BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049N17

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767028.1|  PREDICTED: probable protein phosphatase 2C 3...    192   2e-55   Nicotiana sylvestris
ref|XP_009588474.1|  PREDICTED: probable protein phosphatase 2C 3...    192   2e-55   
ref|XP_009588473.1|  PREDICTED: probable protein phosphatase 2C 3...    192   2e-55   Nicotiana tomentosiformis
ref|XP_009767026.1|  PREDICTED: probable protein phosphatase 2C 3...    192   2e-55   Nicotiana sylvestris
ref|XP_009767020.1|  PREDICTED: probable protein phosphatase 2C 1...    192   5e-55   Nicotiana sylvestris
ref|XP_009588467.1|  PREDICTED: probable protein phosphatase 2C 1...    192   5e-55   Nicotiana tomentosiformis
ref|XP_010320753.1|  PREDICTED: probable protein phosphatase 2C 15      192   7e-55   
gb|KDO38779.1|  hypothetical protein CISIN_1g033174mg                   178   4e-53   Citrus sinensis [apfelsine]
ref|XP_006344157.1|  PREDICTED: probable protein phosphatase 2C 1...    186   7e-53   Solanum tuberosum [potatoes]
ref|XP_008351008.1|  PREDICTED: probable protein phosphatase 2C 15      177   2e-51   
ref|XP_007044253.1|  Phosphatase 2C family protein                      181   6e-51   
ref|XP_010264732.1|  PREDICTED: probable protein phosphatase 2C 15      181   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_008389261.1|  PREDICTED: probable protein phosphatase 2C 15      179   3e-50   
gb|KDP29451.1|  hypothetical protein JCGZ_18372                         179   3e-50   Jatropha curcas
ref|XP_002527010.1|  protein phosphatase, putative                      179   6e-50   Ricinus communis
ref|XP_004497062.1|  PREDICTED: probable protein phosphatase 2C 1...    177   2e-49   Cicer arietinum [garbanzo]
ref|XP_006378470.1|  hypothetical protein POPTR_0010s13130g             177   2e-49   
ref|XP_010044241.1|  PREDICTED: probable protein phosphatase 2C 15      177   3e-49   Eucalyptus grandis [rose gum]
ref|XP_006448418.1|  hypothetical protein CICLE_v10015330mg             177   3e-49   Citrus clementina [clementine]
ref|XP_010279327.1|  PREDICTED: probable protein phosphatase 2C 15      176   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_008339644.1|  PREDICTED: probable protein phosphatase 2C 15      176   8e-49   Malus domestica [apple tree]
ref|XP_009357108.1|  PREDICTED: probable protein phosphatase 2C 15      176   9e-49   Pyrus x bretschneideri [bai li]
ref|XP_002279675.1|  PREDICTED: probable protein phosphatase 2C 15      175   1e-48   
ref|XP_008797622.1|  PREDICTED: probable protein phosphatase 2C 3       175   2e-48   Phoenix dactylifera
ref|XP_009356234.1|  PREDICTED: probable protein phosphatase 2C 15      174   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_010922151.1|  PREDICTED: probable protein phosphatase 2C 3       174   2e-48   Elaeis guineensis
gb|KHG10433.1|  hypothetical protein F383_12376                         172   2e-47   Gossypium arboreum [tree cotton]
ref|XP_007142943.1|  hypothetical protein PHAVU_007G030400g             172   2e-47   Phaseolus vulgaris [French bean]
gb|KJB31457.1|  hypothetical protein B456_005G192600                    172   2e-47   Gossypium raimondii
gb|KJB31458.1|  hypothetical protein B456_005G192600                    172   2e-47   Gossypium raimondii
ref|XP_007222389.1|  hypothetical protein PRUPE_ppa006061mg             171   3e-47   Prunus persica
ref|XP_006469091.1|  PREDICTED: probable protein phosphatase 2C 3...    169   4e-47   Citrus sinensis [apfelsine]
ref|XP_006842367.1|  hypothetical protein AMTR_s00079p00186650          171   4e-47   
ref|XP_004299042.1|  PREDICTED: probable protein phosphatase 2C 15      171   5e-47   Fragaria vesca subsp. vesca
ref|XP_008243272.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    171   6e-47   
ref|XP_010906997.1|  PREDICTED: probable protein phosphatase 2C 3...    169   8e-47   
gb|KHN06682.1|  Hypothetical protein glysoja_021228                     170   1e-46   Glycine soja [wild soybean]
ref|XP_003536672.1|  PREDICTED: probable protein phosphatase 2C 1...    170   1e-46   Glycine max [soybeans]
ref|XP_010906996.1|  PREDICTED: probable protein phosphatase 2C 3...    169   4e-46   Elaeis guineensis
ref|XP_003555914.1|  PREDICTED: probable protein phosphatase 2C 1...    169   4e-46   Glycine max [soybeans]
emb|CAN76446.1|  hypothetical protein VITISV_010117                     174   4e-46   Vitis vinifera
gb|ABR17671.1|  unknown                                                 162   8e-46   Picea sitchensis
ref|XP_008792836.1|  PREDICTED: probable protein phosphatase 2C 1...    168   1e-45   Phoenix dactylifera
ref|XP_008792835.1|  PREDICTED: probable protein phosphatase 2C 1...    168   1e-45   
emb|CDP00657.1|  unnamed protein product                                165   4e-45   Coffea canephora [robusta coffee]
ref|XP_011076402.1|  PREDICTED: probable protein phosphatase 2C 1...    166   6e-45   Sesamum indicum [beniseed]
ref|NP_177008.1|  putative protein phosphatase 2C 15                    165   8e-45   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20040.1|  AT1G68410                                              165   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888662.1|  hypothetical protein ARALYDRAFT_894606             165   1e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_010099267.1|  putative protein phosphatase 2C 15                 166   1e-44   
ref|XP_006645937.1|  PREDICTED: probable protein phosphatase 2C 3...    163   2e-44   Oryza brachyantha
ref|XP_010511830.1|  PREDICTED: probable protein phosphatase 2C 15      163   7e-44   Camelina sativa [gold-of-pleasure]
emb|CDY44900.1|  BnaA02g13820D                                          162   7e-44   Brassica napus [oilseed rape]
ref|XP_010470790.1|  PREDICTED: probable protein phosphatase 2C 15      162   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010415460.1|  PREDICTED: probable protein phosphatase 2C 15      162   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006302270.1|  hypothetical protein CARUB_v10020313mg             162   1e-43   Capsella rubella
ref|XP_004135083.1|  PREDICTED: probable protein phosphatase 2C 1...    161   2e-43   Cucumis sativus [cucumbers]
ref|XP_008446622.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    161   3e-43   Cucumis melo [Oriental melon]
ref|NP_001043180.2|  Os01g0513100                                       152   5e-43   
ref|XP_011022405.1|  PREDICTED: probable protein phosphatase 2C 15      159   9e-43   Populus euphratica
ref|XP_002312412.1|  phosphatase 2C family protein                      159   1e-42   
ref|XP_009127629.1|  PREDICTED: probable protein phosphatase 2C 15      159   2e-42   Brassica rapa
gb|EYU30003.1|  hypothetical protein MIMGU_mgv1a006840mg                158   2e-42   Erythranthe guttata [common monkey flower]
gb|ACN31161.1|  unknown                                                 153   5e-42   Zea mays [maize]
emb|CDX81511.1|  BnaC02g18150D                                          157   7e-42   
ref|XP_009385409.1|  PREDICTED: probable protein phosphatase 2C 3       157   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004968827.1|  PREDICTED: probable protein phosphatase 2C 3...    157   2e-41   Setaria italica
ref|XP_002455646.1|  hypothetical protein SORBIDRAFT_03g016300          157   2e-41   Sorghum bicolor [broomcorn]
ref|XP_003567758.1|  PREDICTED: probable protein phosphatase 2C 3...    154   1e-40   Brachypodium distachyon [annual false brome]
ref|NP_001151513.1|  LOC100285147                                       155   1e-40   Zea mays [maize]
gb|EPS73050.1|  hypothetical protein M569_01706                         151   1e-39   Genlisea aurea
sp|Q0JMD4.2|P2C03_ORYSJ  RecName: Full=Probable protein phosphata...    152   1e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70750.1|  hypothetical protein OsI_02161                          152   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_010532299.1|  PREDICTED: probable protein phosphatase 2C 1...    150   5e-39   Tarenaya hassleriana [spider flower]
dbj|BAJ89158.1|  predicted protein                                      147   8e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010230932.1|  PREDICTED: probable protein phosphatase 2C 3...    149   9e-39   Brachypodium distachyon [annual false brome]
ref|XP_006448420.1|  hypothetical protein CICLE_v10018331mg             144   2e-37   
ref|XP_009626600.1|  PREDICTED: probable protein phosphatase 2C 5       140   9e-36   Nicotiana tomentosiformis
ref|XP_004230274.1|  PREDICTED: probable protein phosphatase 2C 5       140   2e-35   Solanum lycopersicum
ref|XP_009759573.1|  PREDICTED: probable protein phosphatase 2C 5       139   4e-35   Nicotiana sylvestris
ref|XP_006344713.1|  PREDICTED: probable protein phosphatase 2C 5...    136   5e-34   
ref|XP_009599009.1|  PREDICTED: probable protein phosphatase 2C 5       136   5e-34   Nicotiana tomentosiformis
ref|XP_009799456.1|  PREDICTED: probable protein phosphatase 2C 5       135   6e-34   Nicotiana sylvestris
ref|XP_006433490.1|  hypothetical protein CICLE_v10001248mg             134   3e-33   Citrus clementina [clementine]
ref|XP_006472159.1|  PREDICTED: probable protein phosphatase 2C 5...    134   3e-33   Citrus sinensis [apfelsine]
ref|XP_007031084.1|  Phosphatase 2C family protein                      134   3e-33   Theobroma cacao [chocolate]
gb|KHG19035.1|  hypothetical protein F383_08660                         132   8e-33   Gossypium arboreum [tree cotton]
gb|EYU37269.1|  hypothetical protein MIMGU_mgv1a006832mg                132   1e-32   Erythranthe guttata [common monkey flower]
gb|KJB45378.1|  hypothetical protein B456_007G303500                    132   2e-32   Gossypium raimondii
gb|KJB45380.1|  hypothetical protein B456_007G303500                    131   2e-32   Gossypium raimondii
ref|XP_010681640.1|  PREDICTED: probable protein phosphatase 2C 15      131   2e-32   
ref|XP_011092109.1|  PREDICTED: probable protein phosphatase 2C 5       131   2e-32   Sesamum indicum [beniseed]
ref|XP_011466159.1|  PREDICTED: probable protein phosphatase 2C 5       130   4e-32   Fragaria vesca subsp. vesca
gb|KDP23425.1|  hypothetical protein JCGZ_23258                         130   4e-32   Jatropha curcas
emb|CAN74505.1|  hypothetical protein VITISV_015889                     130   4e-32   Vitis vinifera
ref|XP_002282985.1|  PREDICTED: probable protein phosphatase 2C 5       130   6e-32   Vitis vinifera
ref|XP_010674109.1|  PREDICTED: probable protein phosphatase 2C 5       130   7e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB26348.1|  hypothetical protein B456_004G237900                    130   7e-32   Gossypium raimondii
gb|KJB26350.1|  hypothetical protein B456_004G237900                    130   7e-32   Gossypium raimondii
gb|KHG19034.1|  hypothetical protein F383_08660                         130   8e-32   Gossypium arboreum [tree cotton]
gb|KHG06373.1|  hypothetical protein F383_32810                         128   3e-31   Gossypium arboreum [tree cotton]
ref|XP_003626183.1|  hypothetical protein MTR_7g112430                  127   6e-31   Medicago truncatula
ref|XP_008245693.1|  PREDICTED: probable protein phosphatase 2C 5       127   8e-31   Prunus mume [ume]
ref|XP_002512477.1|  protein phosphatase, putative                      127   9e-31   Ricinus communis
ref|XP_007205238.1|  hypothetical protein PRUPE_ppa006100mg             126   9e-31   
ref|XP_007205239.1|  hypothetical protein PRUPE_ppa006100mg             126   1e-30   
emb|CDP17226.1|  unnamed protein product                                126   2e-30   Coffea canephora [robusta coffee]
ref|XP_008450571.1|  PREDICTED: probable protein phosphatase 2C 5       125   2e-30   Cucumis melo [Oriental melon]
ref|XP_004135583.1|  PREDICTED: probable protein phosphatase 2C 5...    125   3e-30   Cucumis sativus [cucumbers]
ref|XP_009338205.1|  PREDICTED: probable protein phosphatase 2C 5       125   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_004494559.1|  PREDICTED: probable protein phosphatase 2C 5...    125   3e-30   Cicer arietinum [garbanzo]
gb|EPS69183.1|  hypothetical protein M569_05581                         125   4e-30   Genlisea aurea
ref|XP_008370399.1|  PREDICTED: probable protein phosphatase 2C 5       125   4e-30   Malus domestica [apple tree]
ref|XP_008388502.1|  PREDICTED: probable protein phosphatase 2C 5       124   9e-30   
ref|XP_010245443.1|  PREDICTED: probable protein phosphatase 2C 5       124   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_006382433.1|  hypothetical protein POPTR_0005s02110g             123   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_007163342.1|  hypothetical protein PHAVU_001G226800g             123   2e-29   Phaseolus vulgaris [French bean]
gb|ABK92834.1|  unknown                                                 116   3e-29   Populus trichocarpa [western balsam poplar]
gb|ABR16488.1|  unknown                                                 121   1e-28   Picea sitchensis
ref|XP_010528916.1|  PREDICTED: probable protein phosphatase 2C 5       120   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_003554626.1|  PREDICTED: probable protein phosphatase 2C 5...    119   6e-28   
ref|XP_006604795.1|  PREDICTED: probable protein phosphatase 2C 5...    119   7e-28   Glycine max [soybeans]
ref|XP_011036917.1|  PREDICTED: probable protein phosphatase 2C 5...    118   2e-27   Populus euphratica
ref|XP_011036918.1|  PREDICTED: probable protein phosphatase 2C 5...    117   2e-27   Populus euphratica
emb|CDX95002.1|  BnaC05g06690D                                          116   3e-27   
ref|XP_004495681.1|  PREDICTED: probable protein phosphatase 2C 5...    116   3e-27   
ref|XP_007144975.1|  hypothetical protein PHAVU_007G199100g             117   3e-27   Phaseolus vulgaris [French bean]
ref|XP_010259436.1|  PREDICTED: probable protein phosphatase 2C 5...    115   4e-27   
ref|XP_004495680.1|  PREDICTED: probable protein phosphatase 2C 5...    116   5e-27   Cicer arietinum [garbanzo]
ref|XP_010259431.1|  PREDICTED: probable protein phosphatase 2C 5...    116   6e-27   
ref|XP_002318970.1|  phosphatase 2C family protein                      115   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006434797.1|  hypothetical protein CICLE_v10001232mg             115   1e-26   Citrus clementina [clementine]
ref|XP_006473344.1|  PREDICTED: probable protein phosphatase 2C 1...    115   1e-26   
gb|KDO84217.1|  hypothetical protein CISIN_1g045195mg                   115   1e-26   Citrus sinensis [apfelsine]
ref|XP_006473342.1|  PREDICTED: probable protein phosphatase 2C 1...    115   2e-26   Citrus sinensis [apfelsine]
gb|KEH43094.1|  protein phosphatase 2C family protein                   114   2e-26   Medicago truncatula
ref|XP_003591191.1|  hypothetical protein MTR_1g083750                  114   3e-26   Medicago truncatula
gb|KHN16084.1|  Hypothetical protein glysoja_012060                     114   4e-26   Glycine soja [wild soybean]
ref|XP_004157232.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    113   5e-26   
gb|KHN20267.1|  Hypothetical protein glysoja_023830                     113   5e-26   Glycine soja [wild soybean]
ref|XP_010938321.1|  PREDICTED: probable protein phosphatase 2C 33      113   6e-26   
ref|XP_010553723.1|  PREDICTED: probable protein phosphatase 2C 5       113   7e-26   Tarenaya hassleriana [spider flower]
gb|ACJ83645.1|  unknown                                                 108   8e-26   Medicago truncatula
ref|XP_011023738.1|  PREDICTED: probable protein phosphatase 2C 5...    112   1e-25   Populus euphratica
ref|XP_011023736.1|  PREDICTED: probable protein phosphatase 2C 5...    112   1e-25   Populus euphratica
ref|XP_011023737.1|  PREDICTED: probable protein phosphatase 2C 5...    112   1e-25   Populus euphratica
gb|AIZ68189.1|  putative protein phosphatase 2C 33                      112   1e-25   Ornithogalum longebracteatum [sea-onion]
gb|KCW60535.1|  hypothetical protein EUGRSUZ_H03276                     112   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010024104.1|  PREDICTED: probable protein phosphatase 2C 5       112   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010905680.1|  PREDICTED: probable protein phosphatase 2C 33      112   2e-25   Elaeis guineensis
gb|KDP38368.1|  hypothetical protein JCGZ_04293                         111   3e-25   Jatropha curcas
ref|XP_002510242.1|  protein phosphatase, putative                      111   3e-25   
gb|ABD28356.2|  Protein phosphatase 2C-like                             111   4e-25   Medicago truncatula
emb|CDP01349.1|  unnamed protein product                                110   5e-25   Coffea canephora [robusta coffee]
ref|XP_006417602.1|  hypothetical protein EUTSA_v10007698mg             110   5e-25   Eutrema salsugineum [saltwater cress]
ref|XP_007017285.1|  Phosphatase 2C family protein isoform 1            110   9e-25   
ref|XP_009764893.1|  PREDICTED: probable protein phosphatase 2C 1...    110   9e-25   Nicotiana sylvestris
ref|XP_009764892.1|  PREDICTED: probable protein phosphatase 2C 1...    110   9e-25   Nicotiana sylvestris
ref|XP_009610734.1|  PREDICTED: probable protein phosphatase 2C 1...    110   1e-24   Nicotiana tomentosiformis
ref|XP_007017286.1|  Phosphatase 2C family protein isoform 2            110   1e-24   
ref|XP_009610735.1|  PREDICTED: probable protein phosphatase 2C 1...    109   1e-24   Nicotiana tomentosiformis
ref|XP_011074446.1|  PREDICTED: probable protein phosphatase 2C 12      109   1e-24   Sesamum indicum [beniseed]
emb|CDY31109.1|  BnaA08g26590D                                          109   1e-24   Brassica napus [oilseed rape]
ref|XP_009110849.1|  PREDICTED: probable protein phosphatase 2C 5       109   1e-24   Brassica rapa
ref|XP_008795536.1|  PREDICTED: probable protein phosphatase 2C 33      109   1e-24   Phoenix dactylifera
ref|XP_011030187.1|  PREDICTED: probable protein phosphatase 2C 12      108   3e-24   Populus euphratica
ref|XP_001757865.1|  predicted protein                                  108   3e-24   
emb|CDY25665.1|  BnaC05g25440D                                          102   5e-24   Brassica napus [oilseed rape]
ref|XP_006393585.1|  hypothetical protein EUTSA_v10011502mg             107   5e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010092060.1|  putative protein phosphatase 2C 12                 108   5e-24   
ref|XP_006307584.1|  hypothetical protein CARUB_v10009209mg             107   6e-24   
ref|XP_009781091.1|  PREDICTED: probable protein phosphatase 2C 12      107   6e-24   Nicotiana sylvestris
ref|XP_010519103.1|  PREDICTED: probable protein phosphatase 2C 12      107   6e-24   Tarenaya hassleriana [spider flower]
ref|XP_006307585.1|  hypothetical protein CARUB_v10009209mg             107   6e-24   
ref|XP_007160841.1|  hypothetical protein PHAVU_001G021200g             107   7e-24   Phaseolus vulgaris [French bean]
ref|XP_004238165.1|  PREDICTED: probable protein phosphatase 2C 12      107   8e-24   Solanum lycopersicum
ref|XP_010500262.1|  PREDICTED: probable protein phosphatase 2C 12      107   1e-23   Camelina sativa [gold-of-pleasure]
emb|CDY17840.1|  BnaC08g04540D                                          107   1e-23   Brassica napus [oilseed rape]
ref|XP_002894042.1|  hypothetical protein ARALYDRAFT_473885             107   1e-23   
gb|AAK92805.1|  unknown protein                                         107   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564504.1|  putative protein phosphatase 2C 12                    107   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302440.2|  phosphatase 2C family protein                      107   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010539072.1|  PREDICTED: probable protein phosphatase 2C 1...    107   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_009620218.1|  PREDICTED: probable protein phosphatase 2C 12      106   1e-23   Nicotiana tomentosiformis
ref|XP_011017216.1|  PREDICTED: probable protein phosphatase 2C 12      106   1e-23   Populus euphratica
ref|XP_011016491.1|  PREDICTED: probable protein phosphatase 2C 12      106   1e-23   Populus euphratica
gb|KJB58458.1|  hypothetical protein B456_009G211100                    106   1e-23   Gossypium raimondii
ref|XP_010539071.1|  PREDICTED: probable protein phosphatase 2C 1...    107   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_006829727.1|  hypothetical protein AMTR_s00126p00104180          106   1e-23   
ref|XP_006354899.1|  PREDICTED: probable protein phosphatase 2C 1...    106   2e-23   Solanum tuberosum [potatoes]
gb|KJB58457.1|  hypothetical protein B456_009G211100                    106   2e-23   Gossypium raimondii
gb|KHG12192.1|  hypothetical protein F383_19798                         106   2e-23   Gossypium arboreum [tree cotton]
gb|KHG12193.1|  hypothetical protein F383_19798                         106   2e-23   Gossypium arboreum [tree cotton]
ref|XP_002284640.1|  PREDICTED: probable protein phosphatase 2C 12      106   2e-23   Vitis vinifera
gb|KJB58459.1|  hypothetical protein B456_009G211100                    106   2e-23   Gossypium raimondii
ref|XP_006595966.1|  PREDICTED: probable protein phosphatase 2C 1...    105   2e-23   Glycine max [soybeans]
ref|XP_008797258.1|  PREDICTED: probable protein phosphatase 2C 1...    105   2e-23   
gb|AFK41874.1|  unknown                                                 106   3e-23   Medicago truncatula
ref|XP_010061763.1|  PREDICTED: probable protein phosphatase 2C 12      105   3e-23   Eucalyptus grandis [rose gum]
gb|EYU25409.1|  hypothetical protein MIMGU_mgv1a006684mg                105   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_003521674.1|  PREDICTED: probable protein phosphatase 2C 5...    105   3e-23   Glycine max [soybeans]
ref|XP_003545307.1|  PREDICTED: probable protein phosphatase 2C 1...    105   3e-23   Glycine max [soybeans]
ref|XP_008220215.1|  PREDICTED: probable protein phosphatase 2C 12      105   4e-23   Prunus mume [ume]
ref|XP_009411651.1|  PREDICTED: probable protein phosphatase 2C 33      105   4e-23   
ref|XP_004499068.1|  PREDICTED: probable protein phosphatase 2C 1...    105   4e-23   
ref|XP_006374959.1|  phosphatase 2C family protein                      105   4e-23   Populus trichocarpa [western balsam poplar]
gb|KHN03953.1|  Hypothetical protein glysoja_022639                     105   4e-23   Glycine soja [wild soybean]
emb|CAN78409.1|  hypothetical protein VITISV_023178                     105   6e-23   Vitis vinifera
ref|XP_009107427.1|  PREDICTED: probable protein phosphatase 2C 12      104   7e-23   Brassica rapa
ref|NP_172388.1|  putative protein phosphatase 2C                       104   7e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17018.1|  BnaA08g03820D                                          104   7e-23   Brassica napus [oilseed rape]
ref|XP_010479140.1|  PREDICTED: probable protein phosphatase 2C 12      104   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010461537.1|  PREDICTED: probable protein phosphatase 2C 12      104   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_007222388.1|  hypothetical protein PRUPE_ppa006058mg             104   1e-22   Prunus persica
gb|KJB63822.1|  hypothetical protein B456_010G018200                    103   2e-22   Gossypium raimondii
emb|CDY32154.1|  BnaCnng06630D                                          104   2e-22   Brassica napus [oilseed rape]
ref|XP_009386662.1|  PREDICTED: probable protein phosphatase 2C 33      103   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009145043.1|  PREDICTED: probable protein phosphatase 2C 1...    103   2e-22   
ref|XP_008452538.1|  PREDICTED: probable protein phosphatase 2C 1...    103   3e-22   Cucumis melo [Oriental melon]
ref|XP_003550341.1|  PREDICTED: probable protein phosphatase 2C 1...    103   3e-22   Glycine max [soybeans]
ref|XP_008452534.1|  PREDICTED: probable protein phosphatase 2C 1...    103   3e-22   Cucumis melo [Oriental melon]
emb|CDY17078.1|  BnaC06g00110D                                          102   3e-22   Brassica napus [oilseed rape]
ref|XP_009145042.1|  PREDICTED: probable protein phosphatase 2C 1...    102   3e-22   Brassica rapa
emb|CDY43845.1|  BnaA05g18570D                                          102   3e-22   Brassica napus [oilseed rape]
ref|XP_009118925.1|  PREDICTED: probable protein phosphatase 2C 12      102   3e-22   Brassica rapa
ref|XP_011083858.1|  PREDICTED: probable protein phosphatase 2C 1...    102   4e-22   
ref|XP_011083859.1|  PREDICTED: probable protein phosphatase 2C 1...    102   4e-22   
ref|XP_010475741.1|  PREDICTED: probable protein phosphatase 2C 5       102   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010458188.1|  PREDICTED: probable protein phosphatase 2C 5       102   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010489746.1|  PREDICTED: probable protein phosphatase 2C 5       102   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002892487.1|  hypothetical protein ARALYDRAFT_471002             102   4e-22   
ref|XP_011083856.1|  PREDICTED: probable protein phosphatase 2C 1...    102   4e-22   Sesamum indicum [beniseed]
ref|XP_011083857.1|  PREDICTED: probable protein phosphatase 2C 1...    102   4e-22   
emb|CDY06741.1|  BnaA10g05200D                                          102   5e-22   
ref|XP_004499069.1|  PREDICTED: probable protein phosphatase 2C 1...    102   5e-22   Cicer arietinum [garbanzo]
gb|KJB29498.1|  hypothetical protein B456_005G103200                    102   5e-22   Gossypium raimondii
gb|KJB29497.1|  hypothetical protein B456_005G103200                    102   5e-22   Gossypium raimondii
ref|XP_004242956.1|  PREDICTED: probable protein phosphatase 2C 12      102   6e-22   Solanum lycopersicum
gb|KHN22311.1|  Hypothetical protein glysoja_022067                     101   8e-22   Glycine soja [wild soybean]
ref|XP_003528265.1|  PREDICTED: probable protein phosphatase 2C 1...    101   9e-22   Glycine max [soybeans]
ref|XP_007136673.1|  hypothetical protein PHAVU_009G064200g             101   9e-22   Phaseolus vulgaris [French bean]
ref|XP_006581239.1|  PREDICTED: probable protein phosphatase 2C 1...    101   1e-21   Glycine max [soybeans]
ref|XP_006581240.1|  PREDICTED: probable protein phosphatase 2C 1...    100   1e-21   Glycine max [soybeans]
ref|XP_008807757.1|  PREDICTED: probable protein phosphatase 2C 33      101   1e-21   Phoenix dactylifera
gb|EYU36299.1|  hypothetical protein MIMGU_mgv1a006731mg                101   1e-21   Erythranthe guttata [common monkey flower]
gb|EPS63832.1|  hypothetical protein M569_10947                         102   1e-21   Genlisea aurea
ref|XP_008361008.1|  PREDICTED: probable protein phosphatase 2C 12      101   1e-21   
ref|XP_008393818.1|  PREDICTED: probable protein phosphatase 2C 12      101   1e-21   
ref|XP_004141247.1|  PREDICTED: probable protein phosphatase 2C 1...    100   1e-21   Cucumis sativus [cucumbers]
ref|XP_004487674.1|  PREDICTED: probable protein phosphatase 2C 1...    100   1e-21   Cicer arietinum [garbanzo]
ref|XP_010275585.1|  PREDICTED: probable protein phosphatase 2C 12      100   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009359088.1|  PREDICTED: probable protein phosphatase 2C 12      100   3e-21   Pyrus x bretschneideri [bai li]
gb|AES59470.2|  catalytic/protein phosphatase type 2C                   100   3e-21   Medicago truncatula
ref|XP_006307591.1|  hypothetical protein CARUB_v10009213mg             100   3e-21   Capsella rubella
ref|XP_010667515.1|  PREDICTED: probable protein phosphatase 2C 12    99.8    4e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009367363.1|  PREDICTED: probable protein phosphatase 2C 12    99.8    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_008797259.1|  PREDICTED: probable protein phosphatase 2C 1...  99.8    5e-21   Phoenix dactylifera
ref|XP_010939443.1|  PREDICTED: probable protein phosphatase 2C 1...  99.4    5e-21   
ref|XP_003589219.1|  Protein phosphatase 2C-like protein                100   5e-21   
ref|XP_010939442.1|  PREDICTED: probable protein phosphatase 2C 1...  99.4    5e-21   Elaeis guineensis
ref|XP_004292819.1|  PREDICTED: probable protein phosphatase 2C 12    99.0    8e-21   Fragaria vesca subsp. vesca
gb|KEH35748.1|  catalytic/protein phosphatase type 2C                 98.6    1e-20   Medicago truncatula
ref|XP_010269263.1|  PREDICTED: probable protein phosphatase 2C 12    97.8    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_003603027.1|  hypothetical protein MTR_3g101540                96.3    7e-20   Medicago truncatula
gb|AFK36110.1|  unknown                                               95.9    1e-19   Medicago truncatula
ref|XP_006448422.1|  hypothetical protein CICLE_v10018105mg           94.4    2e-19   
ref|XP_002465394.1|  hypothetical protein SORBIDRAFT_01g037810        95.5    2e-19   Sorghum bicolor [broomcorn]
gb|KHN04510.1|  Hypothetical protein glysoja_019597                   95.9    2e-19   Glycine soja [wild soybean]
ref|XP_010916634.1|  PREDICTED: probable protein phosphatase 2C 12    94.7    2e-19   Elaeis guineensis
ref|XP_010943030.1|  PREDICTED: probable protein phosphatase 2C 1...  93.6    4e-19   Elaeis guineensis
gb|AFW88634.1|  putative protein phosphatase 2C family protein        94.0    5e-19   
ref|XP_010943029.1|  PREDICTED: probable protein phosphatase 2C 1...  93.6    8e-19   Elaeis guineensis
ref|XP_008805255.1|  PREDICTED: probable protein phosphatase 2C 12    92.8    1e-18   Phoenix dactylifera
gb|ACF85382.1|  unknown                                               91.7    1e-18   Zea mays [maize]
ref|XP_008805807.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  92.8    2e-18   
ref|NP_001149558.1|  LOC100283184                                     92.4    2e-18   Zea mays [maize]
ref|NP_001141091.1|  putative protein phosphatase 2C family protein   91.7    3e-18   Zea mays [maize]
ref|XP_004958778.1|  PREDICTED: probable protein phosphatase 2C 3...  91.7    4e-18   Setaria italica
gb|EMT17740.1|  Putative protein phosphatase 2C 33                    91.3    6e-18   
ref|XP_006578016.1|  PREDICTED: probable protein phosphatase 2C 1...  89.7    8e-18   
ref|XP_006578015.1|  PREDICTED: probable protein phosphatase 2C 1...  89.7    8e-18   
ref|XP_004984655.1|  PREDICTED: probable protein phosphatase 2C 3...  90.5    9e-18   
ref|XP_006578014.1|  PREDICTED: probable protein phosphatase 2C 1...  89.7    1e-17   
ref|XP_003523598.2|  PREDICTED: probable protein phosphatase 2C 1...  90.1    1e-17   
ref|XP_002461259.1|  hypothetical protein SORBIDRAFT_02g043760        89.4    2e-17   
ref|XP_009401437.1|  PREDICTED: probable protein phosphatase 2C 1...  89.4    2e-17   
ref|XP_009380915.1|  PREDICTED: probable protein phosphatase 2C 12    89.4    2e-17   
dbj|BAJ94997.1|  predicted protein                                    89.0    3e-17   
ref|XP_006660705.1|  PREDICTED: probable protein phosphatase 2C 6...  88.6    3e-17   
ref|XP_006653467.1|  PREDICTED: probable protein phosphatase 2C 4...  88.6    4e-17   
ref|XP_009409307.1|  PREDICTED: probable protein phosphatase 2C 12    88.6    5e-17   
ref|XP_010239966.1|  PREDICTED: probable protein phosphatase 2C 4...  88.6    5e-17   
ref|XP_006648761.1|  PREDICTED: probable protein phosphatase 2C 1...  88.2    6e-17   
gb|AFW62683.1|  putative protein phosphatase 2C family protein        84.0    7e-17   
gb|EEE61087.1|  hypothetical protein OsJ_14978                        87.4    8e-17   
gb|EPS58059.1|  hypothetical protein M569_16756                       85.1    9e-17   
ref|NP_001047178.1|  Os02g0567200                                     87.8    1e-16   
gb|ACL54755.1|  unknown                                               83.2    1e-16   
gb|ACN27318.1|  unknown                                               85.5    1e-16   
gb|EEC77369.1|  hypothetical protein OsI_16091                        87.4    1e-16   
ref|XP_003578238.1|  PREDICTED: probable protein phosphatase 2C 69    87.0    1e-16   
gb|EEC73439.1|  hypothetical protein OsI_07726                        87.0    2e-16   
ref|NP_001140347.1|  putative protein phosphatase 2C family protein   87.0    2e-16   
ref|XP_002462493.1|  hypothetical protein SORBIDRAFT_02g026710        86.7    2e-16   
ref|NP_001063382.1|  Os09g0459600                                     86.7    2e-16   
ref|XP_006649947.1|  PREDICTED: probable protein phosphatase 2C 3...  85.5    2e-16   
gb|EAZ09387.1|  hypothetical protein OsI_31661                        86.3    3e-16   
ref|XP_009771631.1|  PREDICTED: probable protein phosphatase 2C 12    81.6    3e-16   
ref|XP_004952709.1|  PREDICTED: probable protein phosphatase 2C 1...  86.3    3e-16   
gb|ACF84293.1|  unknown                                               83.2    3e-16   
ref|XP_004952708.1|  PREDICTED: probable protein phosphatase 2C 1...  86.3    4e-16   
ref|XP_006658990.1|  PREDICTED: probable protein phosphatase 2C 3...  85.5    5e-16   
ref|NP_001152457.1|  Ca2+/calmodulin-dependent protein kinase pho...  85.9    5e-16   
ref|XP_008658740.1|  PREDICTED: ca2+/calmodulin-dependent protein...  85.5    5e-16   
ref|NP_001049866.1|  Os03g0301700                                     85.5    5e-16   
ref|XP_008658742.1|  PREDICTED: ca2+/calmodulin-dependent protein...  85.5    6e-16   
ref|XP_008658741.1|  PREDICTED: ca2+/calmodulin-dependent protein...  85.5    6e-16   
ref|XP_008658738.1|  PREDICTED: ca2+/calmodulin-dependent protein...  85.9    6e-16   
ref|XP_008658739.1|  PREDICTED: ca2+/calmodulin-dependent protein...  85.9    7e-16   
ref|XP_004984131.1|  PREDICTED: probable protein phosphatase 2C 1...  84.7    1e-15   
ref|XP_006651470.1|  PREDICTED: probable protein phosphatase 2C 1...  84.7    1e-15   
ref|XP_004984130.1|  PREDICTED: probable protein phosphatase 2C 1...  84.7    1e-15   
dbj|BAK04527.1|  predicted protein                                    84.7    1e-15   
gb|EMS59956.1|  putative protein phosphatase 2C 40                    84.3    1e-15   
ref|XP_010228539.1|  PREDICTED: probable protein phosphatase 2C 1...  84.3    1e-15   
ref|XP_010228538.1|  PREDICTED: probable protein phosphatase 2C 1...  84.3    1e-15   
ref|NP_001060712.1|  Os07g0690400                                     84.3    2e-15   
emb|CAE01570.2|  OSJNBa0064H22.20                                     84.3    2e-15   
emb|CAH67094.1|  H0818E04.11                                          84.3    2e-15   
ref|XP_008677565.1|  PREDICTED: uncharacterized protein LOC100382...  84.0    2e-15   
sp|Q7XTC7.3|P2C40_ORYSJ  RecName: Full=Probable protein phosphata...  84.3    2e-15   
ref|XP_003575194.1|  PREDICTED: probable protein phosphatase 2C 15    84.0    2e-15   
ref|XP_008677561.1|  PREDICTED: uncharacterized protein LOC100382...  84.0    2e-15   
ref|XP_003558102.1|  PREDICTED: probable protein phosphatase 2C 33    83.6    3e-15   
ref|XP_002454036.1|  hypothetical protein SORBIDRAFT_04g023510        83.6    3e-15   
ref|XP_008646497.1|  PREDICTED: putative protein phosphatase 2C f...  83.6    3e-15   
ref|XP_002467747.1|  hypothetical protein SORBIDRAFT_01g033320        83.2    3e-15   
ref|NP_001170543.1|  putative protein phosphatase 2C family protein   83.2    3e-15   
gb|AAK52556.1|AC079853_9  Unknown protein                             83.2    3e-15   
ref|XP_008646491.1|  PREDICTED: putative protein phosphatase 2C f...  83.2    4e-15   
ref|NP_001146789.1|  putative protein phosphatase 2C family protein   83.2    4e-15   
gb|ACN33405.1|  unknown                                               82.8    6e-15   
ref|XP_004957026.1|  PREDICTED: probable protein phosphatase 2C 6...  82.4    7e-15   
ref|NP_001151313.1|  catalytic/ protein phosphatase type 2C           82.4    8e-15   
emb|CDP00656.1|  unnamed protein product                              75.9    1e-14   
ref|XP_003562410.1|  PREDICTED: probable protein phosphatase 2C 33    81.6    1e-14   
ref|XP_009413632.1|  PREDICTED: probable protein phosphatase 2C 12    81.6    1e-14   
ref|XP_004975776.1|  PREDICTED: probable protein phosphatase 2C 4...  81.6    1e-14   
gb|EMT09218.1|  Putative protein phosphatase 2C 69                    80.9    1e-14   
ref|XP_008651098.1|  PREDICTED: uncharacterized protein LOC100273...  80.5    2e-14   
ref|NP_001052931.2|  Os04g0449400                                     76.3    2e-14   
gb|EMS65150.1|  putative protein phosphatase 2C 69                    80.9    2e-14   
ref|NP_001149520.1|  catalytic/ protein phosphatase type 2C           80.5    3e-14   
ref|NP_001141493.1|  uncharacterized protein LOC100273605             80.5    3e-14   
ref|XP_001759688.1|  predicted protein                                80.5    3e-14   
gb|ACL54158.1|  unknown                                               80.1    5e-14   
ref|XP_001781498.1|  predicted protein                                79.7    5e-14   
ref|XP_003581291.1|  PREDICTED: probable protein phosphatase 2C 4...  79.3    9e-14   
dbj|BAK06878.1|  predicted protein                                    79.0    9e-14   
dbj|BAK00932.1|  predicted protein                                    78.2    2e-13   
ref|XP_004501576.1|  PREDICTED: probable protein phosphatase 2C 1...  72.0    3e-13   
gb|EPS59533.1|  hypothetical protein M569_15272                       77.4    3e-13   
ref|XP_010036140.1|  PREDICTED: probable protein phosphatase 2C 12    67.4    1e-10   
ref|XP_002986557.1|  hypothetical protein SELMODRAFT_235036           69.7    1e-10   
gb|KCW66457.1|  hypothetical protein EUGRSUZ_F00253                   65.9    2e-10   
gb|KEH22033.1|  protein phosphatase 2C family protein                 68.9    2e-10   
ref|XP_010059966.1|  PREDICTED: probable protein phosphatase 2C 12    66.2    2e-10   
ref|XP_002979083.1|  hypothetical protein SELMODRAFT_109752           64.7    6e-09   
gb|AAY34912.1|  protein phosphatase 2C-related                        59.3    1e-08   
ref|XP_006855339.1|  hypothetical protein AMTR_s00057p00093140        63.2    2e-08   
gb|EMS67839.1|  putative protein phosphatase 2C 33                    59.3    4e-07   
ref|XP_001751989.1|  predicted protein                                56.6    3e-06   
ref|XP_011076426.1|  PREDICTED: probable protein phosphatase 2C 1...  53.9    2e-05   
ref|XP_011076418.1|  PREDICTED: probable protein phosphatase 2C 1...  53.9    2e-05   
gb|AFK33489.1|  unknown                                               48.5    2e-04   
emb|CDM82896.1|  unnamed protein product                              50.1    5e-04   
gb|ACR37418.1|  unknown                                               46.6    5e-04   
tpg|DAA54619.2|  TPA: putative protein phosphatase 2C family protein  48.5    6e-04   



