BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049M17

Length=451
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010093709.1|  hypothetical protein L484_019050                   156   1e-45   Morus notabilis
ref|XP_010662384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   7e-45   Vitis vinifera
ref|XP_010264244.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   8e-45   Nelumbo nucifera [Indian lotus]
ref|XP_007215154.1|  hypothetical protein PRUPE_ppa013399mg             154   1e-44   Prunus persica
ref|XP_008228960.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   1e-44   Prunus mume [ume]
ref|XP_010258983.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    154   2e-44   Nelumbo nucifera [Indian lotus]
gb|EPS58672.1|  hypothetical protein M569_16139                         154   2e-44   Genlisea aurea
ref|XP_011018294.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    153   2e-44   Populus euphratica
ref|XP_010055510.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    153   2e-44   Eucalyptus grandis [rose gum]
ref|XP_011070110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    153   3e-44   Sesamum indicum [beniseed]
ref|XP_007155645.1|  hypothetical protein PHAVU_003G219300g             152   9e-44   Phaseolus vulgaris [French bean]
ref|XP_004516831.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   1e-43   Cicer arietinum [garbanzo]
ref|XP_004147198.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   1e-43   Cucumis sativus [cucumbers]
ref|NP_001235493.1|  uncharacterized protein LOC100499749               151   2e-43   Glycine max [soybeans]
ref|XP_007161348.1|  hypothetical protein PHAVU_001G061600g             151   3e-43   Phaseolus vulgaris [French bean]
ref|XP_007039883.1|  NADH dehydrogenase 1 beta subcomplex subunit 8     150   4e-43   
ref|XP_010530067.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   5e-43   Tarenaya hassleriana [spider flower]
gb|AGL09490.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          150   5e-43   Hydnora visseri
gb|ABK94153.1|  unknown                                                 150   5e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006398455.1|  hypothetical protein EUTSA_v10001074mg             149   6e-43   Eutrema salsugineum [saltwater cress]
ref|XP_009114266.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   8e-43   Brassica rapa
emb|CDY17725.1|  BnaA06g35440D                                          149   8e-43   Brassica napus [oilseed rape]
emb|CDY41058.1|  BnaA09g18370D                                          149   9e-43   Brassica napus [oilseed rape]
ref|XP_009101408.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   9e-43   Brassica rapa
ref|XP_002518112.1|  conserved hypothetical protein                     149   1e-42   Ricinus communis
ref|XP_009378949.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_006281322.1|  hypothetical protein CARUB_v10027375mg             148   2e-42   Capsella rubella
emb|CDP09936.1|  unnamed protein product                                147   4e-42   Coffea canephora [robusta coffee]
gb|KHN09808.1|  NADH dehydrogenase [ubiquinone] 1 beta subcomplex...    147   5e-42   Glycine soja [wild soybean]
ref|XP_006355476.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   5e-42   Solanum tuberosum [potatoes]
emb|CDX77778.1|  BnaC07g20320D                                          147   5e-42   
ref|XP_004245753.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   5e-42   Solanum lycopersicum
ref|XP_010441437.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   5e-42   Camelina sativa [gold-of-pleasure]
gb|KJB51916.1|  hypothetical protein B456_008G237800                    147   6e-42   Gossypium raimondii
gb|KJB21488.1|  hypothetical protein B456_004G200300                    147   8e-42   Gossypium raimondii
ref|XP_009770592.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   1e-41   Nicotiana sylvestris
gb|EYU32869.1|  hypothetical protein MIMGU_mgv1a016342mg                146   1e-41   Erythranthe guttata [common monkey flower]
gb|KHG13058.1|  hypothetical protein F383_17357                         146   1e-41   Gossypium arboreum [tree cotton]
ref|XP_009602608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   1e-41   Nicotiana tomentosiformis
emb|CDY28920.1|  BnaA02g25560D                                          146   1e-41   Brassica napus [oilseed rape]
ref|XP_008343083.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   2e-41   
ref|XP_006830041.1|  hypothetical protein AMTR_s00124p00115680          145   2e-41   Amborella trichopoda
emb|CDY40556.1|  BnaC02g33360D                                          145   2e-41   Brassica napus [oilseed rape]
ref|XP_010919522.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   3e-41   Elaeis guineensis
ref|XP_009128982.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   3e-41   Brassica rapa
gb|KHG01041.1|  hypothetical protein F383_21717                         145   4e-41   Gossypium arboreum [tree cotton]
gb|KFK31361.1|  hypothetical protein AALP_AA6G102500                    145   4e-41   Arabis alpina [alpine rockcress]
ref|XP_003608732.1|  hypothetical protein MTR_4g101140                  144   8e-41   Medicago truncatula
ref|XP_010494996.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_011466981.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   2e-40   Fragaria vesca subsp. vesca
ref|XP_009400677.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21491.1|  hypothetical protein B456_004G200300                    142   5e-40   Gossypium raimondii
gb|ACJ84169.1|  unknown                                                 141   1e-39   Medicago truncatula
ref|XP_008786987.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   2e-39   Phoenix dactylifera
ref|XP_008796817.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   4e-39   Phoenix dactylifera
ref|XP_008381184.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   6e-39   
ref|XP_009101407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   3e-38   Brassica rapa
ref|XP_004983722.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   2e-37   Setaria italica
ref|XP_006662581.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   2e-37   Oryza brachyantha
ref|XP_010919523.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   3e-37   
ref|XP_003574306.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   4e-37   Brachypodium distachyon [annual false brome]
ref|NP_001131355.1|  uncharacterized protein LOC100192676               134   7e-37   Zea mays [maize]
ref|XP_008659963.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   9e-37   
ref|XP_006440353.1|  hypothetical protein CICLE_v10022867mg             134   1e-36   Citrus clementina [clementine]
