Sbjct  245  KGGFKWRESKKANPNILVGAMVAGPDRHDGFKDIRTNYNYTEPTLAANAGLVAALIS  301



>gb|KHM99090.1| Endoglucanase 11 [Glycine soja]
Length=527

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 76/123 (62%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            K+ C G      ++  FA SQ DY+LG NPM MSYLVGYG NYPK VHHRGASI +    
Sbjct  382  KLNCHGGTVDHEEILNFAKSQVDYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKN  441

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W  S  PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +VG
Sbjct  442  KGFIGCTQGYDNWYGSQAPNPNVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVG  501

Query  247  LLS  239
            + +
Sbjct  502  VFA  504



>emb|CDY23486.1| BnaC06g24550D [Brassica napus]
Length=488

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C     +PS LR+ A  Q DY+LGDNP+ MSY+VGYG  +P+ +HHRG+S+P+     
Sbjct  359  VPCGELTASPSLLRQVAKRQVDYILGDNPLGMSYMVGYGRRFPRRIHHRGSSVPSVSAHP  418

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A  GCK+G ++  S+ PNPN+ VG +VGGP + + + DSR   +Q+EPTTY +A +VGLL
Sbjct  419  ARIGCKEGSRYFLSSNPNPNLLVGAVVGGPNVTDAFPDSRPYFVQSEPTTYINAPLVGLL  478



>gb|KDP30800.1| hypothetical protein JCGZ_13743 [Jatropha curcas]
Length=532

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 75/125 (60%), Gaps = 5/125 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            K+ C G      ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI +    
Sbjct  384  KLVCHGGLVDHEEILNFAKSQVDYILGSNPMNMSYLVGYGSKYPTRVHHRGASIVSYREN  443

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W    +PNPNV VG LVGGP   + ++D R N MQ E  TYN+A +VG
Sbjct  444  KGFIGCTQGYDNWYSQKEPNPNVLVGALVGGPDCQDNFMDQRGNYMQTEACTYNTAPLVG  503

Query  247  LLSGL  233
            + + L
Sbjct  504  VFAKL  508



>ref|XP_009378750.1| PREDICTED: endoglucanase 17 [Pyrus x bretschneideri]
 ref|XP_009335709.1| PREDICTED: endoglucanase 17-like [Pyrus x bretschneideri]
 ref|XP_009335713.1| PREDICTED: endoglucanase 17-like [Pyrus x bretschneideri]
Length=510

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 78/123 (63%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   TP  LR  A  Q DY+LGDNPMKMSY+VGYG  YP+ +HHRG+S+P      
Sbjct  381  VNCGGTAITPKRLRAIAKRQVDYLLGDNPMKMSYMVGYGPRYPRRIHHRGSSLPCIAAHP  440

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   C  GF  + S  PNPN+ VG ++GGP  N+ + D R++  Q+EP TY +A +VG L
Sbjct  441  AKIQCSSGFSVMSSQSPNPNILVGAVIGGPDKNDKFPDQRSDYEQSEPATYINAPLVGSL  500

Query  241  SGL  233
            + L
Sbjct  501  AYL  503



>ref|XP_004500768.1| PREDICTED: endoglucanase 24-like isoform X3 [Cicer arietinum]
Length=340

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 81/121 (67%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            I C   Y +   LR+ A  Q DY+LGDNP+ +SY+VGYG+NYP+ +HHRG+S+P      
Sbjct  211  INCGNVYVSAQTLRERAKRQVDYILGDNPLGLSYMVGYGNNYPQRIHHRGSSLPNIKDHP  270

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                CK+G  +  ST PNPNV VG +VGGP  ++ Y+D R + +++EPTTY +A  VG+L
Sbjct  271  QKIACKEGSIYFNSTNPNPNVLVGAIVGGPGEDDVYMDDRADYIKSEPTTYINAPFVGVL  330