>ref|XP_009767028.1| PREDICTED: probable protein phosphatase 2C 3 isoform X3 [Nicotiana 
sylvestris]
Length=369

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+KS     K SKKLSA+GIVEELFEEGSAMLAERLG+EDSNGPSMSG FICAVCQ
Sbjct  259  SLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAMLAERLGNEDSNGPSMSGFFICAVCQ  318

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  319  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  369



>ref|XP_009588474.1| PREDICTED: probable protein phosphatase 2C 3 isoform X3 [Nicotiana 
tomentosiformis]
Length=369

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+KS     K SKKLSA+GIVEELFEEGSAMLAERLGSEDSNGPSMS LFICA+CQ
Sbjct  259  SLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAMLAERLGSEDSNGPSMSSLFICAICQ  318

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  319  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  369



>ref|XP_009588473.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+KS     K SKKLSA+GIVEELFEEGSAMLAERLGSEDSNGPSMS LFICA+CQ
Sbjct  267  SLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAMLAERLGSEDSNGPSMSSLFICAICQ  326

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  327  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  377



>ref|XP_009767026.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+KS     K SKKLSA+GIVEELFEEGSAMLAERLG+EDSNGPSMSG FICAVCQ
Sbjct  267  SLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAMLAERLGNEDSNGPSMSGFFICAVCQ  326

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  327  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  377



>ref|XP_009767020.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767021.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767022.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767023.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767024.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767025.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
Length=429

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+KS     K SKKLSA+GIVEELFEEGSAMLAERLG+EDSNGPSMSG FICAVCQ
Sbjct  319  SLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAMLAERLGNEDSNGPSMSGFFICAVCQ  378

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  379  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  429



>ref|XP_009588467.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588468.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588469.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588470.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588471.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588472.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
Length=429

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+KS     K SKKLSA+GIVEELFEEGSAMLAERLGSEDSNGPSMS LFICA+CQ
Sbjct  319  SLFFRRKSQKSTAKLSKKLSAIGIVEELFEEGSAMLAERLGSEDSNGPSMSSLFICAICQ  378

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  379  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  429



>ref|XP_010320753.1| PREDICTED: probable protein phosphatase 2C 15 [Solanum lycopersicum]
 ref|XP_010320754.1| PREDICTED: probable protein phosphatase 2C 15 [Solanum lycopersicum]
Length=429

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 100/110 (91%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+   KSA K SKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ
Sbjct  319  SLFFRRNSQKSAGKLSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  378

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DC NKKDAMEGKRPSGVKV
Sbjct  379  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCCNKKDAMEGKRPSGVKV  428



>gb|KDO38779.1| hypothetical protein CISIN_1g033174mg [Citrus sinensis]
Length=125

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLG+E++   S SGLF CAVCQ+D
Sbjct  17   LFRKKSLDSANKLSKKLSAVGIVEELFEEGSAMLAERLGNEENVVQSTSGLFTCAVCQID  76

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  77   LAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  125



>ref|XP_006344157.1| PREDICTED: probable protein phosphatase 2C 15-like [Solanum tuberosum]
Length=429

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 99/110 (90%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  FR+KS   A K SKKLSAVGIVEELFEEGSA+LAERLGSEDSNGPSMS LFICAVCQ
Sbjct  319  SLFFRRKSHKSAAKLSKKLSAVGIVEELFEEGSAILAERLGSEDSNGPSMSDLFICAVCQ  378

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            VDL ASEGISVHAG+IFSTSSKPWQGPFLC DC NKKDAMEGK+PSGVKV
Sbjct  379  VDLAASEGISVHAGSIFSTSSKPWQGPFLCADCCNKKDAMEGKQPSGVKV  428



>ref|XP_008351008.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=248

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG  460
            P+++    +  FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S SG
Sbjct  130  PKKINKFRTLFFRKKSXASANKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTPQSTSG  189

Query  459  LFICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            LF+CAVCQVDL  SEGISVHAG+IFSTSSKPWQGPFLC+DCRNKKDAMEGKRPSGV+VA
Sbjct  190  LFMCAVCQVDLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  248



>ref|XP_007044253.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY00085.1| Phosphatase 2C family protein [Theobroma cacao]
Length=428

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRK+S   A K SKKLSAVGIVEELFEEGSAMLAERLG++DS G + SGLF CAVCQVD
Sbjct  320  LFRKRSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGNDDSAGQTTSGLFTCAVCQVD  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTS+KPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  380  LAPSEGISVHAGSIFSTSTKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>ref|XP_010264732.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010264741.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S   A K +KKLSAVGIVEELFEEGSAMLAERLG+E S G S SGLF CAVCQ
Sbjct  327  SLIFRKRSQDSANKLAKKLSAVGIVEELFEEGSAMLAERLGNESSMGQSTSGLFTCAVCQ  386

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            VDL  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGVKV
Sbjct  387  VDLAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKV  436



>ref|XP_008389261.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
 ref|XP_008360042.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=427

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG  460
            P+++    +  FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S SG
Sbjct  309  PKKINKFRTLFFRKKSXASANKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTXQSTSG  368

Query  459  LFICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            LF+CAVCQVDL  SEGISVHAG+IFSTSSKPWQGPFLC+DCRNKKDAMEGKRPSGV+VA
Sbjct  369  LFMCAVCQVDLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  427



>gb|KDP29451.1| hypothetical protein JCGZ_18372 [Jatropha curcas]
Length=432

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 3/112 (3%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            ++ +FRKKS     K SKKLSAVGIVEELFEEGSAMLAERLG++D+   S SGLF CAVC
Sbjct  321  TALLFRKKSHDSTNKLSKKLSAVGIVEELFEEGSAMLAERLGNDDTATQSTSGLFTCAVC  380

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            QVDL  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  381  QVDLAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  432



>ref|XP_002527010.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF35382.1| protein phosphatase, putative [Ricinus communis]
Length=428

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLG+++S   S SGLF CAVCQVD
Sbjct  320  LFRKKSRDAANKLSKKLSAVGIVEELFEEGSAMLAERLGNDESTTQSTSGLFTCAVCQVD  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L +SEGISVHAG+IFSTSSKPWQGPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  380  LASSEGISVHAGSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  428



>ref|XP_004497062.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Cicer arietinum]
 ref|XP_004497063.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Cicer arietinum]
 ref|XP_004497064.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Cicer arietinum]
Length=429

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
             FRKKS   A K SKKLSA+ IVEELFEEGSAMLAERLG++D+ G S SGLF+CAVCQVD
Sbjct  321  FFRKKSRDSAGKLSKKLSAINIVEELFEEGSAMLAERLGNDDNTGQSTSGLFVCAVCQVD  380

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTSSKPWQGPFLC+DCR+KKDAMEGKRPSGVKV+
Sbjct  381  LAPSEGISVHAGSIFSTSSKPWQGPFLCSDCRDKKDAMEGKRPSGVKVS  429



>ref|XP_006378470.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
 gb|ERP56267.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
Length=428