ref|XP_008659958.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   1e-36   
ref|NP_001065325.1|  Os10g0551600                                       133   1e-36   
ref|NP_001142497.1|  uncharacterized protein LOC100274725               133   2e-36   Zea mays [maize]
ref|NP_001144293.1|  uncharacterized protein LOC100277176               133   2e-36   
dbj|BAJ85316.1|  predicted protein                                      132   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002467527.1|  hypothetical protein SORBIDRAFT_01g029640          132   3e-36   Sorghum bicolor [broomcorn]
gb|EEC67413.1|  hypothetical protein OsI_34583                          132   4e-36   Oryza sativa Indica Group [Indian rice]
gb|AGL09494.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          130   7e-36   Thottea sp. JN-2013
gb|AGL09491.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          129   1e-35   Manekia incurva
gb|AGL09493.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          129   2e-35   Piper nigrum
gb|AGL09486.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          129   2e-35   Asimina triloba [pawpaw]
gb|AGL09485.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          127   7e-35   Asarum caudatum
gb|AGL09488.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          127   8e-35   Chloranthus fortunei
gb|AGL09497.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          127   1e-34   Zippelia begoniifolia
gb|AGL09496.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          125   6e-34   Xymalos monospora
gb|AFP49345.1|  hypothetical protein                                    124   1e-33   Olea europaea
gb|AGL09492.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          123   3e-33   Peperomia prostrata
gb|AGL09487.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          123   5e-33   Calycanthus occidentalis [California-allspice]
ref|NP_568684.1|  uncharacterized protein                               122   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518861.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_002863335.1|  hypothetical protein ARALYDRAFT_494216             120   1e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010264245.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    120   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010258984.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    119   5e-31   Nelumbo nucifera [Indian lotus]
gb|AGL09489.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          117   6e-31   Hernandia nymphaeifolia [kayu jambu hutan]
gb|ABK23873.1|  unknown                                                 119   6e-31   Picea sitchensis
gb|KDP39850.1|  hypothetical protein JCGZ_03381                         117   3e-30   Jatropha curcas
gb|AGL09495.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          115   3e-30   Verhuellia lunaria
gb|ABD64927.1|  hypothetical protein 24.t00002                          117   3e-30   Brassica oleracea
gb|ABD64969.1|  hypothetical protein 25.t00006                          117   4e-30   Brassica oleracea
ref|XP_011018295.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    116   5e-30   Populus euphratica
emb|CDY25957.1|  BnaC09g20300D                                          123   8e-30   Brassica napus [oilseed rape]
ref|XP_010695116.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    115   2e-29   
ref|XP_001753451.1|  predicted protein                                  114   2e-29   
ref|XP_006368197.1|  hypothetical protein POPTR_0001s00430g             114   3e-29   
emb|CBI31907.3|  unnamed protein product                                119   4e-29   Vitis vinifera
ref|XP_006355519.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    114   5e-29   
gb|ABD64995.1|  hypothetical protein 26.t00015                          112   1e-28   Brassica oleracea
ref|XP_003608733.1|  hypothetical protein MTR_4g101140                  110   7e-28   
ref|XP_008796813.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    109   5e-27   Phoenix dactylifera
ref|XP_008796814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    108   1e-26   
ref|XP_008796812.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    108   2e-26   
gb|AFW87915.1|  hypothetical protein ZEAMMB73_145461                    105   1e-25   
gb|EMT16400.1|  hypothetical protein F775_28617                         103   4e-25   
ref|XP_002440834.1|  hypothetical protein SORBIDRAFT_09g008006          101   9e-25   
ref|XP_006440354.1|  hypothetical protein CICLE_v10022867mg           99.8    1e-23   
gb|ADY38662.1|  hypothetical protein                                  91.7    9e-21   Wolffia arrhiza
ref|XP_010934141.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...  82.8    1e-16   
gb|AGU36714.1|  kinesin-related protein                               76.6    1e-15   Helianthus petiolaris
gb|AGU36718.1|  kinesin-related protein                               76.6    2e-15   Helianthus annuus
gb|AGU36715.1|  kinesin-related protein                               76.6    2e-15   Helianthus annuus
gb|AGU36716.1|  kinesin-related protein                               76.6    2e-15   Helianthus annuus
gb|AGU36724.1|  kinesin-related protein                               76.3    2e-15   Helianthus annuus
gb|KJB51917.1|  hypothetical protein B456_008G237800                  75.9    9e-15   Gossypium raimondii
gb|KJB21489.1|  hypothetical protein B456_004G200300                  75.5    1e-14   Gossypium raimondii
ref|NP_001236148.1|  uncharacterized protein LOC100306514             70.5    3e-12   
ref|XP_003064828.1|  predicted protein                                69.3    3e-11   Micromonas pusilla CCMP1545
ref|XP_005649552.1|  hypothetical protein COCSUDRAFT_52742            65.1    2e-10   Coccomyxa subellipsoidea C-169
ref|XP_002504368.1|  predicted protein                                63.9    5e-10   Micromonas commoda
gb|AFK49234.1|  unknown                                               62.0    2e-09   Lotus japonicus
ref|XP_001420082.1|  predicted protein                                58.9    2e-08   Ostreococcus lucimarinus CCE9901
gb|KCW71992.1|  hypothetical protein EUGRSUZ_E00445                   57.4    5e-08   Eucalyptus grandis [rose gum]
gb|KJB21490.1|  hypothetical protein B456_004G200300                  57.0    8e-08   Gossypium raimondii
emb|CEF99290.1|  unnamed product                                      53.9    8e-07   Ostreococcus tauri
ref|XP_003081497.1|  unnamed protein product                          53.9    1e-06   
ref|XP_010229345.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  52.4    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_007510211.1|  predicted protein                                52.0    7e-06   Bathycoccus prasinos