Query  241  S  239
            +
Sbjct  331  A  331



>ref|XP_002510937.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF51539.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=506

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C     TP+ L   A  Q DY+LG NP+ MSY+VGYG+ YP+ +HHRG+++P      
Sbjct  374  VKCGNVVATPTRLVAVAKGQVDYILGRNPLGMSYMVGYGNKYPQRIHHRGSTLPMIQNHP  433

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
               GCK+G  + ES  PNPNV VG +VGGP +N+ Y+D R N  Q+EPTTY +A  VG+L
Sbjct  434  QHIGCKEGTPYFESNNPNPNVLVGAIVGGPDINDQYVDDRLNVSQSEPTTYINAPFVGVL  493

Query  241  SGL  233
            + L
Sbjct  494  AYL  496



>ref|XP_006858738.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
 gb|ERN20205.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
Length=619

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  404
            C   Y++   LR+FA SQ +Y+LGDNP KMSY+VGYG NYPK+VHHRGASIP +  T C 
Sbjct  470  CGPYYFSAIVLRQFAQSQINYILGDNPRKMSYVVGYGSNYPKHVHHRGASIPNNQKTTCT  529

Query  403  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
             G+KW +S  PNPN   G +VGGP   + + D R+N    EPT   +A +V  L  L
Sbjct  530  GGWKWRDSNNPNPNTITGAMVGGPDRFDQFRDVRSNYNYTEPTLAGNAGLVAALISL  586



>ref|XP_009595307.1| PREDICTED: endoglucanase 18-like [Nicotiana tomentosiformis]
Length=512

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            +TC    ++ S+++ FA SQ DY+LG+NP+KMSY+VG+G  YP  +HHR +SIP+     
Sbjct  357  VTCGSVTFSTSNIKAFAKSQVDYILGNNPLKMSYMVGFGSKYPTQLHHRASSIPSIYNHP  416

Query  421  ATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGL  245
               GC DG+  W  S  PNPN+ VG +VGGP   + ++DSR++   +EPTTY +A  VG 
Sbjct  417  TRVGCNDGYSSWYNSNNPNPNIHVGAIVGGPNSGDQFVDSRSDYSHSEPTTYMNAAFVGS  476

Query  244  LSGL  233
            ++ L
Sbjct  477  VAAL  480



>ref|XP_011079628.1| PREDICTED: endoglucanase 17 [Sesamum indicum]
Length=506

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   TP  LR FA  Q DY+LGDNP+KMS++VGYG  YP  +HHRG+S+P+ A   
Sbjct  377  VNCGGHIITPKKLRTFAQKQVDYLLGDNPLKMSFMVGYGPRYPLRIHHRGSSLPSVAAHP  436

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C  GF  ++S  PNPN+  G +VGGP  N+ + D R++  Q+EP TY +A +VG L
Sbjct  437  SKIQCSSGFSIMDSQSPNPNILTGAVVGGPDQNDRFPDQRSDYEQSEPATYINAPLVGAL  496

Query  241  SGL  233
            + L
Sbjct  497  AYL  499



>gb|KCW73256.1| hypothetical protein EUGRSUZ_E01717 [Eucalyptus grandis]
Length=475

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 79/126 (63%), Gaps = 5/126 (4%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---  425
            A I C G   + SDL + A SQADY+LG+NP K+SY+VGYG NYP  VHHRGASI +   
Sbjct  349  ASIQCPGGIASSSDLIELAQSQADYILGENPNKLSYMVGYGSNYPTQVHHRGASIVSIKK  408

Query  424  DAT-TGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  251
            D T   C  GF  W     PNPNV  G LVGGP   + Y DSR+N   AEP T N+A  V
Sbjct  409  DPTPVSCSQGFDLWFNKNAPNPNVLDGALVGGPDQQDGYSDSRSNYQMAEPATANTAPFV  468