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKKS   A+K SKKLSA+GIVEELFEEGSAMLAERLG+ DS   S SGLF C VCQ+D
Sbjct  320  LFRKKSHFSASKLSKKLSAIGIVEELFEEGSAMLAERLGNGDSTSQSTSGLFTCVVCQID  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGV+VA
Sbjct  380  LAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVRVA  428



>ref|XP_010044241.1| PREDICTED: probable protein phosphatase 2C 15 [Eucalyptus grandis]
 gb|KCW86301.1| hypothetical protein EUGRSUZ_B02992 [Eucalyptus grandis]
Length=428

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 97/108 (90%), Gaps = 3/108 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FR KS   A K SKKLSA+GIVEELFEEGSAMLAERLG+++S G S SGLF+CAVCQVD
Sbjct  320  LFRSKSKGSANKLSKKLSAIGIVEELFEEGSAMLAERLGTDESAGQSTSGLFVCAVCQVD  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            L +SEGISVHAG+IFST++KPWQGPFLC DCRNKKDAMEGKRPSGVKV
Sbjct  380  LASSEGISVHAGSIFSTNTKPWQGPFLCGDCRNKKDAMEGKRPSGVKV  427



>ref|XP_006448418.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006448419.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006468741.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Citrus sinensis]
 ref|XP_006468742.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Citrus sinensis]
 gb|ESR61658.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 gb|ESR61659.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
Length=428

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 95/109 (87%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLG+E+    S SGLF CAVCQ+D
Sbjct  320  LFRKKSLDSANKLSKKLSAVGIVEELFEEGSAMLAERLGNEEPVVQSTSGLFTCAVCQID  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  380  LAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>ref|XP_010279327.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279328.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279329.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279330.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            IFRK+S   A K +K LS VGIVEELFEEGSAMLAERLGSE S G S SGLF CAVCQVD
Sbjct  329  IFRKRSCDSANKLAKSLSTVGIVEELFEEGSAMLAERLGSESSMGQSTSGLFTCAVCQVD  388

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            L  SEGISVHAG+IFSTS+KPWQGPFLC DCRNKKDAMEGKRPSGVKV
Sbjct  389  LAPSEGISVHAGSIFSTSTKPWQGPFLCADCRNKKDAMEGKRPSGVKV  436



>ref|XP_008339644.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=428

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 4/120 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSM-S  463
            P+++    + +FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S  S
Sbjct  309  PKKINKLRTLLFRKKSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTPQSTTS  368

Query  462  GLFICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            GLF+CAVCQVDL  SEGISVHAG+IFSTSSKPWQGPFLC+DCRNKKDAMEGKRPSGV+VA
Sbjct  369  GLFMCAVCQVDLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  428



>ref|XP_009357108.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 4/120 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSM-S  463
            P+++    + +FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S  S
Sbjct  309  PKKINKLRTLLFRKKSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTPQSTTS  368

Query  462  GLFICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            GLF+CAVCQVDL  SEGISVHAG+IFSTSSKPWQGPFLC+DCRNKKDAMEGKRPSGV+VA
Sbjct  369  GLFMCAVCQVDLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  428



>ref|XP_002279675.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644317.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644359.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644395.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 ref|XP_010644423.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera]
 emb|CBI26983.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 94/108 (87%), Gaps = 3/108 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRK+S     K SKKLSA+GIVEELFEEGSAMLAERLGSE+  G   SGLF+CAVCQVD
Sbjct  319  LFRKRSRDSVNKLSKKLSAIGIVEELFEEGSAMLAERLGSEECPGQPTSGLFMCAVCQVD  378

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            L  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSG+KV
Sbjct  379  LAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGIKV  426



>ref|XP_008797622.1| PREDICTED: probable protein phosphatase 2C 3 [Phoenix dactylifera]
Length=434

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S   A+K +KKLSAVGIVEELFEEGSAML ERLG++ S G + SGLF CA+CQ
Sbjct  324  SLIFRKRSKDSASKLAKKLSAVGIVEELFEEGSAMLEERLGNDSSAGQTTSGLFTCAICQ  383

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            VDL  SEGISVHAG++FSTSSKPW+GPFLC DCRNKKDAMEGKRPSGVKV
Sbjct  384  VDLAPSEGISVHAGSLFSTSSKPWEGPFLCADCRNKKDAMEGKRPSGVKV  433



>ref|XP_009356234.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 4/120 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSM-S  463
            P+++    +  FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S  S
Sbjct  309  PKKINKFRTLFFRKKSRASANKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTPQSTTS  368

Query  462  GLFICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            GLF+CAVCQVDL  SEGISVHAG+IFSTSSKPWQGPFLC+DCRNKKDAMEGKRPSGV+VA
Sbjct  369  GLFMCAVCQVDLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  428



>ref|XP_010922151.1| PREDICTED: probable protein phosphatase 2C 3 [Elaeis guineensis]
 ref|XP_010922158.1| PREDICTED: probable protein phosphatase 2C 3 [Elaeis guineensis]
Length=432

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S   A+K +KKLSAVGIVEELFEEGSAMLAERLG++ S G + SGLF CA+CQ
Sbjct  322  SLIFRKRSKDSASKLAKKLSAVGIVEELFEEGSAMLAERLGNDSSGGQTTSGLFTCAICQ  381

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
             DL  SEGISVHAG++FSTSSKPW+GPFLC DCRNKKDAMEGKRPSGVKV
Sbjct  382  ADLAPSEGISVHAGSLFSTSSKPWEGPFLCADCRNKKDAMEGKRPSGVKV  431



>gb|KHG10433.1| hypothetical protein F383_12376 [Gossypium arboreum]
Length=426

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 94/111 (85%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S +FRK    SA K SKKLSAVGIVEELFEEGSAMLAERLG+++  G + SG+F C VCQ
Sbjct  316  SFLFRKSSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGNDEGAGQTTSGIFTCGVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL  SEGISVHAG+IFSTSSKPWQGPFLC  CRNKKDAMEGKRPSGVKVA
Sbjct  376  VDLAPSEGISVHAGSIFSTSSKPWQGPFLCAACRNKKDAMEGKRPSGVKVA  426



>ref|XP_007142943.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
 gb|ESW14937.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
Length=431

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 98/110 (89%), Gaps = 5/110 (5%)
 Frame = -1

Query  597  FRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDS--NGPSMSGLFICAVCQV  433
            FRK+S   A+K SKKLSA+ IVEELFEEGSAMLAERLG++D+   G S SG+F+CAVCQV
Sbjct  322  FRKRSRDSASKLSKKLSAINIVEELFEEGSAMLAERLGNDDNLNTGQSTSGIFVCAVCQV  381

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            DL  SEGISVHAG+IFSTSSKPWQGPFLC+DCR+KKDAMEGKRPSGVKV+
Sbjct  382  DLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCRDKKDAMEGKRPSGVKVS  431



>gb|KJB31457.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31459.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31460.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=428

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S +FRK    SA K SKKLSAVGIVEELFEEGSAMLAERLG ++  G + SGLF C VCQ
Sbjct  318  SFLFRKSSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGIDEGAGQTTSGLFTCGVCQ  377

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL  SEGISVHAG+IFSTSSKPWQGPFLC  CRNKKDAMEGKRPSGVKVA
Sbjct  378  VDLAPSEGISVHAGSIFSTSSKPWQGPFLCAACRNKKDAMEGKRPSGVKVA  428



>gb|KJB31458.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=427

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = -1

Query  606  STIFRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S +FRK    SA K SKKLSAVGIVEELFEEGSAMLAERLG ++  G + SGLF C VCQ
Sbjct  317  SFLFRKSSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGIDEGAGQTTSGLFTCGVCQ  376

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL  SEGISVHAG+IFSTSSKPWQGPFLC  CRNKKDAMEGKRPSGVKVA
Sbjct  377  VDLAPSEGISVHAGSIFSTSSKPWQGPFLCAACRNKKDAMEGKRPSGVKVA  427



>ref|XP_007222389.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica]
 gb|EMJ23588.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica]
Length=429

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 95/110 (86%), Gaps = 4/110 (4%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSM-SGLFICAVCQV  433
             FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S  SGLF+CAVCQV
Sbjct  320  FFRKKSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTAQSTTSGLFMCAVCQV  379

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            DL  SEGISVHAG+IFSTSSKPWQGPFLC+DC NKKDAMEGKRPSGVKVA
Sbjct  380  DLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCCNKKDAMEGKRPSGVKVA  429



>ref|XP_006469091.1| PREDICTED: probable protein phosphatase 2C 3-like, partial [Citrus 
sinensis]
Length=323

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKKS   A K +KKLSAVGIVEELFEEGSAMLAERLG+E+    S SGLF CAVCQ+D
Sbjct  215  LFRKKSLDSANKLTKKLSAVGIVEELFEEGSAMLAERLGNEEPVLQSTSGLFTCAVCQID  274

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTSSKP QGPF C DCRNKKDAMEGKRPSGVKVA
Sbjct  275  LAPSEGISVHAGSIFSTSSKPRQGPFFCADCRNKKDAMEGKRPSGVKVA  323



>ref|XP_006842367.1| hypothetical protein AMTR_s00079p00186650 [Amborella trichopoda]
 gb|ERN04042.1| hypothetical protein AMTR_s00079p00186650 [Amborella trichopoda]
Length=431

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 95/111 (86%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S     K +KKLSAVGIVEELFEEGSAMLAERLG+ D++G + SGLF CAVCQ
Sbjct  322  SFIFRKRSRDSVNKLTKKLSAVGIVEELFEEGSAMLAERLGN-DTSGQTPSGLFTCAVCQ  380

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            VDL  SEGISVHAG+ FS SSKPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  381  VDLAPSEGISVHAGSFFSISSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  431



>ref|XP_004299042.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464089.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
Length=429

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 4/109 (4%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSM-SGLFICAVCQV  433
            +FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S  SGLF+CAVCQV
Sbjct  320  LFRKKSRDSAHKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTAQSTTSGLFMCAVCQV  379

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            DL  SEGISVHAG+IFS SSKPWQGPFLC+DCRNKKDAMEGKRPSGV+V
Sbjct  380  DLAPSEGISVHAGSIFSMSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRV  428



>ref|XP_008243272.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 15 [Prunus mume]
Length=431

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 96/112 (86%), Gaps = 4/112 (4%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSM-SGLFICAVC  439
            +  FRKKS   A K SKKLSAVGIVEELFEEGSAMLAERLGS++    S  SGLF+CAVC
Sbjct  320  TLFFRKKSRDSANKLSKKLSAVGIVEELFEEGSAMLAERLGSDECTAQSTTSGLFMCAVC  379

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            QVDL  SEGISVHAG+IFSTSSKPWQGPFLC+DC NKKDAMEGKRPSGVKVA
Sbjct  380  QVDLAPSEGISVHAGSIFSTSSKPWQGPFLCSDCCNKKDAMEGKRPSGVKVA  431



>ref|XP_010906997.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Elaeis 
guineensis]
Length=368

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S   ++K +KKLSAVGIVEELFEEGSAMLAERLG++ S G   SGLF CA+CQ
Sbjct  258  SLIFRKRSKDSSSKLAKKLSAVGIVEELFEEGSAMLAERLGNDSSAGQETSGLFTCAICQ  317

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            VDL  SEGISVHAG+IFSTSSKPW+GPFLC DC NKKDAMEGKRPSGV V
Sbjct  318  VDLAPSEGISVHAGSIFSTSSKPWEGPFLCADCCNKKDAMEGKRPSGVTV  367



>gb|KHN06682.1| Hypothetical protein glysoja_021228 [Glycine soja]
Length=431

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 5/110 (5%)
 Frame = -1

Query  597  FRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDS--NGPSMSGLFICAVCQV  433
            FRK+S   A+K SKKLSA+ IVEELFEEGSAMLAERLG++D+  +G S SG+F+CAVCQV
Sbjct  322  FRKRSRDSASKLSKKLSAINIVEELFEEGSAMLAERLGNDDNLNSGQSTSGIFVCAVCQV  381

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            DL  SEGISVHAG+IFSTSSKPW+GPFLC DCR+KKDAMEGKRPSGVKV+
Sbjct  382  DLAPSEGISVHAGSIFSTSSKPWEGPFLCFDCRDKKDAMEGKRPSGVKVS  431



>ref|XP_003536672.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Glycine max]
 ref|XP_006589677.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Glycine max]
 ref|XP_006589678.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Glycine max]
 ref|XP_006589679.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X4 
[Glycine max]
Length=431

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 5/110 (5%)
 Frame = -1

Query  597  FRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDS--NGPSMSGLFICAVCQV  433
            FRK+S   A+K SKKLSA+ IVEELFEEGSAMLAERLG++D+  +G S SG+F+CAVCQV
Sbjct  322  FRKRSRDSASKLSKKLSAINIVEELFEEGSAMLAERLGNDDNLNSGQSTSGIFVCAVCQV  381

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            DL  SEGISVHAG+IFSTSSKPW+GPFLC DCR+KKDAMEGKRPSGVKV+
Sbjct  382  DLAPSEGISVHAGSIFSTSSKPWEGPFLCFDCRDKKDAMEGKRPSGVKVS  431



>ref|XP_010906996.1| PREDICTED: probable protein phosphatase 2C 3 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S   ++K +KKLSAVGIVEELFEEGSAMLAERLG++ S G   SGLF CA+CQ
Sbjct  328  SLIFRKRSKDSSSKLAKKLSAVGIVEELFEEGSAMLAERLGNDSSAGQETSGLFTCAICQ  387

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            VDL  SEGISVHAG+IFSTSSKPW+GPFLC DC NKKDAMEGKRPSGV V
Sbjct  388  VDLAPSEGISVHAGSIFSTSSKPWEGPFLCADCCNKKDAMEGKRPSGVTV  437



>ref|XP_003555914.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Glycine max]
 ref|XP_006605919.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Glycine max]
 ref|XP_006605920.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Glycine max]
 gb|KHN11390.1| Hypothetical protein glysoja_015285 [Glycine soja]
Length=431

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 97/110 (88%), Gaps = 5/110 (5%)
 Frame = -1

Query  597  FRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDS--NGPSMSGLFICAVCQV  433
            FRK    SA+K SKKLSA+ IVEELFEEGSAMLAERLG++D+  +G S SG+F+CAVCQV
Sbjct  322  FRKSSRDSASKLSKKLSAINIVEELFEEGSAMLAERLGNDDNLNSGQSTSGIFVCAVCQV  381

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            DL  SEGISVHAG+IFSTSSKPW+GPFLC DCR+KKDAMEGKRPSGVKV+
Sbjct  382  DLAPSEGISVHAGSIFSTSSKPWEGPFLCFDCRDKKDAMEGKRPSGVKVS  431



>emb|CAN76446.1| hypothetical protein VITISV_010117 [Vitis vinifera]
Length=1001

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 93/107 (87%), Gaps = 3/107 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRK+S     K SKKLSA+GIVEELFEEGSAMLAERLGSE+  G   SGLF+CAVCQVD
Sbjct  289  LFRKRSRDSVNKLSKKLSAIGIVEELFEEGSAMLAERLGSEECPGQPTSGLFMCAVCQVD  348

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVK  289
            L  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSG+K
Sbjct  349  LXPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGIK  395



>gb|ABR17671.1| unknown [Picea sitchensis]
Length=208

 Score =   162 bits (409),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 92/111 (83%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S     K + KLSAVGIVEELFEEGSAMLAERLGSE S   + SGLF CAVCQ
Sbjct  99   SLIFRKRSRDSMNKLTSKLSAVGIVEELFEEGSAMLAERLGSESSLA-ATSGLFTCAVCQ  157

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
             DL  SEGISVHAG+ FST+++PW+GPFLC DCR+KKDAMEGKRPSGVKVA
Sbjct  158  TDLTPSEGISVHAGSFFSTTARPWEGPFLCADCRHKKDAMEGKRPSGVKVA  208



>ref|XP_008792836.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008778230.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Phoenix 
dactylifera]
Length=458

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S   A+K +KKLSAVGIVEELFEEGSAMLAERLG++ S G + SGLF CA+CQ
Sbjct  348  SLIFRKRSEDSASKLAKKLSAVGIVEELFEEGSAMLAERLGNDLSAGQATSGLFTCAICQ  407

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
             DL  SEGISVHAG+IFSTSSKPW+GPFLC DC NKKDAMEGKRPSGV V
Sbjct  408  ADLAPSEGISVHAGSIFSTSSKPWEGPFLCADCCNKKDAMEGKRPSGVTV  457



>ref|XP_008792835.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008778229.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Phoenix 
dactylifera]
Length=460

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRK+S   A+K +KKLSAVGIVEELFEEGSAMLAERLG++ S G + SGLF CA+CQ
Sbjct  350  SLIFRKRSEDSASKLAKKLSAVGIVEELFEEGSAMLAERLGNDLSAGQATSGLFTCAICQ  409

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
             DL  SEGISVHAG+IFSTSSKPW+GPFLC DC NKKDAMEGKRPSGV V
Sbjct  410  ADLAPSEGISVHAGSIFSTSSKPWEGPFLCADCCNKKDAMEGKRPSGVTV  459



>emb|CDP00657.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -1

Query  555  AVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEGISVHAGAIFSTS  376
            AVGIVEELFEEGSAMLAERLG++DS+G +  GLFICAVCQ DL  SEGISVHAG+IFSTS
Sbjct  309  AVGIVEELFEEGSAMLAERLGNDDSSGQTTVGLFICAVCQTDLAPSEGISVHAGSIFSTS  368

Query  375  SKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            SKPWQGPFLC+DCRNKKDAMEGKRPSGVKV
Sbjct  369  SKPWQGPFLCSDCRNKKDAMEGKRPSGVKV  398



>ref|XP_011076402.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
 ref|XP_011076409.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
Length=428

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 4/108 (4%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKKS   A K S KL++VGIVEELFEEGSAMLAERLG++D++G + S LF+CAVCQ D
Sbjct  321  LFRKKSYGSANKLSMKLASVGIVEELFEEGSAMLAERLGNDDTSGQT-SSLFVCAVCQAD  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            L  +EGISVHAG+IFS SSKPWQGPFLC DCRNKKDAMEGKRPSGV+V
Sbjct  380  LAPNEGISVHAGSIFSMSSKPWQGPFLCADCRNKKDAMEGKRPSGVRV  427



>ref|NP_177008.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 ref|NP_001031252.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 sp|Q9M9C6.1|P2C15_ARATH RecName: Full=Probable protein phosphatase 2C 15; Short=AtPP2C15 
[Arabidopsis thaliana]
 gb|AAF26041.1|AC015986_4 putative protein phosphatase; 14863-16856 [Arabidopsis thaliana]
 gb|AAK92818.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AAM14234.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AEE34790.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 gb|AEE34791.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
Length=436

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG--LFICAVC  439
            S +FRKKS  + K SKKLS VGIVEELFEEGSAMLAERLGS D +  S +G  +F CA+C
Sbjct  325  SLLFRKKSNSSNKLSKKLSTVGIVEELFEEGSAMLAERLGSGDCSKESTTGGGIFTCAIC  384

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  385  QLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  435



>dbj|BAH20040.1| AT1G68410 [Arabidopsis thaliana]
Length=436

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG--LFICAVC  439
            S +FRKKS  + K SKKLS VGIVEELFEEGSAMLAERLGS D +  S +G  +F CA+C
Sbjct  325  SLLFRKKSNSSNKLSKKLSTVGIVEELFEEGSAMLAERLGSGDCSKESTTGGGIFTCAIC  384

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  385  QLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  435



>ref|XP_002888662.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64921.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
Length=438

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG--LFICAVC  439
            S +FRKKS  + K SKKLS VGIVEELFEEGSAMLAERLGS D +  S +G  +F CA+C
Sbjct  327  SLLFRKKSNSSNKLSKKLSTVGIVEELFEEGSAMLAERLGSGDCSKESTTGGGIFTCAIC  386

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  387  QLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  437



>ref|XP_010099267.1| putative protein phosphatase 2C 15 [Morus notabilis]
 gb|EXB77531.1| putative protein phosphatase 2C 15 [Morus notabilis]
Length=526

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 89/102 (87%), Gaps = 3/102 (3%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKKS     K SKKLSAVGIVEELFEEGSAMLAERLG++DS G S SGLF+CAVCQVD
Sbjct  335  LFRKKSRDSVNKLSKKLSAVGIVEELFEEGSAMLAERLGNDDSMGQSTSGLFMCAVCQVD  394

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            L  SEGISVHAG+IFSTS+KPWQGPFLC  CRNKKDAMEGKR
Sbjct  395  LAPSEGISVHAGSIFSTSAKPWQGPFLCAGCRNKKDAMEGKR  436



>ref|XP_006645937.1| PREDICTED: probable protein phosphatase 2C 3-like, partial [Oryza 
brachyantha]
Length=403

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 98/118 (83%), Gaps = 3/118 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG  460
            P+++    S IFRKK+     K +K+LSAVG+VEELFEEGSAML+ERLGS+ S   + S 
Sbjct  285  PKKINKLKSLIFRKKAKDQTNKLTKQLSAVGMVEELFEEGSAMLSERLGSDSSGRRTSSS  344

Query  459  LFICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            LF CA+CQVDL  SEGISVHAG+IFS+SSKPW+GPFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  345  LFTCAICQVDLEPSEGISVHAGSIFSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKV  402



>ref|XP_010511830.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010511832.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=440

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG--LFICAVC  439
            S +FRKKS  + K SKKLS+VGIVEELFEEGSAML ERLGS D +  S +G  +F CA+C
Sbjct  329  SLLFRKKSNSSNKLSKKLSSVGIVEELFEEGSAMLDERLGSGDFSKESTTGGGIFTCAIC  388

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  389  QLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  439



>emb|CDY44900.1| BnaA02g13820D [Brassica napus]
Length=413

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 93/112 (83%), Gaps = 5/112 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSED-SNGPSMSG--LFICAV  442
            S +FRKKS  + K SKKLS V IVEELFEEGSAMLAERLGS D S  P+  G  LF CA+
Sbjct  301  SLLFRKKSNSSNKLSKKLSTVSIVEELFEEGSAMLAERLGSGDCSKEPTTGGGGLFTCAI  360

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            CQ+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  361  CQLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  412



>ref|XP_010470790.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470791.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470792.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=439

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG--LFICAVC  439
            S +FRKKS  + K +KKLS+VGIVEELFEEGSAML ERLGS D +  S +G  +F CA+C
Sbjct  328  SLLFRKKSNSSNKLAKKLSSVGIVEELFEEGSAMLDERLGSGDCSKESTTGGGIFTCAIC  387

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  388  QLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  438



>ref|XP_010415460.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=442

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG--LFICAVC  439
            S +FRKKS  + K +KKLS+VGIVEELFEEGSAML ERLGS D +  S +G  +F CA+C
Sbjct  331  SLLFRKKSNSSNKLAKKLSSVGIVEELFEEGSAMLDERLGSGDCSKESTTGGGIFTCAIC  390

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  391  QLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  441



>ref|XP_006302270.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
 gb|EOA35168.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
Length=437

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG--LFICAVC  439
            S +FRKKS  + K SKKLS+VGIVEELFEEGSAML ERLGS D +  S +G  +F CA+C
Sbjct  326  SLLFRKKSNSSNKLSKKLSSVGIVEELFEEGSAMLDERLGSGDCSKESTTGGGIFTCAIC  385

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  S+GISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  386  QLDLAPSDGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  436



>ref|XP_004135083.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus]
 ref|XP_004159290.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus]
 gb|KGN52100.1| hypothetical protein Csa_5G610350 [Cucumis sativus]
Length=433

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 92/112 (82%), Gaps = 4/112 (4%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSED--SNGPSMSGLFICAVC  439
            S +FRKKS  + K SK+LSA+G VEELFE+GSAMLAERLG+ +   +G     +F C VC
Sbjct  322  SLLFRKKSPSSNKLSKRLSAIGFVEELFEDGSAMLAERLGTVELSGSGHGTPNMFTCVVC  381

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            QVDL  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGV+VA
Sbjct  382  QVDLAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVRVA  433