>ref|XP_010093709.1| hypothetical protein L484_019050 [Morus notabilis]
 gb|EXB54489.1| hypothetical protein L484_019050 [Morus notabilis]
Length=125

 Score =   156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/76 (95%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTP
Sbjct  50   NDELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_010662384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Vitis vinifera]
Length=125

 Score =   154 bits (390),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIA+TVGKYEALAWMCGGL FFASLGL+AVWNDKASKIPFTP
Sbjct  50   NDELIWDNGTPFPEPCIDRIAETVGKYEALAWMCGGLSFFASLGLLAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_010264244.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Nelumbo nucifera]
Length=125

 Score =   154 bits (390),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIPFTP
Sbjct  50   NDELLWDNGTPFPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_007215154.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
 gb|EMJ16353.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
Length=125

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF P
Sbjct  50   NDELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_008228960.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Prunus mume]
Length=125

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF P
Sbjct  50   NDELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_010258983.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=125

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS IPFTP
Sbjct  50   NDELVWDNGTPFPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASXIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>gb|EPS58672.1| hypothetical protein M569_16139, partial [Genlisea aurea]
Length=124

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS+IP+TP
Sbjct  49   NDELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASRIPYTP  108

Query  271  KVYPYDNLKVELGGEP  224
            KV+PYDNL+VELGGEP
Sbjct  109  KVFPYDNLRVELGGEP  124



>ref|XP_011018294.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Populus euphratica]
Length=125

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNLKVELGGEP
Sbjct  110  KVYPYDNLKVELGGEP  125