Query  250  GLLSGL  233
            G+L+ L
Sbjct  469  GVLARL  474



>ref|XP_008369029.1| PREDICTED: endoglucanase 17-like [Malus domestica]
Length=509

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 78/123 (63%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT--  416
            + C G   TP  LR  A  Q DY+LGDNPMKMSY+VGYG  YP+ +HHRG+S+P  A   
Sbjct  380  VNCGGTAITPKRLRAIAKRQVDYLLGDNPMKMSYMVGYGPRYPQRIHHRGSSLPCIAAHP  439

Query  415  --TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
                C  GF  + S  PNPN+ VG ++GGP  N+ + D R++  Q+EP TY +A +VG L
Sbjct  440  TKIQCSSGFSVMSSQSPNPNILVGAVIGGPDKNDKFPDQRSDYEQSEPATYINAPLVGSL  499

Query  241  SGL  233
            + L
Sbjct  500  AYL  502



>ref|XP_010058568.1| PREDICTED: endoglucanase 14-like [Eucalyptus grandis]
Length=492

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 79/126 (63%), Gaps = 5/126 (4%)
 Frame = -3

Query  595  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---  425
            A I C G   + SDL + A SQADY+LG+NP K+SY+VGYG NYP  VHHRGASI +   
Sbjct  366  ASIQCPGGIASSSDLIELAQSQADYILGENPNKLSYMVGYGSNYPTQVHHRGASIVSIKK  425

Query  424  DAT-TGCKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  251
            D T   C  GF  W     PNPNV  G LVGGP   + Y DSR+N   AEP T N+A  V
Sbjct  426  DPTPVSCSQGFDLWFNKNAPNPNVLDGALVGGPDQQDGYSDSRSNYQMAEPATANTAPFV  485

Query  250  GLLSGL  233
            G+L+ L
Sbjct  486  GVLARL  491



>ref|XP_008386675.1| PREDICTED: endoglucanase 17-like [Malus domestica]
 ref|XP_008359414.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 17-like [Malus 
domestica]
Length=508

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   TP  LR  A  Q DY+LGDNPMKMSY+VGYG  YP+ +HHRG+S+P+     
Sbjct  379  VNCGGTVITPMWLRAIAKRQVDYLLGDNPMKMSYMVGYGPRYPQRIHHRGSSLPSVAAHP  438

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   C  GF  + S  PNPN+ VG ++GGP  N+ + D R++  Q+EP TY +A +VG L
Sbjct  439  AKIQCSSGFSVMSSQSPNPNILVGAVIGGPDQNDKFPDQRSDYEQSEPATYINAPLVGTL  498

Query  241  SGL  233
            + L
Sbjct  499  TYL  501



>ref|XP_002278065.1| PREDICTED: endoglucanase 25-like [Vitis vinifera]
Length=624

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-G  410
            +C G  YT   L+ F+MSQ +Y+LGDNPMKMSY+VG+GD+YP +VHHR ASIP D     
Sbjct  473  SCGGYNYTLEMLQSFSMSQVNYILGDNPMKMSYVVGFGDSYPIHVHHRSASIPWDGHQYS  532

Query  409  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  233
            C+DG KWL S  PNPN  +G +VGGP  ++ ++D R      EP+  ++A +V  L  L
Sbjct  533  CEDGDKWLHSEDPNPNTLLGAMVGGPDQHDKFLDDRKKPWFTEPSISSNAGLVAALIAL  591



>ref|XP_010676913.1| PREDICTED: endoglucanase 1-like [Beta vulgaris subsp. vulgaris]
Length=496

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 78/117 (67%), Gaps = 4/117 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DA  419
            +C     T + L   A  Q DY+LGDNP KMSY+VG+G+ YP +VHHRG+S+P+     +
Sbjct  368  SCGSSIITANKLISLAKQQVDYILGDNPEKMSYMVGFGNKYPMHVHHRGSSLPSVHAHPS  427