>ref|XP_008446622.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 15 [Cucumis melo]
Length=434

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSED--SNGPSMSGLFICAV  442
            S +FRKK   S+ K SK+LSA+G VEELFE+GSAMLAERLG+ +   +G     +F C V
Sbjct  322  SLLFRKKXSPSSNKLSKRLSAIGFVEELFEDGSAMLAERLGTVELSGSGHGTPNMFTCVV  381

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            CQVDL  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGV+VA
Sbjct  382  CQVDLAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVRVA  434



>ref|NP_001043180.2| Os01g0513100 [Oryza sativa Japonica Group]
 dbj|BAD73079.1| phosphatase-like protein [Oryza sativa Japonica Group]
 dbj|BAD73271.1| phosphatase-like protein [Oryza sativa Japonica Group]
 dbj|BAF05094.2| Os01g0513100 [Oryza sativa Japonica Group]
Length=133

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKSATKP---SKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG  460
            P+++    S IFRKK+   P   +K+LSA G+VEELFEEGSAML+ERLG++ S   + S 
Sbjct  14   PKKINKLKSLIFRKKTKDHPNKLTKQLSAAGMVEELFEEGSAMLSERLGNDSSGRRTSSS  73

Query  459  LFICAVCQVDLGASEGISVHAGAIF-STSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            LF CA+CQVDL  SEGISVHAG+IF S+SSKPW+GPFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  74   LFTCAICQVDLEPSEGISVHAGSIFSSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKV  132



>ref|XP_011022405.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022414.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022422.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022430.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022439.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022447.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
Length=428

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKK   S++K SKKLSA+G VEELFEEGSAMLAERLG++ S   S SGLF C VCQ+D
Sbjct  320  LFRKKCHDSSSKLSKKLSAIGTVEELFEEGSAMLAERLGNDGSTSQSTSGLFTCVVCQID  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  380  LAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>ref|XP_002312412.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE89779.1| phosphatase 2C family protein [Populus trichocarpa]
Length=428

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 3/109 (3%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKK   S++K SKKLSA+G VEELFEEGSAMLAERLG++ S   S SGLF C VCQ+D
Sbjct  320  LFRKKCHDSSSKLSKKLSAIGTVEELFEEGSAMLAERLGNDYSTSQSTSGLFTCVVCQID  379

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            L  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  380  LAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>ref|XP_009127629.1| PREDICTED: probable protein phosphatase 2C 15 [Brassica rapa]
Length=426

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 93/114 (82%), Gaps = 7/114 (6%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSED-SNGPSMSG----LFIC  448
            S +FRKKS  + K SKKLS V IVEELFEEGSAMLAERLGS D S  P+  G    +F C
Sbjct  312  SLLFRKKSNSSNKLSKKLSTVSIVEELFEEGSAMLAERLGSGDCSKEPTTGGGGGGIFTC  371

Query  447  AVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            A+CQ+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  372  AICQLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  425



>gb|EYU30003.1| hypothetical protein MIMGU_mgv1a006840mg [Erythranthe guttata]
 gb|EYU30004.1| hypothetical protein MIMGU_mgv1a006840mg [Erythranthe guttata]
Length=429

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 4/108 (4%)
 Frame = -1

Query  600  IFRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRK   KS+ K +KK+S VGIVE+LFEEGSAMLAERLG++DS+G +  G+F+CAVCQVD
Sbjct  322  LFRKLSSKSSAKLAKKVSDVGIVEQLFEEGSAMLAERLGNDDSSGQN-CGVFVCAVCQVD  380

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            L  +EGISVHAG+IFS SSKPWQGPFLC DC NKK+AMEGKRPSGVKV
Sbjct  381  LSPNEGISVHAGSIFSMSSKPWQGPFLCGDCLNKKEAMEGKRPSGVKV  428



>gb|ACN31161.1| unknown [Zea mays]
Length=250

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 92/111 (83%), Gaps = 6/111 (5%)
 Frame = -1

Query  606  STIFRKKSATKPSKKL----SAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            S IFRKK A  PS+KL    SAVGIVEE+FEEGSAML+ERLG  D +G   S LF CA+C
Sbjct  141  SFIFRKK-AKDPSQKLTKQHSAVGIVEEIFEEGSAMLSERLGP-DLDGRRTSSLFTCAIC  198

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFS++S+PW+GPFLC+DCR KKDAMEGKRPSGVKV
Sbjct  199  QLDLEPSEGISVHAGSIFSSTSRPWEGPFLCSDCREKKDAMEGKRPSGVKV  249



>emb|CDX81511.1| BnaC02g18150D [Brassica napus]
Length=438

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 93/117 (79%), Gaps = 10/117 (9%)
 Frame = -1

Query  606  STIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSED-SNGPSMSG-------L  457
            S +FRKKS  + K SKKLS V IVEELFEEGSAMLAERLGS D S  P+  G       +
Sbjct  321  SLLFRKKSNSSNKLSKKLSTVSIVEELFEEGSAMLAERLGSGDCSKEPTTGGGGGGGGGI  380

Query  456  FICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            F CA+CQ+DL  SEGISVHAG+IFSTS KPWQGPFLCTDCR+KKDAMEGKRPSGVKV
Sbjct  381  FTCAICQLDLAPSEGISVHAGSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  437



>ref|XP_009385409.1| PREDICTED: probable protein phosphatase 2C 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385410.1| PREDICTED: probable protein phosphatase 2C 3 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 4/118 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG  460
            P++V    S IFR+K   S  K +KKLSAVG+VEELFEEGSAMLAERLG+ DS+    S 
Sbjct  315  PKKVNRLKSFIFRRKPKDSVNKLAKKLSAVGVVEELFEEGSAMLAERLGN-DSSAEKTSN  373

Query  459  LFICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            +F CA+CQ  L  S+G+SVHAG+IFST+SKPW+GPFLC DCRNKKDAMEGKRPSGVKV
Sbjct  374  VFTCAICQAILVPSKGVSVHAGSIFSTNSKPWEGPFLCDDCRNKKDAMEGKRPSGVKV  431



>ref|XP_004968827.1| PREDICTED: probable protein phosphatase 2C 3-like [Setaria italica]
Length=483

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 5/111 (5%)
 Frame = -1

Query  606  STIFRKKSATKPSKKL----SAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            S IFRKK A  PS+KL    S  G+VEE+FEEGSAML+ERLG + + G + S LF CA+C
Sbjct  373  SLIFRKK-AKDPSQKLTKQHSGAGVVEEIFEEGSAMLSERLGPDSNGGRTSSSLFTCAIC  431

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            QVDL  SEGISVHAG+IFS+SSKPW+GPFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  432  QVDLEPSEGISVHAGSIFSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKV  482



>ref|XP_002455646.1| hypothetical protein SORBIDRAFT_03g016300 [Sorghum bicolor]
 gb|EES00766.1| hypothetical protein SORBIDRAFT_03g016300 [Sorghum bicolor]
Length=496

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 6/111 (5%)
 Frame = -1

Query  606  STIFRKKSATKPSKKL----SAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            S IFRKK A  PS+KL    SAVGIVEE+FEEGSAML+ERLG   S+G   S LF CA+C
Sbjct  387  SLIFRKK-AKDPSQKLTKQHSAVGIVEEIFEEGSAMLSERLGPH-SDGRRTSSLFTCAIC  444

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFS+SS+PW+GPFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  445  QLDLEPSEGISVHAGSIFSSSSRPWEGPFLCSDCRDKKDAMEGKRPSGVKV  495



>ref|XP_003567758.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Brachypodium 
distachyon]
Length=468

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 4/110 (4%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRKK    + K +K+LS+VG+VEE+FEEGSAML+ERLG+  S+G   S LF CA+CQ
Sbjct  359  SLIFRKKGKVMSNKLTKQLSSVGMVEEIFEEGSAMLSERLGNH-SSGRRTSSLFTCAICQ  417

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            VDL  SEGISVHAG+ FS+SSKPWQ PFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  418  VDLDPSEGISVHAGSKFSSSSKPWQSPFLCSDCRDKKDAMEGKRPSGVKV  467



>ref|NP_001151513.1| LOC100285147 [Zea mays]
 gb|ACG43141.1| protein phosphatase 2C ABI2 [Zea mays]
Length=484

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 92/111 (83%), Gaps = 6/111 (5%)
 Frame = -1

Query  606  STIFRKKSATKPSKKL----SAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            S IFRKK A  PS+KL    SAVGIVEE+FEEGSAML+ERLG  D +G   S LF CA+C
Sbjct  375  SFIFRKK-AKDPSQKLTKQHSAVGIVEEIFEEGSAMLSERLGP-DLDGRRTSSLFTCAIC  432

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            Q+DL  SEGISVHAG+IFS++S+PW+GPFLC+DCR KKDAMEGKRPSGVKV
Sbjct  433  QLDLEPSEGISVHAGSIFSSTSRPWEGPFLCSDCREKKDAMEGKRPSGVKV  483



>gb|EPS73050.1| hypothetical protein M569_01706, partial [Genlisea aurea]
Length=436

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = -1

Query  597  FRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPS--MSGLFICAVCQVDLG  424
            F + S  + SKKLSAV  VEELFEEGSAMLAERLG     GPS   + LF+CA+CQ DL 
Sbjct  332  FCRASTNRSSKKLSAVSTVEELFEEGSAMLAERLGH--GGGPSGETNSLFVCAICQTDLA  389

Query  423  ASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
             +EGISVHAG+IFS SSKPWQGPFLC DCR+KKDAMEGKRPSGVK+
Sbjct  390  PNEGISVHAGSIFSMSSKPWQGPFLCADCRDKKDAMEGKRPSGVKI  435



>sp|Q0JMD4.2|P2C03_ORYSJ RecName: Full=Probable protein phosphatase 2C 3; Short=OsPP2C03 
[Oryza sativa Japonica Group]
 gb|EEE54680.1| hypothetical protein OsJ_01986 [Oryza sativa Japonica Group]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKSATKP---SKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG  460
            P+++    S IFRKK+   P   +K+LSA G+VEELFEEGSAML+ERLG++ S   + S 
Sbjct  366  PKKINKLKSLIFRKKTKDHPNKLTKQLSAAGMVEELFEEGSAMLSERLGNDSSGRRTSSS  425

Query  459  LFICAVCQVDLGASEGISVHAGAIF-STSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            LF CA+CQVDL  SEGISVHAG+IF S+SSKPW+GPFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  426  LFTCAICQVDLEPSEGISVHAGSIFSSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKV  484



>gb|EEC70750.1| hypothetical protein OsI_02161 [Oryza sativa Indica Group]
Length=485

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = -1

Query  630  PQEV**ASSTIFRKKSATKP---SKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSG  460
            P+++    S IFRKK+   P   +K+LSA G+VEELFEEGSAML+ERLG++ S   + S 
Sbjct  366  PKKINKLKSLIFRKKTKDHPNKLTKQLSAAGMVEELFEEGSAMLSERLGNDSSGRRTSSS  425

Query  459  LFICAVCQVDLGASEGISVHAGAIF-STSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            LF CA+CQVDL  SEGISVHAG+IF S+SSKPW+GPFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  426  LFTCAICQVDLEPSEGISVHAGSIFSSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKV  484



>ref|XP_010532299.1| PREDICTED: probable protein phosphatase 2C 15 isoform X2 [Tarenaya 
hassleriana]
Length=440

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 81/96 (84%), Gaps = 6/96 (6%)
 Frame = -1

Query  561  LSAVGIVEELFEEGSAMLAERLGSEDSNGPSMS----GLFICAVCQVDLGASEGISVHAG  394
            LSAVG VEELFEEGSAMLAERLGS   NG  +S    G+F CA+CQVDL  SEGISVHAG
Sbjct  346  LSAVGNVEELFEEGSAMLAERLGS--GNGEEVSTKTKGMFTCAICQVDLAPSEGISVHAG  403

Query  393  AIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            +IFSTS KPWQGPFLC DCRNKKDAMEGKRPSGVKV
Sbjct  404  SIFSTSLKPWQGPFLCGDCRNKKDAMEGKRPSGVKV  439



>dbj|BAJ89158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = -1

Query  606  STIFRKKSATKP---SKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S IFRKK+  +P   +K+LS+ G+VEE+FEEGSA+L+ERLG++  +  + S LF CA+CQ
Sbjct  223  SLIFRKKTKDQPNKLTKQLSSAGMVEEIFEEGSAILSERLGNDSGSWRTSSSLFTCAICQ  282

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
              L  SEG SVH G++FS+SSKPW+GPFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  283  AGLEPSEGTSVHVGSVFSSSSKPWEGPFLCSDCRDKKDAMEGKRPSGVKV  332



>ref|XP_010230932.1| PREDICTED: probable protein phosphatase 2C 3 isoform X1 [Brachypodium 
distachyon]
Length=470

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 6/112 (5%)
 Frame = -1

Query  606  STIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAER--LGSEDSNGPSMSGLFICAV  442
            S IFRKK    + K +K+LS+VG+VEE+FEEGSAML+ER  LG+  S+G   S LF CA+
Sbjct  359  SLIFRKKGKVMSNKLTKQLSSVGMVEEIFEEGSAMLSERCRLGNH-SSGRRTSSLFTCAI  417

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            CQVDL  SEGISVHAG+ FS+SSKPWQ PFLC+DCR+KKDAMEGKRPSGVKV
Sbjct  418  CQVDLDPSEGISVHAGSKFSSSSKPWQSPFLCSDCRDKKDAMEGKRPSGVKV  469



>ref|XP_006448420.1| hypothetical protein CICLE_v10018331mg [Citrus clementina]
 gb|ESR61660.1| hypothetical protein CICLE_v10018331mg [Citrus clementina]
Length=352

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 87/117 (74%), Gaps = 14/117 (12%)
 Frame = -1

Query  600  IFRKKS---ATKPSKKLSAVGIVEEL--------FEEGSAMLAERLGSEDSNGPSMSGLF  454
            +FRKKS   A K SKKLSAVGIV  +        F  G A   ++LG+E+    S SGLF
Sbjct  239  LFRKKSLDSANKLSKKLSAVGIVNAVSFACVNVRFVIGKA---QKLGNEEPVLQSTSGLF  295

Query  453  ICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
             CAVCQ+DL  SEGISVHAG+IFSTSSKPWQGPFLC DCRNKKDAMEGKRPSGVKVA
Sbjct  296  TCAVCQIDLAPSEGISVHAGSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  352



>ref|XP_009626600.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana tomentosiformis]
Length=427

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = -1

Query  609  SSTIFRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            SS IF ++S    SKKLS VGIVEELFEEGSAMLAERLG +D    S SGLF CA+CQVD
Sbjct  319  SSFIFGRRSQNSRSKKLSTVGIVEELFEEGSAMLAERLG-KDFPLNSSSGLFRCAICQVD  377

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
              ASEG+SV++G  FS +SKPW+GPFLC +CR KKDAMEGKRPS
Sbjct  378  QPASEGLSVNSGPFFSPASKPWEGPFLCANCRRKKDAMEGKRPS  421



>ref|XP_004230274.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
 ref|XP_010313289.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
 ref|XP_010313296.1| PREDICTED: probable protein phosphatase 2C 5 [Solanum lycopersicum]
Length=427

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = -1

Query  609  SSTIFRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +S +FR++S    S KLSAVG+VEELFEEGSAMLAERLG +D    S SGLF CAVCQ D
Sbjct  319  TSFLFRRRSQNARSNKLSAVGVVEELFEEGSAMLAERLG-KDFPLDSSSGLFRCAVCQAD  377

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
              ASEG+SV++G  FS SSKPW+GPFLC  CR KKDAMEGKRPS
Sbjct  378  QPASEGLSVNSGPFFSPSSKPWEGPFLCATCRRKKDAMEGKRPS  421



>ref|XP_009759573.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana sylvestris]
Length=427

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = -1

Query  609  SSTIFRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            SS I+ K S    SKKLS VGIVEELFEEGSAMLAERLG +D    S SGLF CA+CQVD
Sbjct  319  SSFIYGKISQNSRSKKLSTVGIVEELFEEGSAMLAERLG-KDFPLNSSSGLFRCAICQVD  377

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
              ASEG+SV++G  FS +SKPW+GPFLC +CR KKDAMEGKRPS
Sbjct  378  QPASEGLSVNSGPFFSPASKPWEGPFLCANCRRKKDAMEGKRPS  421



>ref|XP_006344713.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Solanum tuberosum]
 ref|XP_006344714.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Solanum tuberosum]
Length=427

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = -1

Query  609  SSTIFRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +S +F ++S    S KLSAVG+VEELFEEGSAMLAERLG +D    S SGLF CAVCQ D
Sbjct  319  TSFLFGRRSQNARSNKLSAVGVVEELFEEGSAMLAERLG-KDFPLDSSSGLFRCAVCQAD  377

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
              ASEG+SV++G  FS +SKPW+GPFLC+ CR KKDAMEGKRPS
Sbjct  378  QPASEGLSVNSGPFFSPASKPWEGPFLCSTCRRKKDAMEGKRPS  421



>ref|XP_009599009.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana tomentosiformis]
Length=428

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = -1

Query  609  SSTIFRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +S +F ++S    S KLSAVG+VEELFEEGSAMLAERLG +D    S SGLF CAVCQ D
Sbjct  320  TSFLFGRRSQNARSNKLSAVGVVEELFEEGSAMLAERLG-KDFPLDSSSGLFRCAVCQAD  378

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
              ASEG+SV++G  FS +SKPW+GPFLC  CR KKDAMEGKRPS
Sbjct  379  QPASEGLSVNSGPFFSPASKPWEGPFLCATCRRKKDAMEGKRPS  422



>ref|XP_009799456.1| PREDICTED: probable protein phosphatase 2C 5 [Nicotiana sylvestris]
Length=428

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = -1

Query  609  SSTIFRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +S +F ++S    S KLSAVG+VEELFEEGSAMLAERLG +D    S SGLF CAVCQ D
Sbjct  320  TSFLFGRRSQNARSNKLSAVGVVEELFEEGSAMLAERLG-KDFPLDSSSGLFRCAVCQAD  378

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
              ASEG+SV++G  FS +SKPW+GPFLC  CR KKDAMEGKRPS
Sbjct  379  QPASEGLSVNSGPFFSPASKPWEGPFLCATCRRKKDAMEGKRPS  422



>ref|XP_006433490.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 ref|XP_006433491.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|ESR46730.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|ESR46731.1| hypothetical protein CICLE_v10001248mg [Citrus clementina]
 gb|KDO81742.1| hypothetical protein CISIN_1g014281mg [Citrus sinensis]
 gb|KDO81743.1| hypothetical protein CISIN_1g014281mg [Citrus sinensis]
Length=427

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = -1

Query  609  SSTIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            SS IF KK+  + K S KL+AVG+VEELFEEGSAMLAERLG +  +  S SGLF CAVCQ
Sbjct  317  SSLIFGKKAHDSMKTSNKLAAVGVVEELFEEGSAMLAERLGRDFPSNAS-SGLFRCAVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
            VD   S+G+SV++G  FS +SKPW+GPFLC +CR KKDAMEGKRP
Sbjct  376  VDQPPSDGLSVNSGPYFSPTSKPWEGPFLCANCRKKKDAMEGKRP  420



>ref|XP_006472159.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Citrus sinensis]
 ref|XP_006472160.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Citrus sinensis]
Length=427

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = -1

Query  609  SSTIFRKKS--ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            SS IF KK+  + K S KL+AVG+VEELFEEGSAMLAERLG +  +  S SGLF CAVCQ
Sbjct  317  SSLIFGKKAHDSMKTSNKLAAVGVVEELFEEGSAMLAERLGRDFPSNAS-SGLFRCAVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
            VD   S+G+SV++G  FS +SKPW+GPFLC +CR KKDAMEGKRP
Sbjct  376  VDQPPSDGLSVNSGPYFSPTSKPWEGPFLCANCRKKKDAMEGKRP  420



>ref|XP_007031084.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY11586.1| Phosphatase 2C family protein [Theobroma cacao]
Length=428

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F K+S     K + KLS VG+VEELFEEGSAMLAERLG +D    + SG+F CAVC
Sbjct  317  SSLLFGKRSQNSTNKTTNKLSVVGVVEELFEEGSAMLAERLG-KDFPMNTNSGIFKCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   SEG++V++G  FS +SKPW+GPFLCT+CR KKDAMEGKRPS
Sbjct  376  QVDQPPSEGLTVNSGPFFSPASKPWEGPFLCTNCRKKKDAMEGKRPS  422



>gb|KHG19035.1| hypothetical protein F383_08660 [Gossypium arboreum]
Length=397

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 4/105 (4%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F K+S T   K + KLSAVG+VEELFEEGSAMLAERLG +D    + SGLF CAVC
Sbjct  286  SSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAMLAERLG-KDFPMNTNSGLFKCAVC  344

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            QVD   +EG++V++G  FS +SKPW+GPFLCT+CR KKDAMEGKR
Sbjct  345  QVDQPPAEGLTVNSGPFFSPASKPWEGPFLCTNCRKKKDAMEGKR  389



>gb|EYU37269.1| hypothetical protein MIMGU_mgv1a006832mg [Erythranthe guttata]
Length=430

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 9/111 (8%)
 Frame = -1

Query  609  SSTIFRKK--SATKPSKKLSAVGIVEELFEEGSAMLAERLGSE---DSNGPSMSGLFICA  445
            +S +F KK  +++K + KLS VG+VEELFEEGSAMLA+RLG +   DSN    SGLF CA
Sbjct  322  TSLLFGKKFHNSSKGTNKLSTVGVVEELFEEGSAMLADRLGKDFPLDSN----SGLFRCA  377

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGV  292
            +CQVD  ASEG+SV++G  FS SSKPW+GPFLC  CR KKDAMEGK+P  V
Sbjct  378  ICQVDQPASEGLSVNSGPFFSPSSKPWEGPFLCASCRRKKDAMEGKKPFAV  428



>gb|KJB45378.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
 gb|KJB45379.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
 gb|KJB45381.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
Length=420

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F K+S T   K + KLSAVG+VEELFEEGSAMLAERLG +D      SGLF CAVC
Sbjct  309  SSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAMLAERLG-KDFPMNKNSGLFKCAVC  367

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   +EG++V++G  FS +SKPW+GPFLCT+CR KKDAMEGKR S
Sbjct  368  QVDQPPAEGLTVNSGPFFSPASKPWEGPFLCTNCRKKKDAMEGKRSS  414



>gb|KJB45380.1| hypothetical protein B456_007G303500 [Gossypium raimondii]
Length=418

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F K+S T   K + KLSAVG+VEELFEEGSAMLAERLG +D      SGLF CAVC
Sbjct  307  SSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAMLAERLG-KDFPMNKNSGLFKCAVC  365

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   +EG++V++G  FS +SKPW+GPFLCT+CR KKDAMEGKR S
Sbjct  366  QVDQPPAEGLTVNSGPFFSPASKPWEGPFLCTNCRKKKDAMEGKRSS  412



>ref|XP_010681640.1| PREDICTED: probable protein phosphatase 2C 15 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010681641.1| PREDICTED: probable protein phosphatase 2C 15 [Beta vulgaris 
subsp. vulgaris]
Length=425

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 79/103 (77%), Gaps = 6/103 (6%)
 Frame = -1

Query  588  KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMS-GLFICAVCQVDLGASEG  412
            + + K SKKLS + IVEELFEEGSAMLAERLG+++ +  S + GLFIC  C VDL A EG
Sbjct  328  RDSNKSSKKLSPISIVEELFEEGSAMLAERLGTDEYSAQSTTPGLFICDECHVDLAAIEG  387

Query  411  ISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            ISVHAG IFSTSSKP     LC DCR KKD MEGKRPSG+K+A
Sbjct  388  ISVHAGPIFSTSSKP-----LCADCRTKKDTMEGKRPSGLKLA  425



>ref|XP_011092109.1| PREDICTED: probable protein phosphatase 2C 5 [Sesamum indicum]
Length=428