>ref|XP_010055510.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Eucalyptus grandis]
 gb|KCW71991.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=125

 Score =   153 bits (387),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPF P
Sbjct  50   NDELVWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_011070110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Sesamum indicum]
Length=125

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGKYEALAW+CGGLGFFASLG +AVWNDKASKIPFTP
Sbjct  50   NDELVWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGFLAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_007155645.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
 gb|ESW27639.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
Length=125

 Score =   152 bits (383),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF P
Sbjct  50   NEELLWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_004516831.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cicer arietinum]
Length=125

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASK PFTP
Sbjct  50   NEELLWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKYPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_004147198.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_004166721.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_008448866.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Cucumis melo]
 gb|KGN55877.1| hypothetical protein Csa_3G021140 [Cucumis sativus]
Length=127

 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGLGFFASLG +AVWNDKASKIPF P
Sbjct  50   NDELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGFLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGG+P
Sbjct  110  KVYPYDNLRVELGGDP  125



>ref|NP_001235493.1| uncharacterized protein LOC100499749 [Glycine max]
 gb|ACU13472.1| unknown [Glycine max]
 gb|KHN04354.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   151 bits (381),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL+WDNGT FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPFTP
Sbjct  50   NEELLWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_007161348.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
 gb|ESW33342.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
Length=156

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  FASLGL+AVWNDKASKIPFTP
Sbjct  81   NEELLWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFASLGLLAVWNDKASKIPFTP  140

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  141  KVYPYDNLRVELGGEP  156



>ref|XP_007039883.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
 gb|EOY24384.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
Length=125

 Score =   150 bits (379),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGKYEALAWMCGGL FFASLGL+A WNDKASKIPFTP
Sbjct  50   NDELIWDNGTSFPEPCIDRIADTVGKYEALAWMCGGLSFFASLGLLAWWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_010530067.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Tarenaya hassleriana]
Length=125

 Score =   150 bits (378),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPC+DRIADTVGKYEAL W+CGGLGFFA+LGL AVWNDKASKIPFTP
Sbjct  50   NDELVWDNGTAFPEPCVDRIADTVGKYEALGWLCGGLGFFATLGLAAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>gb|AGL09490.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hydnora 
visseri]
Length=125

 Score =   150 bits (378),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPC+DRIA T+GKYE LAW+CGGLGFFASLGL+AVWNDKASK+PFTP
Sbjct  50   NDELVWDNGTPFPEPCVDRIAPTIGKYEGLAWLCGGLGFFASLGLLAVWNDKASKLPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            K+YPYDNL+VELGGEP
Sbjct  110  KIYPYDNLRVELGGEP  125



>gb|ABK94153.1| unknown [Populus trichocarpa]
Length=125

 Score =   150 bits (378),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGT FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF P
Sbjct  50   NDELTWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNLKVELGGEP
Sbjct  110  KVYPYDNLKVELGGEP  125



>ref|XP_006398455.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
 gb|ESQ39908.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
Length=125

 Score =   149 bits (377),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVLNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_009114266.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   149 bits (377),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>emb|CDY17725.1| BnaA06g35440D [Brassica napus]
Length=125

 Score =   149 bits (376),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>emb|CDY41058.1| BnaA09g18370D [Brassica napus]
Length=125

 Score =   149 bits (376),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_009101408.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Brassica rapa]
Length=125

 Score =   149 bits (376),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_002518112.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44245.1| conserved hypothetical protein [Ricinus communis]
Length=126

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIP+ P
Sbjct  51   NEELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPYVP  110

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+ ELGGEP
Sbjct  111  KVYPYDNLRAELGGEP  126



>ref|XP_009378949.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Pyrus x bretschneideri]
Length=125

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASKIPF+P
Sbjct  50   NDELIWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKIPFSP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_006281322.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
 gb|EOA14220.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
Length=125

 Score =   148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFFATLGLLAVLNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>emb|CDP09936.1| unnamed protein product [Coffea canephora]
Length=125

 Score =   147 bits (372),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIA+TVGKYEAL+WMCGGLGFFASLGL+AVWNDKASKIP+TP
Sbjct  50   NDELVWDNGTPFPEPCIDRIAETVGKYEALSWMCGGLGFFASLGLLAVWNDKASKIPYTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPY NL+ ELG EP
Sbjct  110  KVYPYGNLRAELGEEP  125