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
              GC DGF++L S  PNPNV VG ++GGP  ++++ D RNN  Q+EP TY +A  VG
Sbjct  428  RIGCNDGFQYLNSGSPNPNVLVGAILGGPDFSDSFTDDRNNYRQSEPATYINAPFVG  484



>ref|XP_009105740.1| PREDICTED: endoglucanase 8 [Brassica rapa]
 emb|CDX96271.1| BnaA07g28820D [Brassica napus]
Length=499

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C     +PS LR+ A  Q DY+LGDNP+ MSY+VGYG  +P+ +HHRG+S+P+     
Sbjct  370  VPCGELTASPSLLRQVAKRQVDYILGDNPLGMSYMVGYGQRFPRRIHHRGSSVPSVSAHP  429

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A  GCK+G ++  S  PNPN+ VG +VGGP + + + DSR   +Q+EPTTY +A +VGLL
Sbjct  430  ARIGCKEGSRYFLSPNPNPNLLVGAVVGGPNVTDAFPDSRPYFVQSEPTTYINAPLVGLL  489



>gb|EMT30810.1| Endoglucanase 4 [Aegilops tauschii]
Length=424

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 80/120 (67%), Gaps = 4/120 (3%)
 Frame = -3

Query  586  TCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DA  419
            +C     TPS L   A  Q DY+LG NP  MSY+VG+G  YP+ VHHRGAS+P+     A
Sbjct  299  SCGSTAVTPSTLVSLAKKQVDYILGANPAGMSYMVGFGARYPRRVHHRGASMPSVHDHPA  358

Query  418  TTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
              GC +GF +L S+ P+ NV VG +VGGP  +++Y DSR+N  QAEP+TY +A +VG L+
Sbjct  359  RIGCDEGFHYLHSSDPDRNVLVGAVVGGPDQSDSYSDSRDNYAQAEPSTYTNAPLVGALA  418



>ref|XP_006418304.1| hypothetical protein EUTSA_v10007402mg [Eutrema salsugineum]
 gb|ESQ36657.1| hypothetical protein EUTSA_v10007402mg [Eutrema salsugineum]
Length=509

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----  416
            C G   TP+ LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+ A     
Sbjct  384  CGGSVVTPARLRSIAKKQVDYLLGDNPLKMSYMVGYGPKYPRRIHHRGSSLPSVANHPTK  443

Query  415  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  236
              C DGF    S  PNPNV +G +VGGP  N+ + D R++  ++EP TY +A +VG L+ 
Sbjct  444  IQCHDGFSMYNSQSPNPNVLLGAVVGGPDQNDQFPDERSDYQRSEPATYINAPLVGALAY  503

Query  235  L  233
            L
Sbjct  504  L  504



>emb|CBI36884.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   TP  LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+     
Sbjct  310  VNCGGTIITPKRLRVIAKKQVDYLLGDNPLKMSYMVGYGPRYPQRIHHRGSSLPSIAKHP  369

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   C  GF  + S  PNPN+ VG +VGGP  ++ + D R++  Q+EP+TY +A +VG L
Sbjct  370  AKIQCSAGFNIMHSQSPNPNILVGAVVGGPDQHDRFPDQRSDFEQSEPSTYTNAPLVGAL  429

Query  241  SGL  233
            + L
Sbjct  430  TYL  432



>ref|XP_010259197.1| PREDICTED: endoglucanase 8-like [Nelumbo nucifera]
Length=458

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -3

Query  562  PSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF  395
            P+ L  FA SQ DY+LG NP+ MSY+VGYG+ +P+ +HHRG+S+P+        GCKDG 
Sbjct  322  PNRLIAFAKSQVDYILGHNPLNMSYMVGYGNKFPQRIHHRGSSLPSVDKHPKHMGCKDGT  381

Query  394  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  239
             ++ ++ PNPNV VG +VGGP +++TY DSR    Q+EPTTY +A +VGLL+
Sbjct  382  PYILTSNPNPNVLVGAVVGGPAVDDTYADSRTLFRQSEPTTYINAPLVGLLA  433