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 8/108 (7%)
 Frame = -1

Query  609  SSTIFRKKSAT-KPSKKLSAVGIVEELFEEGSAMLAERLGSE---DSNGPSMSGLFICAV  442
            SS IF K+    K + +LSAVG+VEELFEEGSAMLAERLG +   DSN    SGLF CA+
Sbjct  319  SSLIFGKRYQNAKGANRLSAVGVVEELFEEGSAMLAERLGKDFPLDSN----SGLFRCAI  374

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            CQVD   S+G+SV++G  FS SSKPW+GPFLC  CR KKDAMEGK+PS
Sbjct  375  CQVDQPPSDGLSVNSGPFFSPSSKPWEGPFLCASCRRKKDAMEGKKPS  422



>ref|XP_011466159.1| PREDICTED: probable protein phosphatase 2C 5 [Fragaria vesca 
subsp. vesca]
Length=426

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 8/113 (7%)
 Frame = -1

Query  609  SSTIFRKKSAT-KPSKKLSAVGIVEELFEEGSAMLAERLGSE---DSNGPSMSGLFICAV  442
            +S IF KKS     + KLSAVG+VEELFEEGSAMLAERLG +   D+N    SG+F CAV
Sbjct  317  TSLIFGKKSQNGSKTNKLSAVGVVEELFEEGSAMLAERLGKDIPLDAN----SGIFRCAV  372

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            CQVD   SEG+SV++G  FS SSKPW+GPFLC  CR KKDAMEGKR S   VA
Sbjct  373  CQVDQPQSEGLSVNSGPFFSPSSKPWEGPFLCAVCRRKKDAMEGKRMSTPTVA  425



>gb|KDP23425.1| hypothetical protein JCGZ_23258 [Jatropha curcas]
Length=437

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KKS     K + KLSAVG+VEELFEEGSAMLAERLG +D    + +GLF CAVC
Sbjct  326  SSLLFGKKSLNYVNKATNKLSAVGVVEELFEEGSAMLAERLG-KDFPSNTNTGLFRCAVC  384

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   ++ +SV++G+ FS  SKPW+GPFLC +CR KKDAMEGKRPS
Sbjct  385  QVDQPPTDSLSVNSGSFFSPGSKPWEGPFLCPNCRKKKDAMEGKRPS  431



>emb|CAN74505.1| hypothetical protein VITISV_015889 [Vitis vinifera]
Length=406

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 83/109 (76%), Gaps = 6/109 (6%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS IF K+S     K + KLSAVG+VEELFEEGSAMLAERLG +D    + SGLF CAVC
Sbjct  293  SSFIFGKRSQNFMNKSTNKLSAVGVVEELFEEGSAMLAERLG-KDIPSNTNSGLFRCAVC  351

Query  438  QVDL--GASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD     S+G+SV++G  FS +SKPW+GPFLC +CR KKDAMEGKRPS
Sbjct  352  QVDQDQSPSDGLSVNSGPFFSPASKPWEGPFLCANCRKKKDAMEGKRPS  400



>ref|XP_002282985.1| PREDICTED: probable protein phosphatase 2C 5 [Vitis vinifera]
 emb|CBI39560.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 83/109 (76%), Gaps = 6/109 (6%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS IF K+S     K + KLSAVG+VEELFEEGSAMLAERLG +D    + SGLF CAVC
Sbjct  317  SSFIFGKRSQNFMNKSTNKLSAVGVVEELFEEGSAMLAERLG-KDIPSNTNSGLFRCAVC  375

Query  438  QVDL--GASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD     S+G+SV++G  FS +SKPW+GPFLC +CR KKDAMEGKRPS
Sbjct  376  QVDQDQSPSDGLSVNSGPFFSPASKPWEGPFLCANCRKKKDAMEGKRPS  424



>ref|XP_010674109.1| PREDICTED: probable protein phosphatase 2C 5 [Beta vulgaris subsp. 
vulgaris]
Length=427

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 3/105 (3%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK--KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S  IF KKS    SK  KLSAVG VEELFEEGSAML ERLG +    P  SGLF CA+CQ
Sbjct  317  SGLIFGKKSHNLASKSSKLSAVGAVEELFEEGSAMLEERLGKDFPMNPE-SGLFRCAICQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
            VD   +EG+S+++G  FS SSKPW+GPFLC +CR KKDAMEGKRP
Sbjct  376  VDQPTNEGLSLNSGTFFSPSSKPWEGPFLCANCRRKKDAMEGKRP  420



>gb|KJB26348.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
 gb|KJB26351.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
 gb|KJB26352.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
Length=428

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 82/107 (77%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +FRKKS     K + KLSA+G+VEELFEEGSA+LAERLG +D    + SG+F CAVC
Sbjct  317  SSILFRKKSLNFTNKTTNKLSAIGVVEELFEEGSAVLAERLG-KDFPTNANSGIFRCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   +EG+++ +G  FS  SK W+GPFLCT+CR KKDAMEGKRPS
Sbjct  376  QVDQPPAEGLTMSSGPFFSHGSKHWEGPFLCTNCRKKKDAMEGKRPS  422



>gb|KJB26350.1| hypothetical protein B456_004G237900 [Gossypium raimondii]
Length=421

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 82/107 (77%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +FRKKS     K + KLSA+G+VEELFEEGSA+LAERLG +D    + SG+F CAVC
Sbjct  310  SSILFRKKSLNFTNKTTNKLSAIGVVEELFEEGSAVLAERLG-KDFPTNANSGIFRCAVC  368

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   +EG+++ +G  FS  SK W+GPFLCT+CR KKDAMEGKRPS
Sbjct  369  QVDQPPAEGLTMSSGPFFSHGSKHWEGPFLCTNCRKKKDAMEGKRPS  415



>gb|KHG19034.1| hypothetical protein F383_08660 [Gossypium arboreum]
Length=416

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 82/104 (79%), Gaps = 4/104 (4%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F K+S T   K + KLSAVG+VEELFEEGSAMLAERLG +D    + SGLF CAVC
Sbjct  297  SSFLFGKRSQTSTNKTTNKLSAVGVVEELFEEGSAMLAERLG-KDFPMNTNSGLFKCAVC  355

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGK  307
            QVD   +EG++V++G  FS +SKPW+GPFLCT+CR KKDAMEGK
Sbjct  356  QVDQPPAEGLTVNSGPFFSPASKPWEGPFLCTNCRKKKDAMEGK  399



>gb|KHG06373.1| hypothetical protein F383_32810 [Gossypium arboreum]
Length=428

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 82/107 (77%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +FRKKS     K + KLSA+G+VEELFEEGSA+LAERLG +D    + SG+F CAVC
Sbjct  317  SSILFRKKSLNFTNKTTNKLSAIGVVEELFEEGSAVLAERLG-KDFPTNANSGIFRCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   +EG+++ +G  FS  SK W+GPFLCT+C+ KKDAMEGKRPS
Sbjct  376  QVDQPPAEGLTLSSGPFFSQGSKRWEGPFLCTNCQKKKDAMEGKRPS  422



>ref|XP_003626183.1| hypothetical protein MTR_7g112430 [Medicago truncatula]
 gb|AES82401.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=428

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 80/110 (73%), Gaps = 10/110 (9%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSE---DSNGPSMSGLFIC  448
            ++  F KKS     K + KLSAVG+VEELFEEGSAML ERLG +   D N    S +F C
Sbjct  317  TTLFFGKKSENSTNKATSKLSAVGVVEELFEEGSAMLIERLGKDFPFDKN----SEIFRC  372

Query  447  AVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            A+CQVD     G+SV++G  FS +SKPW+GPFLCT+CRNKKDAMEGKRPS
Sbjct  373  AICQVDQPPGNGLSVNSGPFFSPASKPWEGPFLCTNCRNKKDAMEGKRPS  422



>ref|XP_008245693.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
 ref|XP_008245698.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
 ref|XP_008245707.1| PREDICTED: probable protein phosphatase 2C 5 [Prunus mume]
Length=428

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK--KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            +S IF KK+    +K  KLS+VG+VEELFEEGSAMLAERLG +DS   + SGLF CAVCQ
Sbjct  317  ASLIFGKKTRNSVNKRNKLSSVGVVEELFEEGSAMLAERLG-KDSTLDANSGLFRCAVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    EG+SV++G  FS +SKPW+G FLC  CRNKKDAMEGKR S
Sbjct  376  VDQPPVEGLSVNSGPFFSPASKPWEGLFLCAKCRNKKDAMEGKRLS  421



>ref|XP_002512477.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF49929.1| protein phosphatase, putative [Ricinus communis]
Length=436

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 4/106 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            +++F KK   S  K + KLSAVG+VEELFEEGSAMLAERLG +D    + SGL+ CAVCQ
Sbjct  326  TSLFGKKPLNSLNKTTNKLSAVGVVEELFEEGSAMLAERLG-KDFPSNTNSGLYRCAVCQ  384

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD   ++ +SV++ + FS  SKPW+GPFLC +CR KKDAMEGKRPS
Sbjct  385  VDQTPTDSLSVNSASFFSPGSKPWEGPFLCPNCRKKKDAMEGKRPS  430



>ref|XP_007205238.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
 gb|EMJ06437.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
Length=381

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK--KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            +S IF KK+    +K  KLS+VG+VEELFEEGSAMLAERLG +DS   + SGLF CAVCQ
Sbjct  271  ASLIFGKKTRNSVNKRNKLSSVGVVEELFEEGSAMLAERLG-KDSTLDANSGLFRCAVCQ  329

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    EG+SV++G  FS +SKPW+G FLC  CRNKKDAMEG+R S
Sbjct  330  VDQPPVEGLSVNSGPFFSPASKPWEGLFLCAKCRNKKDAMEGRRLS  375



>ref|XP_007205239.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
 gb|EMJ06438.1| hypothetical protein PRUPE_ppa006100mg [Prunus persica]
Length=427

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK--KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            +S IF KK+    +K  KLS+VG+VEELFEEGSAMLAERLG +DS   + SGLF CAVCQ
Sbjct  317  ASLIFGKKTRNSVNKRNKLSSVGVVEELFEEGSAMLAERLG-KDSTLDANSGLFRCAVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    EG+SV++G  FS +SKPW+G FLC  CRNKKDAMEG+R S
Sbjct  376  VDQPPVEGLSVNSGPFFSPASKPWEGLFLCAKCRNKKDAMEGRRLS  421



>emb|CDP17226.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            +S  F K+S     K S KLSAVG VEELFEEGSAMLAERLG +D    S SGLF CA+C
Sbjct  318  NSLFFGKRSENSMNKGSSKLSAVGAVEELFEEGSAMLAERLG-KDFPLNSNSGLFKCAIC  376

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD    +G+SV++G  FS  SKPW+GPFLC  CR KKDAMEGKRPS
Sbjct  377  QVDQQPGDGLSVNSGPFFSPGSKPWEGPFLCATCRKKKDAMEGKRPS  423



>ref|XP_008450571.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450572.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450573.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
 ref|XP_008450574.1| PREDICTED: probable protein phosphatase 2C 5 [Cucumis melo]
Length=428

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            ++ F KK   S  K + KLSAVG+VEELFEEGSAMLAERLG +  + P+ SG+F CAVCQ
Sbjct  318  TSFFGKKYPSSLGKSANKLSAVGVVEELFEEGSAMLAERLGKDFPSDPN-SGIFKCAVCQ  376

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
             D   +E +S+++G  FS SSKPW+GPFLC  CR KKDAMEGKRP
Sbjct  377  ADQPPNENLSMNSGPFFSPSSKPWEGPFLCATCRKKKDAMEGKRP  421



>ref|XP_004135583.1| PREDICTED: probable protein phosphatase 2C 5-like [Cucumis sativus]
 gb|KGN66026.1| hypothetical protein Csa_1G568550 [Cucumis sativus]
Length=428

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            ++ F KK   S  K + KLSAVG+VEELFEEGSAMLAERLG +  + P+ SG+F CAVCQ
Sbjct  318  TSFFGKKYPNSLGKSANKLSAVGVVEELFEEGSAMLAERLGKDFPSDPN-SGIFKCAVCQ  376

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
             D   +E +S+++G  FS SSKPW+GPFLC  CR KKDAMEGKRP
Sbjct  377  ADQPPNENLSMNSGPFFSPSSKPWEGPFLCATCRKKKDAMEGKRP  421



>ref|XP_009338205.1| PREDICTED: probable protein phosphatase 2C 5 [Pyrus x bretschneideri]
 ref|XP_009338206.1| PREDICTED: probable protein phosphatase 2C 5 [Pyrus x bretschneideri]
Length=427

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK--KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            +S IF KKS    +K  KLSA+G+VEELFEEGSAML ERLG +DS   + SG+F CAVCQ
Sbjct  317  ASLIFGKKSQNSVNKTNKLSAIGVVEELFEEGSAMLDERLG-KDSPVDANSGIFRCAVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            VD    EG+SV++G+ FS +SKPW+GPFLC  C+ KKDAMEGKR
Sbjct  376  VDQPPVEGLSVNSGSFFSPASKPWEGPFLCAKCQTKKDAMEGKR  419



>ref|XP_004494559.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Cicer arietinum]
 ref|XP_004494560.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Cicer arietinum]
Length=429

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            ++ +F KKS   + K + KLSAVG+VEELFEEGSAML ERLG +D      S +F CA+C
Sbjct  317  TTLLFGKKSDNSSNKATSKLSAVGVVEELFEEGSAMLIERLG-KDFPFNKNSEIFRCAIC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD     G+SV++G  FS +SKPW+GPFLCT+CR KKDAMEGKRPS
Sbjct  376  QVDQPPGNGLSVNSGPFFSPASKPWEGPFLCTNCRKKKDAMEGKRPS  422



>gb|EPS69183.1| hypothetical protein M569_05581, partial [Genlisea aurea]
Length=425

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 82/111 (74%), Gaps = 11/111 (10%)
 Frame = -1

Query  612  ASSTIFRKK---SATKPS-KKLSAVGIVEELFEEGSAMLAERLGSE---DSNGPSMSGLF  454
             SS +F K+   SATK S  +LSA+G+VEELFEEGSAMLAERLG +   DSN    SGLF
Sbjct  318  VSSFLFGKRGHDSATKGSANRLSAIGVVEELFEEGSAMLAERLGKDFPLDSN----SGLF  373

Query  453  ICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
             CA+CQ D    EG+SV++G  FS +SKPW+GPFLC  CR KKDAMEGK+P
Sbjct  374  RCAICQADQPPGEGLSVNSGPFFSPASKPWEGPFLCASCRRKKDAMEGKKP  424



>ref|XP_008370399.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
 ref|XP_008370400.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
Length=427

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (76%), Gaps = 3/104 (3%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK--KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            +S IF KKS    +K  KLSA+G+VEELFEEGSAML ERLG +DS   + SG+F CAVCQ
Sbjct  317  ASLIFGKKSQNSVNKTNKLSAIGVVEELFEEGSAMLDERLG-KDSPVDANSGIFRCAVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            VD    EG+SV++G  FS +SKPW+GPFLC  C+ KKDAMEGKR
Sbjct  376  VDQPPVEGLSVNSGPFFSPASKPWEGPFLCAKCQTKKDAMEGKR  419



>ref|XP_008388502.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
 ref|XP_008388503.1| PREDICTED: probable protein phosphatase 2C 5 [Malus domestica]
Length=427

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 79/104 (76%), Gaps = 3/104 (3%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK--KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            +S IF KK+    +K  KLSA+G+VEELFEEGSAML ERLG +DS   + SG+F CAVCQ
Sbjct  317  ASLIFGKKNQNSMNKTNKLSAIGVVEELFEEGSAMLDERLG-KDSPLNANSGIFRCAVCQ  375

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            VD    EG+SV++   FS +SKPW+GPFLC  C+NKKDAMEGKR
Sbjct  376  VDQPQVEGLSVNSAPFFSPASKPWEGPFLCAKCQNKKDAMEGKR  419



>ref|XP_010245443.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
 ref|XP_010245444.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
 ref|XP_010245446.1| PREDICTED: probable protein phosphatase 2C 5 [Nelumbo nucifera]
Length=428

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            +S IFRKKS     K + KLS+VG+VEELFEEGSAMLAERLG +D      SG F CA+C
Sbjct  318  TSLIFRKKSQNSINKLTNKLSSVGVVEELFEEGSAMLAERLG-KDFPLIKNSGQFKCAIC  376

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            QVD   S+ +S ++G+++S  SKPW+GPFLCT CR K DAMEGKRPS  KVA
Sbjct  377  QVDEPPSDVLS-NSGSLYSCPSKPWEGPFLCTTCRTKMDAMEGKRPSRPKVA  427



>ref|XP_006382433.1| hypothetical protein POPTR_0005s02110g [Populus trichocarpa]
 gb|ERP60230.1| hypothetical protein POPTR_0005s02110g [Populus trichocarpa]
Length=443

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = -1

Query  609  SSTIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KK   S +K + KLSAVG+VEELFEEGSA+LAERLG +D    + SG+  CAVC
Sbjct  332  SSLLFGKKALSSVSKSTNKLSAVGVVEELFEEGSAVLAERLG-KDFPVNTNSGIHRCAVC  390

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            QVD   ++G+SV++G+ FS  SKP +GPFLC++CR KKDAMEGKRPS   V
Sbjct  391  QVDQTPADGLSVNSGSFFSPGSKPCEGPFLCSNCRKKKDAMEGKRPSRTTV  441



>ref|XP_007163342.1| hypothetical protein PHAVU_001G226800g [Phaseolus vulgaris]
 gb|ESW35336.1| hypothetical protein PHAVU_001G226800g [Phaseolus vulgaris]
Length=429

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = -1

Query  591  KKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEG  412
            + S  K + KLSAVG+VEELFEEGSAML ERLG +D      SG+F CAVCQVD    + 
Sbjct  327  ENSVNKATNKLSAVGVVEELFEEGSAMLTERLG-KDFPLNKNSGIFRCAVCQVDQPPGDS  385

Query  411  ISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKV  286
            +SV++G  FS +S PW+GP LCT+CR KKDAMEGKRPS   V
Sbjct  386  LSVNSGPFFSPASNPWEGPLLCTNCRKKKDAMEGKRPSRTTV  427



>gb|ABK92834.1| unknown [Populus trichocarpa]
Length=113

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S++F KK   S +K +KKLSAVG VEELFEEGSA+LAERL S+     + SGL  CAVCQ
Sbjct  3    SSLFGKKALSSVSKSTKKLSAVGAVEELFEEGSAILAERL-SKYFPANANSGLCRCAVCQ  61

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    + +SV++G+ F+  SKPW+GPFLC++C+ KKDAMEGKR S
Sbjct  62   VDQTPGDSLSVNSGSFFTPGSKPWEGPFLCSNCQKKKDAMEGKRSS  107



>gb|ABR16488.1| unknown [Picea sitchensis]
Length=436

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 77/105 (73%), Gaps = 4/105 (4%)
 Frame = -1

Query  603  TIFRKKSATKPSK---KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQV  433
            ++FR+KS    SK   K   + IV+E+FEEGSAMLAERLGSE +   ++SGLF CAVCQ 
Sbjct  328  SLFRRKSTDSTSKTVEKQQNIDIVQEIFEEGSAMLAERLGSEYAVH-TVSGLFACAVCQT  386

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            D+  SEGISVHAG+ FS +   W+GPFLC  C+ KKDAMEGKR S
Sbjct  387  DITPSEGISVHAGSFFSGNMHSWEGPFLCASCKLKKDAMEGKRSS  431



>ref|XP_010528916.1| PREDICTED: probable protein phosphatase 2C 5 [Tarenaya hassleriana]
Length=422

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 79/107 (74%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKKSA---TKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KKS     K   KLSAVG+VEELFEEGSA+LAERLG +D    + +GL  CAVC
Sbjct  317  SSFLFGKKSKNFNVKTGNKLSAVGVVEELFEEGSAVLAERLG-KDMPSNTDTGLLKCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            Q D   +EG+S + GA+ S++SK W+GPFLCT C+ KKDAMEGKRP+
Sbjct  376  QADESHAEGLSTNGGALLSSASKQWEGPFLCTTCKKKKDAMEGKRPN  422



>ref|XP_003554626.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Glycine max]
 ref|XP_006604794.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Glycine max]
 gb|KHN43329.1| Hypothetical protein glysoja_001912 [Glycine soja]
Length=429

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = -1

Query  591  KKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEG  412
            + S  K + KLSAVG+VEELFEEGSAML ERLG +D      SG+F CAVCQ+D    +G
Sbjct  327  ENSMNKATNKLSAVGVVEELFEEGSAMLTERLG-KDFPLNKNSGIFRCAVCQMDQPPGDG  385

Query  411  ISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            +S+++G  FS +S PW+GPFLCT+C  KKDAMEGK+PS
Sbjct  386  LSMNSGPFFSPASNPWEGPFLCTNCWKKKDAMEGKKPS  423



>ref|XP_006604795.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X3 
[Glycine max]
Length=427

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = -1

Query  591  KKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEG  412
            + S  K + KLSAVG+VEELFEEGSAML ERLG +D      SG+F CAVCQ+D    +G
Sbjct  325  ENSMNKATNKLSAVGVVEELFEEGSAMLTERLG-KDFPLNKNSGIFRCAVCQMDQPPGDG  383

Query  411  ISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            +S+++G  FS +S PW+GPFLCT+C  KKDAMEGK+PS
Sbjct  384  LSMNSGPFFSPASNPWEGPFLCTNCWKKKDAMEGKKPS  421



>ref|XP_011036917.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Populus 
euphratica]
Length=437

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KK   S +K + KLSAVG+VEELFEEGSA+LAERLG +D    + SG+  CAVC
Sbjct  326  SSLLFGKKALNSVSKSTNKLSAVGLVEELFEEGSAVLAERLG-KDFPVNTNSGIHRCAVC  384

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   ++G+SV++G+ FS  SKP  G FLC++CR KKDAMEGKRPS
Sbjct  385  QVDQTPADGLSVNSGSFFSPGSKPCDGLFLCSNCRKKKDAMEGKRPS  431



>ref|XP_011036918.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Populus 
euphratica]
Length=428

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KK   S +K + KLSAVG+VEELFEEGSA+LAERLG +D    + SG+  CAVC
Sbjct  317  SSLLFGKKALNSVSKSTNKLSAVGLVEELFEEGSAVLAERLG-KDFPVNTNSGIHRCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   ++G+SV++G+ FS  SKP  G FLC++CR KKDAMEGKRPS
Sbjct  376  QVDQTPADGLSVNSGSFFSPGSKPCDGLFLCSNCRKKKDAMEGKRPS  422



>emb|CDX95002.1| BnaC05g06690D [Brassica napus]
Length=329

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -1

Query  576  KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEGISVHA  397
            K   KLS VG+VEELFEEGSA+LA+RLG +D    + +GL  CAVCQ+D   +EG+S + 
Sbjct  232  KNGNKLSYVGVVEELFEEGSAVLADRLG-KDLLSNTDTGLLKCAVCQIDQSPAEGLSSNE  290

Query  396  GAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            G I S++SK W+GPFLCT C+ KKDAMEGKRPS V V 
Sbjct  291  GPIVSSASKRWEGPFLCTICKKKKDAMEGKRPSKVSVT  328



>ref|XP_004495681.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X2 
[Cicer arietinum]
Length=331

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 4/105 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KKS     K + KLSA+G+VEELFEEGSAML ERLG +D      SG+F CAVC
Sbjct  227  SSLLFGKKSQNTTNKGTNKLSAIGVVEELFEEGSAMLTERLG-KDVPSNMNSGIFRCAVC  285

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
              D  +S+G+S +   I +  SKPW+GPFLCT+C+ KKDAMEGKR
Sbjct  286  LADQPSSDGLSANTDHIITPVSKPWEGPFLCTNCQKKKDAMEGKR  330



>ref|XP_007144975.1| hypothetical protein PHAVU_007G199100g [Phaseolus vulgaris]
 gb|ESW16969.1| hypothetical protein PHAVU_007G199100g [Phaseolus vulgaris]
Length=429