>gb|KHN09808.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   147 bits (372),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL+WDNGT FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASK PF P
Sbjct  50   NEELLWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKTPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_006355476.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=125

 Score =   147 bits (372),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPFTP
Sbjct  50   NDELTWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>emb|CDX77778.1| BnaC07g20320D [Brassica napus]
Length=125

 Score =   147 bits (372),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF P
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_004245753.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Solanum lycopersicum]
Length=125

 Score =   147 bits (371),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPFTP
Sbjct  50   NDELTWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_010441437.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
 ref|XP_010481304.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
Length=125

 Score =   147 bits (371),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV+NDKAS +PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFFAALGLLAVFNDKASTVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>gb|KJB51916.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=125

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF P
Sbjct  50   NDELIWDNGTAFPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>gb|KJB21488.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=125

 Score =   147 bits (370),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF P
Sbjct  50   NDELIWDNGTAFPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_009770592.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana sylvestris]
Length=125

 Score =   146 bits (369),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGTPFPEPCIDRIADTVGKYEALAW+ GGL FF  LGL+AVWNDKAS IPFTP
Sbjct  50   NDELTWDNGTPFPEPCIDRIADTVGKYEALAWLSGGLSFFVGLGLLAVWNDKASTIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>gb|EYU32869.1| hypothetical protein MIMGU_mgv1a016342mg [Erythranthe guttata]
Length=125

 Score =   146 bits (369),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKAS IPF P
Sbjct  50   NDELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASTIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>gb|KHG13058.1| hypothetical protein F383_17357 [Gossypium arboreum]
Length=125

 Score =   146 bits (369),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF P
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGE  227
            KVYPYDNL+VELGGE
Sbjct  110  KVYPYDNLRVELGGE  124



>ref|XP_009602608.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana tomentosiformis]
Length=125

 Score =   146 bits (369),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGTPFPEPCIDRIADTVGKYEALAW+ GGL FF  LGL+AVWNDKAS IPFTP
Sbjct  50   NDELTWDNGTPFPEPCIDRIADTVGKYEALAWLSGGLSFFVGLGLLAVWNDKASTIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>emb|CDY28920.1| BnaA02g25560D [Brassica napus]
Length=125

 Score =   146 bits (368),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGL FFA LG++AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLSFFAGLGMLAVLNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_008343083.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
 ref|XP_008353844.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
Length=125

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPC DRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASKIPF P
Sbjct  50   NDELVWDNGTPFPEPCXDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_006830041.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
 gb|ERM97457.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
Length=124

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT +PEPC+D++A TVG+YEALAW+CGGLGFFASLGL+AVWNDKASKIPFTP
Sbjct  49   NDELIWDNGTAYPEPCLDKLATTVGEYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTP  108

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  109  KVYPYDNLRVELGGEP  124



>emb|CDY40556.1| BnaC02g33360D [Brassica napus]
Length=125

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGL FFA+LG++AV NDKASK+PF+P
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLSFFAALGMLAVLNDKASKVPFSP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_010919522.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Elaeis guineensis]
Length=125

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            +DEL+WDNGTP+PEPC+DR+A T+GKYEAL W+CGGLGFFA+LGL+AVWNDKASKIP+TP
Sbjct  50   HDELVWDNGTPYPEPCVDRLAPTIGKYEALGWLCGGLGFFATLGLLAVWNDKASKIPYTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_009128982.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGL FF +LG++AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLSFFGALGMLAVLNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>gb|KHG01041.1| hypothetical protein F383_21717 [Gossypium arboreum]
Length=125

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF P
Sbjct  50   NDELIWDNGTAFPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYD+L+VELGGEP
Sbjct  110  KVYPYDSLRVELGGEP  125



>gb|KFK31361.1| hypothetical protein AALP_AA6G102500 [Arabis alpina]
Length=125

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV+NDKAS +P+TP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFAALGLLAVFNDKASTVPWTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_003608732.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90929.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
 gb|AFK36027.1| unknown [Medicago truncatula]
Length=125

 Score =   144 bits (363),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASK PF P
Sbjct  50   NEELTWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKTPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_010494996.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Camelina sativa]
Length=125

 Score =   144 bits (362),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV NDKAS +PFT 
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFFAALGLLAVVNDKASTVPFTR  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_011466981.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Fragaria vesca subsp. vesca]
Length=125