>ref|XP_011047209.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
 ref|XP_011047210.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=528

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 76/125 (61%), Gaps = 5/125 (4%)
 Frame = -3

Query  592  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----  425
            K+ C G    P ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI +    
Sbjct  384  KLKCHGGSVDPEEILGFAKSQVDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYREN  443

Query  424  DATTGCKDGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                GC  G+  W    +PNPNV VG LVGGP   + + D R+N MQ E  TYN+A +VG
Sbjct  444  KGFIGCTQGYDNWYGREEPNPNVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVG  503

Query  247  LLSGL  233
            + + L
Sbjct  504  VFAKL  508



>ref|XP_008467115.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 8 [Cucumis melo]
Length=489

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 4/121 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   +PS LR+ A  Q DY+LGDNP++MSY+VGYG  YP  +HHR +S+P+     
Sbjct  363  VPCGGFSASPSMLRQLAKRQVDYILGDNPLRMSYMVGYGARYPLRIHHRASSLPSVQAHP  422

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A  GCK G ++  S  PNPNV VG +VGGP + + + DSR    ++EPTTY +A +VGLL
Sbjct  423  ARIGCKAGSRYFLSPNPNPNVLVGAVVGGPNVTDAFPDSRPFFQESEPTTYINAPLVGLL  482

Query  241  S  239
            +
Sbjct  483  A  483



>gb|KJB41903.1| hypothetical protein B456_007G126900 [Gossypium raimondii]
Length=510

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  589  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----D  422
            + C G   TP  LR  A  Q DY+LGDNP+KMSY+VGYG  YP+ +HHRG+S+P+     
Sbjct  381  VNCGGTRVTPKRLRTIAKKQVDYLLGDNPLKMSYMVGYGPRYPQRIHHRGSSLPSVANHP  440

Query  421  ATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  242
            A   C  GF +++S  PNPN+ VG ++GGP   + + D R++  Q+EP TY +A +VG L
Sbjct  441  AKIQCSTGFNFMKSQSPNPNILVGAVIGGPDQKDRFPDQRSDYEQSEPATYINAPLVGAL  500

Query  241  SGL  233
            + L
Sbjct  501  TYL  503



>gb|EMT00674.1| Endoglucanase 10 [Aegilops tauschii]
Length=555

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -3

Query  583  CDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GC  407
            C   +YT   LRKFA SQ DY+LG NP KMSY+VG+G  YPK VHHRGASIP +    GC
Sbjct  403  CGPNFYTTDVLRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGC  462

Query  406  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPT-TYNSAIIVGLLS  239
            K GFKW ES + NPN+ VG +V GP  ++ + D R N    EPT   N+ ++  L+S
Sbjct  463  KGGFKWRESKKANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAGLVAALIS  519



>ref|XP_007131339.1| hypothetical protein PHAVU_011G005600g [Phaseolus vulgaris]
 gb|ESW03333.1| hypothetical protein PHAVU_011G005600g [Phaseolus vulgaris]
Length=400

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 83/123 (67%), Gaps = 5/123 (4%)
 Frame = -3

Query  592  KITCDGKYY-TPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---  425
            +I C G  + +P+ LR+ A  Q DY+LG NP+ MSY+VGYG  YP+ +HHR +S+P+   
Sbjct  271  EIDCGGNVFASPTRLRQIARGQVDYILGSNPLNMSYMVGYGAKYPERIHHRASSLPSMDE  330

Query  424  -DATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  248
                 GCK+G  + ES  PNPN+  G +VGGP+LN++Y D R + + +EPTTY +A +VG
Sbjct  331  YPPHVGCKEGSFYFESQNPNPNLLTGAVVGGPYLNDSYADHRADFVHSEPTTYINAPLVG  390

Query  247  LLS  239
            + +
Sbjct  391  VFA  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510