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 5/108 (5%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            +S +F KKS     K + KLSAVG+VEELFEEGSAML ERLG +D    + SG F CAVC
Sbjct  317  TSLLFGKKSKNSTNKSTNKLSAVGVVEELFEEGSAMLTERLG-KDFPSNTNSGTFRCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTS-SKPWQGPFLCTDCRNKKDAMEGKRPS  298
            Q D  + +G+SV+ G+ FS   SKPW+GP LCT+C+ KKDAMEGKR S
Sbjct  376  QADQPSVDGLSVNTGSFFSPPVSKPWEGPLLCTNCQKKKDAMEGKRSS  423



>ref|XP_010259436.1| PREDICTED: probable protein phosphatase 2C 5 isoform X3 [Nelumbo 
nucifera]
Length=339

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 10/113 (9%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS IF K+S     K + KLS+VG+VEELFEEGSAML+ERLG +D    + SG F CA+C
Sbjct  225  SSFIFGKRSQNSINKLTNKLSSVGVVEELFEEGSAMLSERLG-KDFPQKTNSGQFRCAIC  283

Query  438  QVDLGASEGISV------HAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QVD   ++G  V      ++G+ +S +SKPW+GPFLCT CR K DAMEGKRPS
Sbjct  284  QVDEPPTDGSEVQSAKCANSGSFYSPTSKPWEGPFLCTSCRTKMDAMEGKRPS  336



>ref|XP_004495680.1| PREDICTED: probable protein phosphatase 2C 5-like isoform X1 
[Cicer arietinum]
Length=423

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 4/105 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KKS     K + KLSA+G+VEELFEEGSAML ERLG +D      SG+F CAVC
Sbjct  319  SSLLFGKKSQNTTNKGTNKLSAIGVVEELFEEGSAMLTERLG-KDVPSNMNSGIFRCAVC  377

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
              D  +S+G+S +   I +  SKPW+GPFLCT+C+ KKDAMEGKR
Sbjct  378  LADQPSSDGLSANTDHIITPVSKPWEGPFLCTNCQKKKDAMEGKR  422



>ref|XP_010259431.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259432.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259433.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Nelumbo 
nucifera]
Length=432

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 81/116 (70%), Gaps = 10/116 (9%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS IF K+S     K + KLS+VG+VEELFEEGSAML+ERLG +D    + SG F CA+C
Sbjct  318  SSFIFGKRSQNSINKLTNKLSSVGVVEELFEEGSAMLSERLG-KDFPQKTNSGQFRCAIC  376

Query  438  QVDLGASEGISV------HAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVK  289
            QVD   ++G  V      ++G+ +S +SKPW+GPFLCT CR K DAMEGKRPS  K
Sbjct  377  QVDEPPTDGSEVQSAKCANSGSFYSPTSKPWEGPFLCTSCRTKMDAMEGKRPSQPK  432



>ref|XP_002318970.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE94893.1| phosphatase 2C family protein [Populus trichocarpa]
Length=436

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S++F KK   S +K +KKLSAVG VEELFEEGSA+LAERL S+     + SGL  CAVCQ
Sbjct  326  SSLFGKKALSSVSKSTKKLSAVGAVEELFEEGSAILAERL-SKYFPANANSGLCRCAVCQ  384

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    + +SV++G+ F+  SKPW+GPFLC++C+ KKDAMEGKR S
Sbjct  385  VDQTPGDSLSVNSGSFFTPGSKPWEGPFLCSNCQKKKDAMEGKRSS  430



>ref|XP_006434797.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 ref|XP_006434798.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48037.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
 gb|ESR48038.1| hypothetical protein CICLE_v10001232mg [Citrus clementina]
Length=429

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
             +FR+KS   ++   ++     +VEELFEEGSAML+ERL   D+  P  +M  LF+CA+C
Sbjct  317  NMFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAIC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG+ +S   +PW GPFLC  C+ KKDAMEGKRPSG
Sbjct  374  QVEMKPEEGISIHAGSTYSGKLRPWDGPFLCLSCQEKKDAMEGKRPSG  421



>ref|XP_006473344.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X3 
[Citrus sinensis]
Length=429

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
             +FR+KS   ++   ++     +VEELFEEGSAML+ERL   D+  P  +M  LF+CA+C
Sbjct  317  NMFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAIC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG+ +S   +PW GPFLC  C+ KKDAMEGKRPSG
Sbjct  374  QVEMKPEEGISIHAGSTYSGKLRPWDGPFLCLSCQEKKDAMEGKRPSG  421



>gb|KDO84217.1| hypothetical protein CISIN_1g045195mg, partial [Citrus sinensis]
Length=411

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
             +FR+KS   ++   ++     +VEELFEEGSAML+ERL   D+  P  +M  LF+CA+C
Sbjct  307  NMFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAIC  363

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG+ +S   +PW GPFLC  C+ KKDAMEGKRPSG
Sbjct  364  QVEMKPEEGISIHAGSTYSGKLRPWDGPFLCLSCQEKKDAMEGKRPSG  411



>ref|XP_006473342.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Citrus sinensis]
 ref|XP_006473343.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Citrus sinensis]
Length=432

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
             +FR+KS   ++   ++     +VEELFEEGSAML+ERL   D+  P  +M  LF+CA+C
Sbjct  317  NMFRRKSPESSSNTDREYVEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAIC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG+ +S   +PW GPFLC  C+ KKDAMEGKRPSG
Sbjct  374  QVEMKPEEGISIHAGSTYSGKLRPWDGPFLCLSCQEKKDAMEGKRPSG  421



>gb|KEH43094.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=331

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 8/107 (7%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPS--MSGLFICA  445
            SS +F KKS   A K + KLSAVG+VEELFEEGSAML ERLG+   N PS   SG+  CA
Sbjct  227  SSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSAMLTERLGN---NVPSDTNSGIHRCA  283

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            VC  D  + +G+SV+     +  SKPW+GPFLCT+C+ KKDAMEGKR
Sbjct  284  VCLADQPSGDGLSVNNDHFITPVSKPWEGPFLCTNCQKKKDAMEGKR  330



>ref|XP_003591191.1| hypothetical protein MTR_1g083750 [Medicago truncatula]
 gb|AES61442.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=423

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 8/107 (7%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPS--MSGLFICA  445
            SS +F KKS   A K + KLSAVG+VEELFEEGSAML ERLG+   N PS   SG+  CA
Sbjct  319  SSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSAMLTERLGN---NVPSDTNSGIHRCA  375

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            VC  D  + +G+SV+     +  SKPW+GPFLCT+C+ KKDAMEGKR
Sbjct  376  VCLADQPSGDGLSVNNDHFITPVSKPWEGPFLCTNCQKKKDAMEGKR  422



>gb|KHN16084.1| Hypothetical protein glysoja_012060 [Glycine soja]
Length=428

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 4/105 (4%)
 Frame = -1

Query  609  SSTIFRKKSATKPSK---KLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            +S +F KKS    +K   KLSAVG+VEELFEEGSAML ERLG +D    S  G+F CAVC
Sbjct  317  TSLLFGKKSPNSTNKGNNKLSAVGVVEELFEEGSAMLTERLG-KDFPSNSNPGIFRCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            Q D  + + +S++ G+ F   SKPW+G FLCT+C+ KKDAMEGKR
Sbjct  376  QADQPSVDSVSMNTGSFFPPVSKPWEGLFLCTNCQKKKDAMEGKR  420



>ref|XP_004157232.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 5-like [Cucumis sativus]
Length=428

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 4/105 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            ++ F KK   S  K + KLSAVG+VEELFEEGSAMLAERLG +  + P+ SG+F CAVCQ
Sbjct  318  TSFFGKKYPNSLGKSANKLSAVGVVEELFEEGSAMLAERLGKDFPSDPN-SGIFKCAVCQ  376

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
             D   +E +S+++G  FS SSKPW+GPFLC  CR +K   + KRP
Sbjct  377  ADQPPNENLSMNSGPFFSPSSKPWEGPFLCATCRKRKTPWKXKRP  421



>gb|KHN20267.1| Hypothetical protein glysoja_023830 [Glycine soja]
Length=428

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 4/105 (4%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            +S +F KKS     K + KLSAVG+VEELFEEGSAML ERLG +D    +   +F CAVC
Sbjct  317  TSLLFGKKSQNSTNKGTNKLSAVGVVEELFEEGSAMLTERLG-KDFPSNTNPEIFRCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            Q D  + + +S++ G  F   SKPW+GPFLCT+C+ KKDAMEGKR
Sbjct  376  QADQPSVDSLSMNTGPFFPPVSKPWEGPFLCTNCQKKKDAMEGKR  420



>ref|XP_010938321.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=433

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 8/114 (7%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICA  445
            +S +F +KS   A K + KLS+VG+VEELFEEGSA+L ERLG    N P  + SG F CA
Sbjct  322  TSLLFGRKSQNTAGKHTNKLSSVGVVEELFEEGSAILEERLGK---NFPLKANSGPFRCA  378

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            +CQVD   +EG+S   G+ FS +SKP +GP+LC +CR KKDAMEGKR S   V+
Sbjct  379  ICQVDQTPNEGLSATVGSYFSPTSKPQEGPYLCVECRRKKDAMEGKRRSRTTVS  432



>ref|XP_010553723.1| PREDICTED: probable protein phosphatase 2C 5 [Tarenaya hassleriana]
Length=429

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            SS +F KK      K   KLSAVG+VEELFEEGSA+LAERLG +D    + +GL  CAVC
Sbjct  319  SSFLFGKKPKNVNNKTGNKLSAVGVVEELFEEGSAVLAERLG-KDIPSNTDTGLLKCAVC  377

Query  438  QVDLGASEGISVHAG-AIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
            Q D   +EG+S+  G A+  ++SK W+GPFLCT+C+ KKDAMEGKRP
Sbjct  378  QADESPAEGLSIDGGGALLLSASKRWEGPFLCTNCKKKKDAMEGKRP  424



>gb|ACJ83645.1| unknown [Medicago truncatula]
Length=165

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 8/107 (7%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPS--MSGLFICA  445
            SS +F KKS   A K + KLSAVG+VEELFEEGSAML ERLG+   N PS   SG+  CA
Sbjct  61   SSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSAMLTERLGN---NVPSDTNSGIHRCA  117

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            VC  D  + +G+SV+     +   KPW+GPFLCT+C+ KKDAM GKR
Sbjct  118  VCLADQPSGDGLSVNNDHFITPVFKPWEGPFLCTNCQKKKDAMGGKR  164



>ref|XP_011023738.1| PREDICTED: probable protein phosphatase 2C 5 isoform X3 [Populus 
euphratica]
Length=428

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S++F KK   S +K +KKLSAVG+VEELFEEGSA+LAERL S+     + SGL  CAVCQ
Sbjct  318  SSLFGKKALSSVSKSTKKLSAVGVVEELFEEGSAILAERL-SKYFPANANSGLCRCAVCQ  376

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    + +SV++G+ FS  SKP +GPFLC++C+ KKDAMEGKR S
Sbjct  377  VDQTPGDSLSVNSGSFFSPGSKPREGPFLCSNCQKKKDAMEGKRSS  422



>ref|XP_011023736.1| PREDICTED: probable protein phosphatase 2C 5 isoform X1 [Populus 
euphratica]
Length=437

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S++F KK   S +K +KKLSAVG+VEELFEEGSA+LAERL S+     + SGL  CAVCQ
Sbjct  327  SSLFGKKALSSVSKSTKKLSAVGVVEELFEEGSAILAERL-SKYFPANANSGLCRCAVCQ  385

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    + +SV++G+ FS  SKP +GPFLC++C+ KKDAMEGKR S
Sbjct  386  VDQTPGDSLSVNSGSFFSPGSKPREGPFLCSNCQKKKDAMEGKRSS  431



>ref|XP_011023737.1| PREDICTED: probable protein phosphatase 2C 5 isoform X2 [Populus 
euphratica]
Length=436

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = -1

Query  606  STIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S++F KK   S +K +KKLSAVG+VEELFEEGSA+LAERL S+     + SGL  CAVCQ
Sbjct  326  SSLFGKKALSSVSKSTKKLSAVGVVEELFEEGSAILAERL-SKYFPANANSGLCRCAVCQ  384

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VD    + +SV++G+ FS  SKP +GPFLC++C+ KKDAMEGKR S
Sbjct  385  VDQTPGDSLSVNSGSFFSPGSKPREGPFLCSNCQKKKDAMEGKRSS  430



>gb|AIZ68189.1| putative protein phosphatase 2C 33 [Ornithogalum saundersiae]
Length=432

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 72/102 (71%), Gaps = 5/102 (5%)
 Frame = -1

Query  597  FRKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSM--SGLFICAVCQVDLG  424
             R +++ K   KLS+VG VEELFEEGSAML ERLG+   N PS   S  F CA+CQ D  
Sbjct  325  LRSQNSAKHPNKLSSVGSVEELFEEGSAMLEERLGT---NFPSKANSSPFRCAICQTDQA  381

Query  423  ASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
             +EG+S   G+ FS+S K W+GP+LCT+CR KKDAMEGKR S
Sbjct  382  PNEGLSATTGSFFSSSPKSWEGPYLCTECRKKKDAMEGKRSS  423



>gb|KCW60535.1| hypothetical protein EUGRSUZ_H03276 [Eucalyptus grandis]
Length=415

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = -1

Query  594  RKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASE  415
            + +S  K + KLSAVG VEELFEEGSAMLAERLG +  +  S  G F CAVCQVD   ++
Sbjct  312  KSQSVNKATSKLSAVGAVEELFEEGSAMLAERLGKDFPSNQS-PGTFKCAVCQVDQPPAD  370

Query  414  GISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
             ++ ++G+ FS +SK  +GPFLCT CR KKDAMEGK+PS   VA
Sbjct  371  NLTANSGSFFSPTSKSGEGPFLCTICRKKKDAMEGKKPSRSLVA  414



>ref|XP_010024104.1| PREDICTED: probable protein phosphatase 2C 5 [Eucalyptus grandis]
Length=427

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = -1

Query  594  RKKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASE  415
            + +S  K + KLSAVG VEELFEEGSAMLAERLG +  +  S  G F CAVCQVD   ++
Sbjct  324  KSQSVNKATSKLSAVGAVEELFEEGSAMLAERLGKDFPSNQS-PGTFKCAVCQVDQPPAD  382

Query  414  GISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
             ++ ++G+ FS +SK  +GPFLCT CR KKDAMEGK+PS   VA
Sbjct  383  NLTANSGSFFSPTSKSGEGPFLCTICRKKKDAMEGKKPSRSLVA  426



>ref|XP_010905680.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
 ref|XP_010905681.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=455

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 76/109 (70%), Gaps = 8/109 (7%)
 Frame = -1

Query  609  SSTIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICA  445
            +S +F KK   +A K + KLS+VG VEELFEEGSA+L ERLG    N P  + S  F CA
Sbjct  340  TSLLFGKKLQNTAGKHTNKLSSVGAVEELFEEGSAILEERLGK---NFPLKANSSPFRCA  396

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            +CQ+D   SEG+S  AG  FS  SKPW+GP+LC +CR KKDAMEGKR S
Sbjct  397  ICQMDQPRSEGLSAIAGTYFSPPSKPWEGPYLCVECRRKKDAMEGKRLS  445



>gb|KDP38368.1| hypothetical protein JCGZ_04293 [Jatropha curcas]
Length=430

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FR+KS+   S   K+     +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  317  SMFRRKSSESSSHVGKEHVEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            Q+++   EGIS+HAG+  S   +PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  374  QMEMKPEEGISIHAGSTDSRKLRPWDGPFLCSSCQEKKEAMEGKRPSG  421



>ref|XP_002510242.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF52429.1| protein phosphatase, putative [Ricinus communis]
Length=425

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FR+KS+   S   K+ +   +VEELFEEGSAMLAERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFRRKSSESSSQVDKEYTEPDVVEELFEEGSAMLAERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H GA  S   +PW GPFLC+ C+ K++AMEGK PSG
Sbjct  373  QVEMKPEEGISIHVGAANSRKLRPWDGPFLCSSCQEKREAMEGKIPSG  420



>gb|ABD28356.2| Protein phosphatase 2C-like [Medicago truncatula]
Length=440

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 10/107 (9%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSE---DSNGPSMSGLFIC  448
            SS +F KKS   A K + KLSAVG+VEELFEEGSAML ERLG+    D+N    SG+  C
Sbjct  319  SSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSAMLTERLGNNVPSDTN----SGIHRC  374

Query  447  AVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGK  307
            AVC  D  + +G+SV+     +  SKPW+GPFLCT+C+ KKDAMEGK
Sbjct  375  AVCLADQPSGDGLSVNNDHFITPVSKPWEGPFLCTNCQKKKDAMEGK  421



>emb|CDP01349.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S++   K+ S   +VEELFEEGSA L+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFRKKPSESSSHTGKEFSEPDVVEELFEEGSASLSERL---DTKYPVCNMFKLFVCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H G+  S   +PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  373  QVEIKPGEGISIHVGSKNSRKLRPWDGPFLCSSCQEKKEAMEGKRPSG  420



>ref|XP_006417602.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 ref|XP_006417603.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 dbj|BAJ34364.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35955.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
 gb|ESQ35956.1| hypothetical protein EUTSA_v10007698mg [Eutrema salsugineum]
Length=428

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -1

Query  609  SSTIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVC  439
            +S + RKK   +  K   KLS+VG+VEELFEEGSA+LA+RLG +D    + +GL  CAVC
Sbjct  317  TSFLSRKKQTDTNNKNGNKLSSVGVVEELFEEGSAVLADRLG-KDLPSNTDTGLLKCAVC  375

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            Q+D   +E +    G I S++SK W+GPFLCT C+ KKDAMEGKRPS
Sbjct  376  QIDQSPAEDLLSDEGPIISSASKRWEGPFLCTICKKKKDAMEGKRPS  422



>ref|XP_007017285.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY14510.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=428

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 8/107 (7%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +FRKK   S+++  K+     +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVCQ
Sbjct  317  MFRKKPSESSSQVDKEYMEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVCQ  373

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            +++   EGIS+HAG+  +   +PW GPFLC+ C+ KK+AMEGKRP+G
Sbjct  374  LEMKPGEGISIHAGSSNAVKLRPWDGPFLCSSCQEKKEAMEGKRPTG  420



>ref|XP_009764893.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Nicotiana 
sylvestris]
Length=409

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKK   S++   +      +VEELFEEGSA L++RL   D+  P  +M  LF+CAVC
Sbjct  296  SIFRKKTSESSSNTERDYDEPDVVEELFEEGSASLSDRL---DAKYPVCNMFKLFMCAVC  352

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG++ + + +PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  353  QVEIKPGEGISIHAGSLNTRNVRPWDGPFLCSSCQVKKEAMEGKRPSG  400



>ref|XP_009764892.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Nicotiana 
sylvestris]
Length=429

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKK   S++   +      +VEELFEEGSA L++RL   D+  P  +M  LF+CAVC
Sbjct  316  SIFRKKTSESSSNTERDYDEPDVVEELFEEGSASLSDRL---DAKYPVCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG++ + + +PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  373  QVEIKPGEGISIHAGSLNTRNVRPWDGPFLCSSCQVKKEAMEGKRPSG  420



>ref|XP_009610734.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Nicotiana 
tomentosiformis]
Length=429

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 78/108 (72%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRK   +S++   +      +VEELFEEGSA L++RL   D+  P  +M  LF+CAVC
Sbjct  316  SIFRKITSESSSNTERDYDEPDVVEELFEEGSASLSDRL---DTKYPVCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG++ + +++PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  373  QVEIKPGEGISIHAGSLNTRNARPWDGPFLCSSCQVKKEAMEGKRPSG  420



>ref|XP_007017286.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY14511.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=439

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 8/107 (7%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +FRKK   S+++  K+     +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVCQ
Sbjct  317  MFRKKPSESSSQVDKEYMEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVCQ  373

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            +++   EGIS+HAG+  +   +PW GPFLC+ C+ KK+AMEGKRP+G
Sbjct  374  LEMKPGEGISIHAGSSNAVKLRPWDGPFLCSSCQEKKEAMEGKRPTG  420



>ref|XP_009610735.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Nicotiana 
tomentosiformis]
Length=409

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 78/108 (72%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRK---KSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRK   +S++   +      +VEELFEEGSA L++RL   D+  P  +M  LF+CAVC
Sbjct  296  SIFRKITSESSSNTERDYDEPDVVEELFEEGSASLSDRL---DTKYPVCNMFKLFMCAVC  352

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG++ + +++PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  353  QVEIKPGEGISIHAGSLNTRNARPWDGPFLCSSCQVKKEAMEGKRPSG  400



>ref|XP_011074446.1| PREDICTED: probable protein phosphatase 2C 12 [Sesamum indicum]
Length=431

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = -1

Query  603  TIFRKKSATKPSK----KLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAV  442
            ++FRKK +   S+    + S   +VEELFEEGSA L+ERL   DS  P  +M  LF+CAV
Sbjct  317  SMFRKKHSESSSQVDKEEYSEPDVVEELFEEGSASLSERL---DSKYPVCNMFKLFMCAV  373

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            CQV++   EGIS+HAG      S+PW GPFLC+ C+ KK+AMEG+RPSG
Sbjct  374  CQVEIKPGEGISIHAGTADPRKSRPWDGPFLCSSCQEKKEAMEGRRPSG  422



>emb|CDY31109.1| BnaA08g26590D [Brassica napus]
Length=427

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = -1

Query  576  KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEGISVHA  397
            K   KLS+VG VEELFEEGSAMLA+RLG +D    + +GL  CAVCQVD   +E +S + 
Sbjct  331  KNGNKLSSVG-VEELFEEGSAMLADRLG-KDLPSNTDTGLLKCAVCQVDQSPAEALSSNE  388

Query  396  GAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            G+I S++SK W+GPFLCT C+ KKDAMEGKRPS
Sbjct  389  GSIISSASKRWEGPFLCTVCKKKKDAMEGKRPS  421



>ref|XP_009110849.1| PREDICTED: probable protein phosphatase 2C 5 [Brassica rapa]
 ref|XP_009110850.1| PREDICTED: probable protein phosphatase 2C 5 [Brassica rapa]
Length=427

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = -1

Query  576  KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEGISVHA  397
            K   KLS+VG VEELFEEGSAMLA+RLG +D    + +GL  CAVCQVD   +E +S + 
Sbjct  331  KNGNKLSSVG-VEELFEEGSAMLADRLG-KDLPSNTDTGLLKCAVCQVDQSPAEALSSNE  388

Query  396  GAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            G+I S++SK W+GPFLCT C+ KKDAMEGKRPS
Sbjct  389  GSIISSASKRWEGPFLCTVCKKKKDAMEGKRPS  421



>ref|XP_008795536.1| PREDICTED: probable protein phosphatase 2C 33 [Phoenix dactylifera]
Length=433

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 8/109 (7%)
 Frame = -1

Query  609  SSTIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICA  445
            +S +F +K   +A K + KLS+VG+VEELFEEGSA+L ERLG    N P  + S  F CA
Sbjct  322  TSLLFGRKLRNTAGKHANKLSSVGVVEELFEEGSAILEERLGK---NFPLKANSAPFRCA  378

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            +CQ+D   +EG+S  AG+ FS +SKP +GP+LC +CR KKDAMEGKR S
Sbjct  379  ICQMDQTPNEGLSATAGSYFSPTSKPLEGPYLCVECRRKKDAMEGKRRS  427



>ref|XP_011030187.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
Length=429

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FR+KS+   S   K+     +VEEL+EEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  317  SMFRRKSSESSSQIDKEYLEPDVVEELYEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGISVHAG+      +PW GPFLC  C+ KK+AMEGKRPSG
Sbjct  374  QVEIKPDEGISVHAGSSDFGKLRPWDGPFLCLSCQEKKEAMEGKRPSG  421



>ref|XP_001757865.1| predicted protein [Physcomitrella patens]
 gb|EDQ77505.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 79/109 (72%), Gaps = 8/109 (7%)
 Frame = -1