 Score =   143 bits (360),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGTPFPEPCIDRIADTVGKYEALAW+ GGL  F  LGL+AVWNDKASKIPF P
Sbjct  50   NDELTWDNGTPFPEPCIDRIADTVGKYEALAWLTGGLSCFVGLGLLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_009400677.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Musa acuminata subsp. malaccensis]
Length=125

 Score =   142 bits (359),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            + +L+WDNGTPFPEPCIDRIA TVGKYEALAW+CGGL FFASLGL+AVWNDKASKIP+ P
Sbjct  50   DHDLLWDNGTPFPEPCIDRIAPTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPYAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>gb|KJB21491.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=126

 Score =   142 bits (358),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF-T  275
            NDEL+WDNGT FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF  
Sbjct  50   NDELIWDNGTAFPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFQA  109

Query  274  PKVYPYDNLKVELGGEP  224
            PKVYPYDNL+VELGGEP
Sbjct  110  PKVYPYDNLRVELGGEP  126



>gb|ACJ84169.1| unknown [Medicago truncatula]
Length=125

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL WDNGTPFPEPCIDRIADTVGKYEA AW+CGGL  FA LGL+AVWNDKASK PF P
Sbjct  50   NEELTWDNGTPFPEPCIDRIADTVGKYEASAWLCGGLSCFAGLGLLAVWNDKASKTPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_008786987.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Phoenix dactylifera]
Length=125

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            +DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+CGGL FFA +GL+ VWNDKASKIP+TP
Sbjct  50   HDELVWDNGTPYPEPCIDRLAPTIGKYEALGWLCGGLSFFAVIGLLTVWNDKASKIPYTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_008796817.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X4 [Phoenix dactylifera]
Length=125

 Score =   140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            +DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+TP
Sbjct  50   HDELVWDNGTPYPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPYTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELG EP
Sbjct  110  KVYPYDNLRVELGEEP  125



>ref|XP_008381184.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Malus domestica]
Length=125

 Score =   139 bits (351),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WD+GT FPEPCIDRI DTVGKYEALAW+CG L  FA LGL+AVWNDKASKIPF P
Sbjct  50   NDELXWDDGTSFPEPCIDRITDTVGKYEALAWLCGSLSCFAXLGLLAVWNDKASKIPFAP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLQVELGGEP  125



>ref|XP_009101407.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Brassica rapa]
Length=143

 Score =   138 bits (348),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 73/94 (78%), Gaps = 18/94 (19%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF--  278
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF  
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFGY  109

Query  277  ----------------TPKVYPYDNLKVELGGEP  224
                            TP+VYPYDNL+VELGGEP
Sbjct  110  LFSPFHGLSLIVLFLQTPRVYPYDNLRVELGGEP  143



>ref|XP_004983722.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Setaria italica]
Length=123

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ A  NDKASKIP+TP
Sbjct  48   NDELLWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGVAAAVNDKASKIPYTP  107

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELG  P
Sbjct  108  KVYPYDNLRVELGDRP  123



>ref|XP_006662581.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Oryza brachyantha]
Length=104

 Score =   135 bits (340),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LGL A  NDKASKIP+TP
Sbjct  29   NDELLWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGLAAALNDKASKIPYTP  88

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+ ELG  P
Sbjct  89   KVYPYDNLREELGDRP  104



>ref|XP_010919523.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Elaeis guineensis]
Length=122

 Score =   135 bits (339),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 3/76 (4%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            +DEL+WDNGTP+PEPC+DR+A T+GKYEAL W+CGGLGFFA+LGL+AVWNDKASK   TP
Sbjct  50   HDELVWDNGTPYPEPCVDRLAPTIGKYEALGWLCGGLGFFATLGLLAVWNDKASK---TP  106

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  107  KVYPYDNLRVELGGEP  122



>ref|XP_003574306.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Brachypodium distachyon]
Length=125

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASKIPFTP
Sbjct  50   NDELVWDNGTPFPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVANDKASKIPFTP  109

Query  271  KVYPYDNLKVELG  233
            K+YPYDNL+VELG
Sbjct  110  KIYPYDNLRVELG  122



>ref|NP_001131355.1| uncharacterized protein LOC100192676 [Zea mays]
 gb|ACG35760.1| hypothetical protein [Zea mays]
Length=123

 Score =   134 bits (337),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+TP
Sbjct  48   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTP  107

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+ ELG  P
Sbjct  108  KVYPYDNLRAELGDRP  123



>ref|XP_008659963.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Zea mays]
Length=89

 Score =   132 bits (333),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+TP
Sbjct  14   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTP  73

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+ ELG  P
Sbjct  74   KVYPYDNLRAELGDRP  89



>ref|XP_006440353.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 ref|XP_006477235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Citrus sinensis]
 gb|ESR53593.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61490.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=125

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEAL W+ GGLGFFASLG +AVWNDKASKIPFTP
Sbjct  50   NDELVWDNGTPFPEPCIDRIADTVGKYEALGWLLGGLGFFASLGALAVWNDKASKIPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  110  KVYPYDNLRVELGGEP  125



>ref|XP_008659958.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Zea mays]
 gb|ACF79732.1| unknown [Zea mays]
Length=123

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+TP
Sbjct  48   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTP  107

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+ ELG  P
Sbjct  108  KVYPYDNLRAELGDRP  123



>ref|NP_001065325.1| Os10g0551600 [Oryza sativa Japonica Group]
 gb|AAG13469.1|AC026758_6 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54938.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27162.1| Os10g0551600 [Oryza sativa Japonica Group]
 dbj|BAG88471.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51371.1| hypothetical protein OsJ_32392 [Oryza sativa Japonica Group]
Length=125

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LGL A  NDKASKIP+TP
Sbjct  50   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGLAATLNDKASKIPYTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYP+DNL+ ELG  P
Sbjct  110  KVYPFDNLREELGDRP  125



>ref|NP_001142497.1| uncharacterized protein LOC100274725 [Zea mays]
 gb|ACG24387.1| hypothetical protein [Zea mays]
 gb|ACG30533.1| hypothetical protein [Zea mays]
 gb|ACG44917.1| hypothetical protein [Zea mays]
 gb|ACG47173.1| hypothetical protein [Zea mays]
 tpg|DAA46215.1| TPA: hypothetical protein ZEAMMB73_636535 [Zea mays]
Length=125

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKASKIP+TP
Sbjct  50   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGVAAVVNDKASKIPYTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYD+L+ ELG  P
Sbjct  110  KVYPYDSLRAELGDRP  125



>ref|NP_001144293.1| uncharacterized protein LOC100277176 [Zea mays]
 gb|ACG39358.1| hypothetical protein [Zea mays]
Length=123

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV N+KASKIP+TP
Sbjct  48   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGVAAVVNNKASKIPYTP  107

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+ ELG  P
Sbjct  108  KVYPYDNLRAELGDRP  123



>dbj|BAJ85316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=125

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASK+P+TP
Sbjct  50   NDELVWDNGTPFPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVVNDKASKMPYTP  109

Query  271  KVYPYDNLKVELG  233
            KVYPYDNL+VELG
Sbjct  110  KVYPYDNLRVELG  122



>ref|XP_002467527.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
 gb|EER94525.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
Length=124

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA LG+ A  NDKASKIP+TP
Sbjct  48   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAVLGVAAAVNDKASKIPYTP  107

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+ ELG  P
Sbjct  108  KVYPYDNLRAELGDRP  123



>gb|EEC67413.1| hypothetical protein OsI_34583 [Oryza sativa Indica Group]
Length=125

 Score =   132 bits (332),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LGL A  N+KASKIP+TP
Sbjct  50   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGLAATLNNKASKIPYTP  109

Query  271  KVYPYDNLKVELGGEP  224
            KVYP+DNL+ ELG  P
Sbjct  110  KVYPFDNLREELGDRP  125



>gb|AGL09494.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Thottea 
sp. JN-2013]
Length=77

 Score =   130 bits (326),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A T+GKYEALAW+CGGL FFASLGL+AVWNDKASKIPFTP
Sbjct  12   NDELVWDNGTPFPEPCIDRLAPTIGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFTP  71

Query  271  KVYPYD  254
            KVYPYD
Sbjct  72   KVYPYD  77



>gb|AGL09491.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Manekia 
incurva]
Length=77

 Score =   129 bits (325),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGLMAVWNDKASKIPFTP
Sbjct  12   NDELVWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLMAVWNDKASKIPFTP  71

Query  271  KVYPYD  254
            KVYPYD
Sbjct  72   KVYPYD  77



>gb|AGL09493.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Piper 
nigrum]
Length=77

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N+EL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTP
Sbjct  12   NEELVWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTP  71