Query  606  STIFR----KKSATKPSK-KLSAVGIVEELFEEGSAMLAERLGSEDS-NGPSMSGLFICA  445
            STI+R    K+    PS+     + ++EELFEEGSAML+ERLG   S NG +  G+F+CA
Sbjct  302  STIYRMFHWKQKQPPPSQPAYDEIPVMEELFEEGSAMLSERLGPGASVNGGN--GMFLCA  359

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            +CQ D+ A++GISVHAGA F++ S+P  GPFLC  C+ K++AMEGK+PS
Sbjct  360  ICQCDIEANDGISVHAGAFFASKSRPLDGPFLCRSCKWKQEAMEGKQPS  408



>emb|CDY25665.1| BnaC05g25440D [Brassica napus]
Length=111

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 8/104 (8%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +F++K   S++   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVCQ
Sbjct  1    MFKRKGSDSSSNIEKEYAEPDLVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVCQ  57

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            V++   EG+S+HAG       +PW GPFLC  C+ KKDAMEGKR
Sbjct  58   VEVKPGEGVSIHAGTANCRKLRPWDGPFLCASCQEKKDAMEGKR  101



>ref|XP_006393585.1| hypothetical protein EUTSA_v10011502mg [Eutrema salsugineum]
 dbj|BAJ34367.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30871.1| hypothetical protein EUTSA_v10011502mg [Eutrema salsugineum]
Length=428

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSSNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>ref|XP_010092060.1| putative protein phosphatase 2C 12 [Morus notabilis]
 gb|EXB50007.1| putative protein phosphatase 2C 12 [Morus notabilis]
Length=460

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKKS    S   K+     +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFRKKSNESSSYIDKEYIEPDMVEELFEEGSAMLSERL---DTKYPLCNMFRLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGV  292
            QV++   EGIS+HAG+      +PW GPFLC  C+ KK+AMEGKR SGV
Sbjct  373  QVEMKPGEGISIHAGSSHPGKLRPWDGPFLCLSCQEKKEAMEGKRQSGV  421



>ref|XP_006307584.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
 gb|EOA40482.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
Length=428

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>ref|XP_009781091.1| PREDICTED: probable protein phosphatase 2C 12 [Nicotiana sylvestris]
Length=426

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+++   S   K      +VEELFEEGSA L++RL   D+  P  +M  LFICAVC
Sbjct  315  SMFRKRTSASSSDIQKDFCEPDVVEELFEEGSASLSDRL---DAKYPVCNMFKLFICAVC  371

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   +G+S+HAG+  +  S+PW GPFLC+ C+ KKDAMEGKRP G
Sbjct  372  QVEIKPGQGVSIHAGSSNTRHSRPWDGPFLCSSCQEKKDAMEGKRPFG  419



>ref|XP_010519103.1| PREDICTED: probable protein phosphatase 2C 12 [Tarenaya hassleriana]
Length=428

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K++   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C+ KK+AMEGKRPSG
Sbjct  373  QVEVKPGEGVSIHAGSSDCRKLRPWDGPFLCVSCQEKKEAMEGKRPSG  420



>ref|XP_006307585.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
 gb|EOA40483.1| hypothetical protein CARUB_v10009209mg [Capsella rubella]
Length=423

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>ref|XP_007160841.1| hypothetical protein PHAVU_001G021200g [Phaseolus vulgaris]
 gb|ESW32835.1| hypothetical protein PHAVU_001G021200g [Phaseolus vulgaris]
Length=427

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKKS+   S   K+ +   +VEEL+EEGSAML+ER    D+  P  +M  LF+CAVC
Sbjct  315  SMFRKKSSESSSCHDKEYAEPDVVEELYEEGSAMLSERF---DTKYPVCNMFKLFMCAVC  371

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H GA  ST  +PW GPFLC+ C+ KK+AMEGKR  G
Sbjct  372  QVEIKPGEGISIHEGASNSTKFRPWDGPFLCSSCQEKKEAMEGKRSLG  419



>ref|XP_004238165.1| PREDICTED: probable protein phosphatase 2C 12 [Solanum lycopersicum]
Length=428

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S++   K      +VEELFEEGSA L++RL   D+  P  +M  LFICAVC
Sbjct  317  SMFRKKTSESSSNIQKDFCEPDVVEELFEEGSASLSDRL---DAKYPVCNMFKLFICAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   +G+S+HAG+  + SS+PW GPFLC+ C+ KK+AMEG+RP G
Sbjct  374  QVEIKPGQGVSIHAGSSNTRSSRPWDGPFLCSSCQEKKEAMEGRRPFG  421



>ref|XP_010500262.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
Length=428

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K++   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>emb|CDY17840.1| BnaC08g04540D [Brassica napus]
Length=428

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C+ KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSANFPKLRPWDGPFLCASCQEKKDAMEGKRSSG  420



>ref|XP_002894042.1| hypothetical protein ARALYDRAFT_473885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70301.1| hypothetical protein ARALYDRAFT_473885 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K++   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>gb|AAK92805.1| unknown protein [Arabidopsis thaliana]
Length=428

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K++   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>ref|NP_564504.1| putative protein phosphatase 2C 12 [Arabidopsis thaliana]
 sp|Q9FX08.1|P2C12_ARATH RecName: Full=Probable protein phosphatase 2C 12; Short=AtPP2C12 
[Arabidopsis thaliana]
 gb|AAG11427.1|AC015449_9 Unknown protein [Arabidopsis thaliana]
 gb|AAN12997.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32161.1| putative protein phosphatase 2C 12 [Arabidopsis thaliana]
Length=428

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K++   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>ref|XP_002302440.2| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE81713.2| phosphatase 2C family protein [Populus trichocarpa]
Length=429

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+S   +++  K+     +VEELFEEGSAML+ERL   D+  P   M  LFICAVC
Sbjct  317  SMFRKRSPESSSQIDKEYLEPDVVEELFEEGSAMLSERL---DTKYPLCKMFKLFICAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H G+      +PW GPFLC+ C+ KK+AMEGKRP G
Sbjct  374  QVEIKPDEGISIHVGSSDFGKLRPWDGPFLCSSCQEKKEAMEGKRPPG  421



>ref|XP_010539072.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Tarenaya 
hassleriana]
Length=425

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K   S +   K+     +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSCSNIDKEYEEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC+ C+ KK+AMEGKRP+G
Sbjct  373  QVEVKPGEGVSIHAGSSVCRKLRPWDGPFLCSSCQEKKEAMEGKRPTG  420



>ref|XP_009620218.1| PREDICTED: probable protein phosphatase 2C 12 [Nicotiana tomentosiformis]
Length=426

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+++   S   K      +VEELFEEGSA L++RL   D+  P  +M  LFICA+C
Sbjct  315  SMFRKRTSASSSDIQKDFCEPDVVEELFEEGSASLSDRL---DAKYPVCNMFKLFICAIC  371

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   +G+S+HAG+  +  S+PW GPFLC+ C+ KKDAMEGKRP G
Sbjct  372  QVEIKPGQGVSIHAGSSKTRYSRPWDGPFLCSSCQEKKDAMEGKRPFG  419



>ref|XP_011017216.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
 ref|XP_011017217.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
 ref|XP_011017218.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
Length=429

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+S   +++  K+     +VEELFEEGSAML+ERL   D+  P   M  LFICAVC
Sbjct  317  SMFRKRSPESSSQIDKEYLEPDVVEELFEEGSAMLSERL---DTKYPLCKMFKLFICAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H G+      +PW GPFLC+ C+ KK+AMEGKRP G
Sbjct  374  QVEIKPDEGISIHVGSSDFGKLRPWDGPFLCSSCQEKKEAMEGKRPPG  421



>ref|XP_011016491.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
 ref|XP_011016492.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
 ref|XP_011016493.1| PREDICTED: probable protein phosphatase 2C 12 [Populus euphratica]
Length=429

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+S   +++  K+     +VEELFEEGSAML+ERL   D+  P   M  LFICAVC
Sbjct  317  SMFRKRSPESSSQIDKEYLEPDVVEELFEEGSAMLSERL---DTKYPLCKMFKLFICAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H G+      +PW GPFLC+ C+ KK+AMEGKRP G
Sbjct  374  QVEIKPDEGISIHVGSSDFGKLRPWDGPFLCSSCQEKKEAMEGKRPPG  421



>gb|KJB58458.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=428

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 4/109 (4%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKK   ++++  K+     +VEELFEEGSAML+ER  ++     +M  LF CAVCQ++
Sbjct  317  MFRKKHSEASSQSDKEYMEPDVVEELFEEGSAMLSERFATKYPLC-NMFKLFTCAVCQLE  375

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            +   EGIS+HAG   S   +PW GPFLC+ C+ KK+AMEGKRPSG  V 
Sbjct  376  MKPGEGISIHAGTSNSVKLRPWDGPFLCSTCQEKKEAMEGKRPSGNMVV  424



>ref|XP_010539071.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Tarenaya 
hassleriana]
Length=454

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K   S +   K+     +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSCSNIDKEYEEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC+ C+ KK+AMEGKRP+G
Sbjct  373  QVEVKPGEGVSIHAGSSVCRKLRPWDGPFLCSSCQEKKEAMEGKRPTG  420



>ref|XP_006829727.1| hypothetical protein AMTR_s00126p00104180 [Amborella trichopoda]
 gb|ERM97143.1| hypothetical protein AMTR_s00126p00104180 [Amborella trichopoda]
Length=430

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 8/106 (8%)
 Frame = -1

Query  600  IFRKKSATKP---SKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +FR+KS+       K+   V +VEE++EEGSAMLAERL   DS  P  SM  LF CAVCQ
Sbjct  308  MFRRKSSESSSHSDKEYCEVDLVEEIYEEGSAMLAERL---DSQYPLRSMFKLFACAVCQ  364

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            V +   EGIS+HAG+     ++PW GPFLC  C+ KKDAMEGKRPS
Sbjct  365  VVIKQGEGISLHAGSSRHGRTRPWDGPFLCKSCQMKKDAMEGKRPS  410



>ref|XP_006354899.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Solanum tuberosum]
Length=428

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 8/107 (7%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +FRKK   S++   K      +VEELFEEGSA L++RL   D+  P  +M  LFICAVCQ
Sbjct  318  MFRKKTSESSSNIQKDFCEPDVVEELFEEGSASLSDRL---DAKYPVCNMFKLFICAVCQ  374

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            V++   +G+S+HAG+  + SS+PW GPFLC+ C+ KK+AMEG+RP G
Sbjct  375  VEIKPGQGVSIHAGSSNTRSSRPWDGPFLCSSCQEKKEAMEGRRPFG  421



>gb|KJB58457.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=428

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKK   ++++  K+     +VEELFEEGSAML+ER  ++     +M  LF CAVCQ++
Sbjct  317  MFRKKHSEASSQSDKEYMEPDVVEELFEEGSAMLSERFATKYPLC-NMFKLFTCAVCQLE  375

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVK  289
            +   EGIS+HAG   S   +PW GPFLC+ C+ KK+AMEGKRPSG +
Sbjct  376  MKPGEGISIHAGTSNSVKLRPWDGPFLCSTCQEKKEAMEGKRPSGSR  422



>gb|KHG12192.1| hypothetical protein F383_19798 [Gossypium arboreum]
Length=428

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +FRKK   ++++  K+     +VEELFEEGSAML+ER  ++    P  +M  LF CAVCQ
Sbjct  317  MFRKKHSEASSQSDKEYMEPDVVEELFEEGSAMLSERFATK---YPLCNMFKLFTCAVCQ  373

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVK  289
            +++   EGIS+HAG   S   +PW GPFLC+ C+ KK+AMEGKRPSG +
Sbjct  374  LEMKPGEGISIHAGTSNSVKLRPWDGPFLCSTCQEKKEAMEGKRPSGSR  422



>gb|KHG12193.1| hypothetical protein F383_19798 [Gossypium arboreum]
Length=374

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKK   ++++  K+     +VEELFEEGSAML+ER  ++     +M  LF CAVCQ++
Sbjct  263  MFRKKHSEASSQSDKEYMEPDVVEELFEEGSAMLSERFATKYPLC-NMFKLFTCAVCQLE  321

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVK  289
            +   EGIS+HAG   S   +PW GPFLC+ C+ KK+AMEGKRPSG +
Sbjct  322  MKPGEGISIHAGTSNSVKLRPWDGPFLCSTCQEKKEAMEGKRPSGSR  368



>ref|XP_002284640.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 ref|XP_010664578.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 ref|XP_010664579.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 ref|XP_010664580.1| PREDICTED: probable protein phosphatase 2C 12 [Vitis vinifera]
 emb|CBI19533.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 8/112 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S++   K+ S   +VEELFEEGSAMLAERL   D+  P  ++  LF+CAVC
Sbjct  317  SMFRKKPSESSSHVDKEYSEPDVVEELFEEGSAMLAERL---DAKYPICNVFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA  283
            QV++   EGIS+HAG+  +   +PW GPFLC+ C+ KK+AMEG+R  G + +
Sbjct  374  QVEMKPGEGISIHAGSSNAGKLRPWDGPFLCSSCQEKKEAMEGRRGDGSRYS  425



>gb|KJB58459.1| hypothetical protein B456_009G211100 [Gossypium raimondii]
Length=460

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 4/105 (4%)
 Frame = -1

Query  600  IFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVD  430
            +FRKK   ++++  K+     +VEELFEEGSAML+ER  ++     +M  LF CAVCQ++
Sbjct  317  MFRKKHSEASSQSDKEYMEPDVVEELFEEGSAMLSERFATKYPLC-NMFKLFTCAVCQLE  375

Query  429  LGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            +   EGIS+HAG   S   +PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  376  MKPGEGISIHAGTSNSVKLRPWDGPFLCSTCQEKKEAMEGKRPSG  420



>ref|XP_006595966.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Glycine max]
Length=386

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKKS+   S   K+ +   +VEEL+EEGSAML+ERL   D+  P  +M  LFICAVC
Sbjct  274  SMFRKKSSESSSYIDKEYTEPDVVEELYEEGSAMLSERL---DTKYPVCNMFKLFICAVC  330

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGK  307
            QV++   EGIS+H GA  S   +PW GPFLC+ C+ KK+AMEGK
Sbjct  331  QVEIKPGEGISIHEGAPNSRKFRPWDGPFLCSSCQEKKEAMEGK  374



>ref|XP_008797258.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Phoenix 
dactylifera]
Length=433

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
             +FR++S    S   +  S   +VEE+FEEGSAMLA+RL   D+  P  +M  LFICAVC
Sbjct  317  NMFRRRSCESTSHSDRGYSQPDVVEEIFEEGSAMLAKRL---DAEYPVRNMFKLFICAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QV++   EGISVHAG+      +PW GPFLC  C+ KK+AMEGKRPS
Sbjct  374  QVEMKPGEGISVHAGSSQHGKLRPWDGPFLCRSCQKKKEAMEGKRPS  420



>gb|AFK41874.1| unknown [Medicago truncatula]
Length=468

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 8/107 (7%)
 Frame = -1

Query  609  SSTIFRKKS---ATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPS--MSGLFICA  445
            SS +F KKS   A K + KLSAVG+VEELFEEGSAML ERLG+   N PS   SG+  CA
Sbjct  319  SSLLFGKKSQNLANKGTNKLSAVGVVEELFEEGSAMLTERLGN---NVPSDTNSGIHRCA  375

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            VC  D  + +G+SV+     +  SKPW+GPFLCT+C+ KKDAM  K+
Sbjct  376  VCLADQPSGDGLSVNNDHFITPVSKPWEGPFLCTNCQKKKDAMGRKK  422



>ref|XP_010061763.1| PREDICTED: probable protein phosphatase 2C 12 [Eucalyptus grandis]
 gb|KCW68759.1| hypothetical protein EUGRSUZ_F02357 [Eucalyptus grandis]
Length=431

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPSK---KLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKKS+   S+   +     +VEELFE+GSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFRKKSSESSSQIDQEFIEPDVVEELFEDGSAMLSERL---DTKYPLCNMFRLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV+L   EGIS+HAG+      +PW GPFLC  C+ KK+AMEG+RP G
Sbjct  373  QVELKPGEGISIHAGSSNPGKLRPWDGPFLCLSCQEKKEAMEGRRPFG  420



>gb|EYU25409.1| hypothetical protein MIMGU_mgv1a006684mg [Erythranthe guttata]
Length=435

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = -1

Query  603  TIFRKKSATKPSKK--------LSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLF  454
            ++FRKKS+   S++             +VEELFEEGSA L+ERL   DS  P  +M  LF
Sbjct  317  SMFRKKSSESSSQRGRNKEEEENLEPEMVEELFEEGSASLSERL---DSKYPVCNMFKLF  373

Query  453  ICAVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGV  292
            ICA+CQ+++   EGIS+H     +  S+PW GPFLC+ C++KKDAMEGK P+GV
Sbjct  374  ICAICQIEIKPGEGISIHEKTNEARKSRPWNGPFLCSSCKDKKDAMEGKIPNGV  427



>ref|XP_003521674.1| PREDICTED: probable protein phosphatase 2C 5-like [Glycine max]
Length=426

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 6/99 (6%)
 Frame = -1

Query  591  KKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDL-GASE  415
            + S  K + KLSAVG+VEELFEEGSAML ERLG +D      SG+F CAVCQVD     +
Sbjct  327  ENSVNKATNKLSAVGVVEELFEEGSAMLTERLG-KDFPLNKNSGIFRCAVCQVDQPPGDD  385

Query  414  GISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            G+SV++G  FS    P   PFLCT+C+ KKDAMEGKRPS
Sbjct  386  GLSVNSGPFFS----PASSPFLCTNCQKKKDAMEGKRPS  420



>ref|XP_003545307.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Glycine max]
 gb|KHN35672.1| Hypothetical protein glysoja_037582 [Glycine soja]
Length=428

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKKS+   S   K+ +   +VEEL+EEGSAML+ERL   D+  P  +M  LFICAVC
Sbjct  316  SMFRKKSSESSSYIDKEYTEPDVVEELYEEGSAMLSERL---DTKYPVCNMFKLFICAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGK  307
            QV++   EGIS+H GA  S   +PW GPFLC+ C+ KK+AMEGK
Sbjct  373  QVEIKPGEGISIHEGAPNSRKFRPWDGPFLCSSCQEKKEAMEGK  416



>ref|XP_008220215.1| PREDICTED: probable protein phosphatase 2C 12 [Prunus mume]
Length=429

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S++   K+     +VEELFEEGSA L+ERL   DS  P  +M  LF+CAVC
Sbjct  317  SMFRKKPCDSSSNVEKEYIEPDMVEELFEEGSATLSERL---DSKYPLCNMFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H+G+      +PW GPFLC+ C+ K++AMEGKRPSG
Sbjct  374  QVEIKPGEGISIHSGSSNPGKLRPWDGPFLCSSCQEKREAMEGKRPSG  421



>ref|XP_009411651.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 5/105 (5%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQV  433
            ++F KK   +A KP+K LS+VG VEELFEEGSAML ERLG   S+  + +GL  CA+CQ 
Sbjct  321  SLFGKKPQNAAGKPNK-LSSVGAVEELFEEGSAMLEERLGKSFSSREN-TGLLRCAICQT  378

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            D    + + V++G +FS  SK  +GP+LC DCR KKDAMEGKRPS
Sbjct  379  DQVPDDDLFVNSGDLFSPPSKQQEGPYLCVDCRRKKDAMEGKRPS  423



>ref|XP_004499068.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Cicer arietinum]
Length=439

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 8/114 (7%)
 Frame = -1

Query  600  IFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +FRKKS+   S   K+     +V EL+EEGSAML+ERL   D+  P  +M  LFICAVCQ
Sbjct  317  MFRKKSSESSSYIDKEYLEPDVVVELYEEGSAMLSERL---DTKYPLCNMFKLFICAVCQ  373

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA*LH  274
            V++   EGISVH GA      +PW GPFLC+ C+ KK+AMEGKR  GV     H
Sbjct  374  VEIKPGEGISVHEGAPNPRKLRPWDGPFLCSSCQEKKEAMEGKRSLGVLTTPFH  427



>ref|XP_006374959.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ERP52756.1| phosphatase 2C family protein [Populus trichocarpa]
Length=429

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FR+KS+   S   K+     +VEEL+EEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  317  SMFRRKSSESSSQIDKEYLEPDVVEELYEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGISVHAG+      +PW GPFLC  C+ KK+AMEGKR SG
Sbjct  374  QVEIKPDEGISVHAGSSDFGKLRPWDGPFLCLSCQEKKEAMEGKRQSG  421



>gb|KHN03953.1| Hypothetical protein glysoja_022639 [Glycine soja]
Length=426

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 6/99 (6%)
 Frame = -1

Query  591  KKSATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDL-GASE  415
            + S  K + KLSAVG+VEELFEEGSAML ERLG +D      SG+F CAVCQVD     +
Sbjct  327  ENSMNKATNKLSAVGVVEELFEEGSAMLTERLG-KDFPLNKNSGIFRCAVCQVDQPPGDD  385

Query  414  GISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            G+SV++G  FS    P   PFLCT+C+ KKDAMEGKRPS
Sbjct  386  GLSVNSGPFFS----PASSPFLCTNCQKKKDAMEGKRPS  420



>emb|CAN78409.1| hypothetical protein VITISV_023178 [Vitis vinifera]
Length=450

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S++   K+ S   +VEELFEEGSAMLAERL   D+  P  ++  LF+CAVC
Sbjct  317  SMFRKKPSESSSHVDKEYSEPDVVEELFEEGSAMLAERL---DAKYPICNVFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            QV++   EGIS+HAG+  +   +PW GPFLC+ C+ KK+AMEG+R
Sbjct  374  QVEMKPGEGISIHAGSSNAGKLRPWDGPFLCSSCQEKKEAMEGRR  418



>ref|XP_009107427.1| PREDICTED: probable protein phosphatase 2C 12 [Brassica rapa]
Length=428

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C+ KKDAMEGKR  G
Sbjct  373  QVEVKPGEGVSIHAGSANFPKLRPWDGPFLCASCQEKKDAMEGKRSLG  420



>ref|NP_172388.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 ref|NP_849621.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|O80492.1|P2C05_ARATH RecName: Full=Probable protein phosphatase 2C 5; Short=AtPP2C05 
[Arabidopsis thaliana]
 gb|AAC24088.1| Contains similarity to protein phosphatase 2C (ABI1) gb|X78886 
from A. thaliana [Arabidopsis thaliana]
 gb|ABM06026.1| At1g09160 [Arabidopsis thaliana]
 dbj|BAH19588.1| AT1G09160 [Arabidopsis thaliana]
 gb|AEE28405.1| putative protein phosphatase 2C 5 [Arabidopsis thaliana]
 gb|AEE28406.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=428

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -1

Query  585  SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEGIS  406
            +  K   KLSAVG+VEELFEEGSA+LA+RLG +D    + +GL  CAVCQ+D   SE +S
Sbjct  328  TNNKNGNKLSAVGVVEELFEEGSAVLADRLG-KDLLSNTETGLLKCAVCQIDESPSEDLS  386

Query  405  VHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
             + G+I S++SK W+GPFLCT C+ KKDAMEGKRPS
Sbjct  387  SNGGSIISSASKRWEGPFLCTICKKKKDAMEGKRPS  422



>emb|CDY17018.1| BnaA08g03820D [Brassica napus]
Length=428

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSDSSSNIEKEYAEPDVVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C+ KKDAMEGKR  G
Sbjct  373  QVEVKPGEGVSIHAGSANFPKLRPWDGPFLCASCQEKKDAMEGKRSLG  420



>ref|XP_010479140.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
 ref|XP_010479141.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
Length=428

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K++   S   K+ +    VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSSSNIEKEYAEPDEVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>ref|XP_010461537.1| PREDICTED: probable protein phosphatase 2C 12 [Camelina sativa]
Length=428

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K++   S   K+ +    VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKTSDSSSNIEKEYAEPDEVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG+      +PW GPFLC  C++KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGSDNCRKLRPWDGPFLCASCQDKKDAMEGKRSSG  420



>ref|XP_007222388.1| hypothetical protein PRUPE_ppa006058mg [Prunus persica]
 gb|EMJ23587.1| hypothetical protein PRUPE_ppa006058mg [Prunus persica]
Length=429

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 75/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S++   K+     +VEELFEEGSA L+ERL   D+  P  +M  LF+CAVC
Sbjct  317  SMFRKKHCDSSSNVEKEYIEPDMVEELFEEGSASLSERL---DTKYPLCNMFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H+G+      +PW GPFLC+ C+ K++AMEGKRPSG
Sbjct  374  QVEIKPGEGISIHSGSSNPGKLRPWDGPFLCSSCQEKREAMEGKRPSG  421



>gb|KJB63822.1| hypothetical protein B456_010G018200 [Gossypium raimondii]
 gb|KJB63823.1| hypothetical protein B456_010G018200 [Gossypium raimondii]
Length=426

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 70/106 (66%), Gaps = 7/106 (7%)
 Frame = -1

Query  600  IFRKKSATKPS--KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQV  433
            +FRKK++   S  K      +VEELFEEGSA L+ERL   D+  P  +M  LF+CAVCQ+
Sbjct  316  MFRKKNSGSSSQDKDYMEPDVVEELFEEGSAWLSERL---DTKYPLCNMFKLFMCAVCQL  372

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            ++   EGIS+H G       +PW GPFLC+ C  KK+AMEGKRPSG
Sbjct  373  EMKPGEGISIHVGTSNPVKLRPWDGPFLCSSCNEKKEAMEGKRPSG  418



>emb|CDY32154.1| BnaCnng06630D [Brassica napus]
Length=500

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -1

Query  576  KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEGISVHA  397
            K   KLS+VG VEELFEEGSAMLA+RLG +D    + +GL  CAVCQVD    E +S + 
Sbjct  405  KNGNKLSSVG-VEELFEEGSAMLADRLG-KDLPSNTDTGLLKCAVCQVDQSPGEALSSNE  462

Query  396  GAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            G+I S++SK W+GPFLCT C+ KKDAMEGKRPS
Sbjct  463  GSI-SSASKRWEGPFLCTICKKKKDAMEGKRPS  494



>ref|XP_009386662.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=428

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -1

Query  606  STIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQ  436
            S +FRKKS     KP+K LS+VG VEELFEEGSAML ERLG         SG   CA+CQ
Sbjct  321  SLLFRKKSQNFSGKPNK-LSSVGSVEELFEEGSAMLEERLGKIHLKN---SGHLRCAICQ  376

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRP  301
            +D   +  +SV +   F  +S PW+GP+LC DC  KKDAMEGKRP
Sbjct  377  MDQAPNNDLSVTSVDGFCPASNPWEGPYLCADCWRKKDAMEGKRP  421



>ref|XP_009145043.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Brassica 
rapa]
Length=409

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K   S++   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  300  SMFKRKGSDSSSNIEKEYAEPDLVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  356

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            QV++   EG+S+HAG       +PW GPFLC  C+ KKDAMEGKR
Sbjct  357  QVEVKPGEGVSIHAGTANCRKLRPWDGPFLCASCQEKKDAMEGKR  401



>ref|XP_008452538.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Cucumis 
melo]
Length=428

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+S+   S   ++ +   +VEELFEEGSAML+ERL   DS  P  +M  LF+CA+C
Sbjct  316  SMFRKRSSESSSHFEREYNEPDVVEELFEEGSAMLSERL---DSKYPVCNMFKLFVCAIC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            Q+++   EG+S++AG+      + W GPFLC  C  KK+AMEGKRPSG
Sbjct  373  QIEIQPREGVSIYAGSSNRGKLRAWDGPFLCLGCTEKKEAMEGKRPSG  420



>ref|XP_003550341.1| PREDICTED: probable protein phosphatase 2C 12-like [Glycine max]
 gb|KHN12774.1| Hypothetical protein glysoja_008737 [Glycine soja]
Length=428

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 8/104 (8%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKKS+   S   K+     +VEEL+EEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFRKKSSESSSYIDKEYMEPDVVEELYEEGSAMLSERL---DTKYPVCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGK  307
            QV++   EGIS+H GA  S   +PW GPFLC+ C+ KK+AMEGK
Sbjct  373  QVEIKPGEGISIHEGAPDSRKFRPWDGPFLCSSCQEKKEAMEGK  416



>ref|XP_008452534.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452535.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452536.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
 ref|XP_008452537.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Cucumis 
melo]
Length=439

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+S+   S   ++ +   +VEELFEEGSAML+ERL   DS  P  +M  LF+CA+C
Sbjct  316  SMFRKRSSESSSHFEREYNEPDVVEELFEEGSAMLSERL---DSKYPVCNMFKLFVCAIC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            Q+++   EG+S++AG+      + W GPFLC  C  KK+AMEGKRPSG
Sbjct  373  QIEIQPREGVSIYAGSSNRGKLRAWDGPFLCLGCTEKKEAMEGKRPSG  420



>emb|CDY17078.1| BnaC06g00110D [Brassica napus]
Length=429

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSA---TKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   +   K+      VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  317  SMFKRKSSGSSSNTEKEYLEPDEVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  373

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG       +PW GPFLC  C+ KKDAMEGKR SG
Sbjct  374  QVEVKPGEGVSIHAGTANCPKLRPWDGPFLCASCQEKKDAMEGKRSSG  421



>ref|XP_009145042.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Brassica 
rapa]
Length=425

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K   S++   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKGSDSSSNIEKEYAEPDLVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            QV++   EG+S+HAG       +PW GPFLC  C+ KKDAMEGKR
Sbjct  373  QVEVKPGEGVSIHAGTANCRKLRPWDGPFLCASCQEKKDAMEGKR  417



>emb|CDY43845.1| BnaA05g18570D [Brassica napus]
Length=424

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++K   S++   K+ +   +VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKGSDSSSNIEKEYAEPDLVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            QV++   EG+S+HAG       +PW GPFLC  C+ KKDAMEGKR
Sbjct  373  QVEVKPGEGVSIHAGTANCRKLRPWDGPFLCASCQEKKDAMEGKR  417



>ref|XP_009118925.1| PREDICTED: probable protein phosphatase 2C 12 [Brassica rapa]
 ref|XP_009118926.1| PREDICTED: probable protein phosphatase 2C 12 [Brassica rapa]
Length=428

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+      VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSGSSSNIEKEYLEPDEVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG       +PW GPFLC  C+ KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGTANCPKLRPWDGPFLCASCQEKKDAMEGKRSSG  420



>ref|XP_011083858.1| PREDICTED: probable protein phosphatase 2C 12 isoform X3 [Sesamum 
indicum]
Length=366

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 9/109 (8%)
 Frame = -1

Query  603  TIFRKKSATKPSK----KLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAV  442
             +FRKK++   S+    +     +VEELFEEGSA L+ERL   DS  P  ++  LFICA+
Sbjct  252  NMFRKKTSESSSQSGKEEYFEPDVVEELFEEGSASLSERL---DSKYPVCNIFKLFICAI  308

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            CQV++   EGIS+HAG      S+PW GPFLC  C+ KK+AMEGKR SG
Sbjct  309  CQVEIKPGEGISIHAGTNDPRKSRPWDGPFLCLSCQEKKEAMEGKRLSG  357



>ref|XP_011083859.1| PREDICTED: probable protein phosphatase 2C 12 isoform X4 [Sesamum 
indicum]
Length=363

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 9/109 (8%)
 Frame = -1

Query  603  TIFRKKSATKPSK----KLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAV  442
             +FRKK++   S+    +     +VEELFEEGSA L+ERL   DS  P  ++  LFICA+
Sbjct  249  NMFRKKTSESSSQSGKEEYFEPDVVEELFEEGSASLSERL---DSKYPVCNIFKLFICAI  305

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            CQV++   EGIS+HAG      S+PW GPFLC  C+ KK+AMEGKR SG
Sbjct  306  CQVEIKPGEGISIHAGTNDPRKSRPWDGPFLCLSCQEKKEAMEGKRLSG  354



>ref|XP_010475741.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010475742.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -1

Query  612  ASSTIFRKKSAT----KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICA  445
            A ++   +K+ T    K   KLSAVG+VEELFEEGSA+LA+RLG +D    + +GL  CA
Sbjct  315  AFTSFLSRKNHTATNHKNGNKLSAVGVVEELFEEGSAVLADRLG-KDLPSNTENGLLKCA  373

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VCQ D    EG+S + G+I S++S  W+GPFLCT C+ KKDAMEGKRPS
Sbjct  374  VCQTDESPGEGLSSNGGSIISSASNRWEGPFLCTICKKKKDAMEGKRPS  422



>ref|XP_010458188.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010458189.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -1

Query  612  ASSTIFRKKSAT----KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICA  445
            A ++   +K+ T    K   KLSAVG+VEELFEEGSA+LA+RLG +D    + +GL  CA
Sbjct  315  AFTSFLSRKNHTATNHKNGNKLSAVGVVEELFEEGSAVLADRLG-KDLPSNTENGLLKCA  373

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VCQ D    EG+S + G+I S++S  W+GPFLCT C+ KKDAMEGKRPS
Sbjct  374  VCQTDESPGEGLSSNGGSIISSASNRWEGPFLCTICKKKKDAMEGKRPS  422



>ref|XP_010489746.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
 ref|XP_010489753.1| PREDICTED: probable protein phosphatase 2C 5 [Camelina sativa]
Length=428

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -1

Query  612  ASSTIFRKKSAT----KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICA  445
            A ++   +K+ T    K   KLSAVG+VEELFEEGSA+LA+RLG +D    + +GL  CA
Sbjct  315  AFTSFLSRKNHTATNHKNGNKLSAVGVVEELFEEGSAVLADRLG-KDLPSNTENGLLKCA  373

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            VCQ D    EG+S + G+I S++S  W+GPFLCT C+ KKDAMEGKRPS
Sbjct  374  VCQTDESPGEGLSSNGGSIISSASNRWEGPFLCTICKKKKDAMEGKRPS  422



>ref|XP_002892487.1| hypothetical protein ARALYDRAFT_471002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68746.1| hypothetical protein ARALYDRAFT_471002 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -1

Query  585  SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGPSMSGLFICAVCQVDLGASEGIS  406
            S  K   KLSAVG+VEELFEEGSA+LA+RLG +D    + +GL  CAVCQ D    E +S
Sbjct  328  SNNKNGNKLSAVGVVEELFEEGSAVLADRLG-KDPPSHTETGLLKCAVCQTDEFPGEDLS  386

Query  405  VHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
             + G+I S++SK W+GPFLCT C+ KKDAMEGKRPS
Sbjct  387  SNGGSIISSASKRWEGPFLCTICKKKKDAMEGKRPS  422



>ref|XP_011083856.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Sesamum 
indicum]
Length=431

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 9/109 (8%)
 Frame = -1

Query  603  TIFRKKSATKPSK----KLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAV  442
             +FRKK++   S+    +     +VEELFEEGSA L+ERL   DS  P  ++  LFICA+
Sbjct  317  NMFRKKTSESSSQSGKEEYFEPDVVEELFEEGSASLSERL---DSKYPVCNIFKLFICAI  373

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            CQV++   EGIS+HAG      S+PW GPFLC  C+ KK+AMEGKR SG
Sbjct  374  CQVEIKPGEGISIHAGTNDPRKSRPWDGPFLCLSCQEKKEAMEGKRLSG  422



>ref|XP_011083857.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Sesamum 
indicum]
Length=371

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 9/109 (8%)
 Frame = -1

Query  603  TIFRKKSATKPSK----KLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAV  442
             +FRKK++   S+    +     +VEELFEEGSA L+ERL   DS  P  ++  LFICA+
Sbjct  257  NMFRKKTSESSSQSGKEEYFEPDVVEELFEEGSASLSERL---DSKYPVCNIFKLFICAI  313

Query  441  CQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            CQV++   EGIS+HAG      S+PW GPFLC  C+ KK+AMEGKR SG
Sbjct  314  CQVEIKPGEGISIHAGTNDPRKSRPWDGPFLCLSCQEKKEAMEGKRLSG  362



>emb|CDY06741.1| BnaA10g05200D [Brassica napus]
Length=428

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++F++KS+   S   K+      VEELFEEGSAML+ERL   D+  P  +M  LF+CAVC
Sbjct  316  SMFKRKSSGSSSNIEKEYLEPDEVEELFEEGSAMLSERL---DTKYPLCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EG+S+HAG       +PW GPFLC  C+ KKDAMEGKR SG
Sbjct  373  QVEVKPGEGVSIHAGTANCPMLRPWDGPFLCASCQEKKDAMEGKRSSG  420



>ref|XP_004499069.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Cicer arietinum]
Length=428

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 8/104 (8%)
 Frame = -1

Query  600  IFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQ  436
            +FRKKS+   S   K+     +V EL+EEGSAML+ERL   D+  P  +M  LFICAVCQ
Sbjct  317  MFRKKSSESSSYIDKEYLEPDVVVELYEEGSAMLSERL---DTKYPLCNMFKLFICAVCQ  373

Query  435  VDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            V++   EGISVH GA      +PW GPFLC+ C+ KK+AMEGKR
Sbjct  374  VEIKPGEGISVHEGAPNPRKLRPWDGPFLCSSCQEKKEAMEGKR  417



>gb|KJB29498.1| hypothetical protein B456_005G103200 [Gossypium raimondii]
Length=427

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 13/117 (11%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S +   K+     +VEELFEEGSA+L+ERL   ++  P  +M  LF+CAVC
Sbjct  316  SLFRKKPSESFSYKDKEYMEPDVVEELFEEGSALLSERL---NTKYPVCNMFKLFMCAVC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA*LHCL  268
            Q+++   EGISVHAG        PW GPFLC+ C+ KK+AMEGKRPS       HC+
Sbjct  373  QIEMKPGEGISVHAGTSSLVKVCPWDGPFLCSSCQEKKEAMEGKRPSD-----RHCI  424



>gb|KJB29497.1| hypothetical protein B456_005G103200 [Gossypium raimondii]
Length=433

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 13/117 (11%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRKK   S +   K+     +VEELFEEGSA+L+ERL   ++  P  +M  LF+CAVC
Sbjct  322  SLFRKKPSESFSYKDKEYMEPDVVEELFEEGSALLSERL---NTKYPVCNMFKLFMCAVC  378

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGVKVA*LHCL  268
            Q+++   EGISVHAG        PW GPFLC+ C+ KK+AMEGKRPS       HC+
Sbjct  379  QIEMKPGEGISVHAGTSSLVKVCPWDGPFLCSSCQEKKEAMEGKRPSD-----RHCI  430



>ref|XP_004242956.1| PREDICTED: probable protein phosphatase 2C 12 [Solanum lycopersicum]
Length=429

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKK---SATKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKK   S +   +      +VEELFEEGSA L++RL   D+  P  +M  LF CA+C
Sbjct  316  SIFRKKTSESCSNTERDYDEPDVVEELFEEGSASLSDRL---DAKYPICNMFKLFTCAIC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+H G+  + + + W GPFLC+ C+ KK+AMEGKRPSG
Sbjct  373  QVEIKPGEGISIHVGSSNTRNFRQWDGPFLCSSCQEKKEAMEGKRPSG  420



>gb|KHN22311.1| Hypothetical protein glysoja_022067 [Glycine soja]
Length=429

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = -1

Query  603  TIFRKKSA---TKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKKS+   T   K+     +V+EL+EEGSAML+ERL   ++  P  +M  LFICAVC
Sbjct  318  SIFRKKSSESSTFIEKEYLEPDVVQELYEEGSAMLSERL---ETKYPLCNMFKLFICAVC  374

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QV++   EGIS+H G       +PW GPFLC+ C+ KK+AMEGKR S
Sbjct  375  QVEIKPGEGISIHEGLTNPGRLRPWDGPFLCSSCQEKKEAMEGKRTS  421



>ref|XP_003528265.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X1 
[Glycine max]
Length=429

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = -1

Query  603  TIFRKKSA---TKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKKS+   T   K+     +V+EL+EEGSAML+ERL   ++  P  +M  LFICAVC
Sbjct  318  SIFRKKSSESSTFIEKEYLEPDVVQELYEEGSAMLSERL---ETKYPLCNMFKLFICAVC  374

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QV++   EGIS+H G       +PW GPFLC+ C+ KK+AMEGKR S
Sbjct  375  QVEIKPGEGISIHEGLTNPGRLRPWDGPFLCSSCQEKKEAMEGKRTS  421



>ref|XP_007136673.1| hypothetical protein PHAVU_009G064200g [Phaseolus vulgaris]
 gb|ESW08667.1| hypothetical protein PHAVU_009G064200g [Phaseolus vulgaris]
Length=429

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKKS+   S   K+     +V+EL+EEGSAML+ERL   ++  P  +M  LFICAVC
Sbjct  318  SIFRKKSSESSSYVDKQYQEPDMVQELYEEGSAMLSERL---ETKYPLCNMFKLFICAVC  374

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QV++   EGIS+H G       +PW GPFLC+ C+ K++AMEGKR S
Sbjct  375  QVEIKPGEGISIHVGLSNPGRLRPWDGPFLCSSCQKKREAMEGKRAS  421



>ref|XP_006581239.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X2 
[Glycine max]
Length=437

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 73/109 (67%), Gaps = 8/109 (7%)
 Frame = -1

Query  603  TIFRKKSA---TKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKKS+   T   K+     +V+EL+EEGSAML+ERL   ++  P  +M  LFICAVC
Sbjct  318  SIFRKKSSESSTFIEKEYLEPDVVQELYEEGSAMLSERL---ETKYPLCNMFKLFICAVC  374

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSGV  292
            QV++   EGIS+H G       +PW GPFLC+ C+ KK+AMEGKR S +
Sbjct  375  QVEIKPGEGISIHEGLTNPGRLRPWDGPFLCSSCQEKKEAMEGKRTSDL  423



>ref|XP_006581240.1| PREDICTED: probable protein phosphatase 2C 12-like isoform X3 
[Glycine max]
Length=347

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = -1

Query  603  TIFRKKSA---TKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +IFRKKS+   T   K+     +V+EL+EEGSAML+ERL   ++  P  +M  LFICAVC
Sbjct  228  SIFRKKSSESSTFIEKEYLEPDVVQELYEEGSAMLSERL---ETKYPLCNMFKLFICAVC  284

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            QV++   EGIS+H G       +PW GPFLC+ C+ KK+AMEGKR S
Sbjct  285  QVEIKPGEGISIHEGLTNPGRLRPWDGPFLCSSCQEKKEAMEGKRTS  331



>ref|XP_008807757.1| PREDICTED: probable protein phosphatase 2C 33 [Phoenix dactylifera]
Length=437

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = -1

Query  609  SSTIFRKKSAT---KPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICA  445
            +S +F KKS     K + KLS+VG VEELFEEGSA+L ERLG    N P  + S  F CA
Sbjct  322  TSLLFGKKSQNTVGKHTNKLSSVGAVEELFEEGSAILEERLGK---NFPLKANSSPFRCA  378

Query  444  VCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPS  298
            +CQ+D   +EG+S  AG  FS +S+  +GP+LC +CR KKDAMEGKR S
Sbjct  379  ICQMDQTPNEGLSATAGTHFSPTSRSSEGPYLCVECRRKKDAMEGKRLS  427



>gb|EYU36299.1| hypothetical protein MIMGU_mgv1a006731mg [Erythranthe guttata]
Length=433

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 70/108 (65%), Gaps = 9/108 (8%)
 Frame = -1

Query  600  IFRKKSATKPS----KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            +FRKK     S    ++      VEE+FEE SA L+ERL   DS  P  +M  LF+CAVC
Sbjct  320  MFRKKHLESSSHAGKEEYYEPDYVEEIFEESSASLSERL---DSKYPVCNMFKLFMCAVC  376

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            QV++   EGIS+HAG       +PW GPFLC+ C++KK+AMEGKRPSG
Sbjct  377  QVEIKPGEGISIHAGTADPKKLRPWDGPFLCSSCQDKKEAMEGKRPSG  424



>gb|EPS63832.1| hypothetical protein M569_10947 [Genlisea aurea]
Length=484

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = -1

Query  603  TIFRKKSATKPSK------KLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFIC  448
            ++FRKKS+   S       + S   +VE+LFEEGSA L+ERL   DS  P  +M  LF+C
Sbjct  318  SMFRKKSSESSSHADGREDEYSEPDLVEQLFEEGSASLSERL---DSKYPVCNMFKLFMC  374

Query  447  AVCQVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            AVCQV++   EG S+ AG+  S   +PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  375  AVCQVEVKPGEGTSIFAGSSDSKKLRPWDGPFLCSTCQEKKEAMEGKRPSG  425



>ref|XP_008361008.1| PREDICTED: probable protein phosphatase 2C 12 [Malus domestica]
Length=430

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = -1

Query  543  VEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQVDLGASEGISVHAGAIFSTSSK  370
            VEELFEEGSA L+ERL   D+  P  +M  LF+CAVCQV++   EGIS+HAG+      +
Sbjct  341  VEELFEEGSASLSERL---DTKYPLCNMFKLFMCAVCQVEIKPGEGISIHAGSSNPGKLR  397

Query  369  PWQGPFLCTDCRNKKDAMEGKRPSG  295
            PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  398  PWDGPFLCSSCQGKKEAMEGKRPSG  422



>ref|XP_008393818.1| PREDICTED: probable protein phosphatase 2C 12 [Malus domestica]
Length=430

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = -1

Query  543  VEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQVDLGASEGISVHAGAIFSTSSK  370
            VEELFEEGSA L+ERL   D+  P  +M  LF+CAVCQV++   EGIS+HAG+      +
Sbjct  341  VEELFEEGSASLSERL---DTKYPLCNMFKLFMCAVCQVEIKPGEGISIHAGSSNPGKLR  397

Query  369  PWQGPFLCTDCRNKKDAMEGKRPSG  295
            PW GPFLC+ C+ KK+AMEGKRPSG
Sbjct  398  PWDGPFLCSSCQGKKEAMEGKRPSG  422



>ref|XP_004141247.1| PREDICTED: probable protein phosphatase 2C 12-like [Cucumis sativus]
 ref|XP_004160613.1| PREDICTED: probable protein phosphatase 2C 12-like [Cucumis sativus]
 gb|KGN55182.1| hypothetical protein Csa_4G639210 [Cucumis sativus]
Length=428

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = -1

Query  603  TIFRKKSATKPS---KKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVC  439
            ++FRK+S+   S   ++ +   +VEELFEEGSAML+ERL   DS  P  +M  LF+CA+C
Sbjct  316  SMFRKRSSESSSHFEREYNEPDVVEELFEEGSAMLSERL---DSKYPVCNMFKLFVCAIC  372

Query  438  QVDLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKRPSG  295
            Q+++   EG+S++AG+      + W GPFLC+ C  KK+AMEGKR SG
Sbjct  373  QIEIQPREGVSIYAGSSNRGKLRAWDGPFLCSSCTEKKEAMEGKRSSG  420



>ref|XP_004487674.1| PREDICTED: probable protein phosphatase 2C 12-like [Cicer arietinum]
Length=428

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = -1

Query  600  IFRKKSA--TKPSKKLSAVGIVEELFEEGSAMLAERLGSEDSNGP--SMSGLFICAVCQV  433
            +FRKK++  +   K+     +V EL+EEGSAML+ERL   D+  P  +M  LFICAVCQV
Sbjct  318  MFRKKTSESSYIDKEYLEPDVVVELYEEGSAMLSERL---DTKYPLCNMFKLFICAVCQV  374

Query  432  DLGASEGISVHAGAIFSTSSKPWQGPFLCTDCRNKKDAMEGKR  304
            ++   EGISVH GA      +PW GPFLC  CR KK+AMEGKR
Sbjct  375  EIKPGEGISVHEGASNPRKLRPWDGPFLCFSCREKKEAMEGKR  417



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875