Query  271  KVYPYD  254
            KVYPYD
Sbjct  72   KVYPYD  77



>gb|AGL09486.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asimina 
triloba]
Length=78

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDR+A T+GKYEAL W+CGGLGFFA+LGL+AVWNDKASKIPFTP
Sbjct  12   NDELVWDNGTPFPEPCIDRLAPTIGKYEALGWLCGGLGFFATLGLLAVWNDKASKIPFTP  71

Query  271  KVYPYDN  251
            KVYPYD 
Sbjct  72   KVYPYDK  78



>gb|AGL09485.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asarum 
caudatum]
Length=77

 Score =   127 bits (320),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGL+AVWNDKASKIPFTP
Sbjct  12   NDELTWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFTP  71

Query  271  KVYPYD  254
            KVYPYD
Sbjct  72   KVYPYD  77



>gb|AGL09488.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Chloranthus 
fortunei]
Length=78

 Score =   127 bits (319),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIA  +GKYEAL W+CGGL FFASLGL+AVWNDKASKIPFTP
Sbjct  12   NDELIWDNGTPFPEPCIDRIAPHIGKYEALGWLCGGLSFFASLGLLAVWNDKASKIPFTP  71

Query  271  KVYPYDN  251
            KVYPYD 
Sbjct  72   KVYPYDK  78



>gb|AGL09497.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Zippelia 
begoniifolia]
Length=77

 Score =   127 bits (319),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            +DEL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGL FFASLGL+AVWNDKASK+PFTP
Sbjct  12   HDELIWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKVPFTP  71

Query  271  KVYPYD  254
            KVYPYD
Sbjct  72   KVYPYD  77



>gb|AGL09496.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Xymalos 
monospora]
Length=78

 Score =   125 bits (314),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIA ++GKYEALAW  GGLGFFAS+GL+AVWNDKASK+PFTP
Sbjct  12   NDELVWDNGTPFPEPCIDRIAPSIGKYEALAWWLGGLGFFASIGLLAVWNDKASKVPFTP  71

Query  271  KVYPYDN  251
            KVYPYD 
Sbjct  72   KVYPYDK  78



>gb|AFP49345.1| hypothetical protein, partial [Olea europaea]
Length=64

 Score =   124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = -1

Query  406  CIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  227
            CIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VELGGE
Sbjct  4    CIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELGGE  63

Query  226  P  224
            P
Sbjct  64   P  64



>gb|AGL09492.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Peperomia 
prostrata]
Length=78

 Score =   123 bits (309),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            +DEL WDNGTP+PEPCIDRIA  +GKYEALAW+CGGLGFF SLGL++VWNDKAS IPFTP
Sbjct  12   DDELTWDNGTPYPEPCIDRIAPNIGKYEALAWLCGGLGFFTSLGLLSVWNDKASSIPFTP  71

Query  271  KVYPYDN  251
            KVYPYD 
Sbjct  72   KVYPYDK  78



>gb|AGL09487.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Calycanthus 
occidentalis]
Length=78

 Score =   123 bits (308),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTP+PEPC+DR+A ++GKYEALAW+CGGLGFFA+LGL AVWNDKASK+PFTP
Sbjct  12   NDELVWDNGTPYPEPCLDRLAPSIGKYEALAWLCGGLGFFAALGLAAVWNDKASKVPFTP  71

Query  271  KVYPYDN  251
            KVY YD 
Sbjct  72   KVYXYDK  78



>ref|NP_568684.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FGK0.1|NDUB8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL58924.1|AF462836_1 AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 dbj|BAB09083.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM19870.1| AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 gb|AAM61542.1| unknown [Arabidopsis thaliana]
 gb|AED95533.1| uncharacterized protein AT5G47570 [Arabidopsis thaliana]
Length=125

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEALAW+ GGLGFF  LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFFVGLGLLAVLNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_010518861.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Tarenaya hassleriana]
Length=137

 Score =   122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPC+DRIADTVGKYEAL W+CGGLGFF +LGL AVWNDKASKIPFTP
Sbjct  50   NDELVWDNGTAFPEPCVDRIADTVGKYEALGWLCGGLGFFVTLGLAAVWNDKASKIPFTP  109

Query  271  KVY  263
            KV+
Sbjct  110  KVF  112



>ref|XP_002863335.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39594.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
Length=125

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEALAW+ GGLGFFA LGL+AV NDKASK+PFTP
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFFAGLGLLAVLNDKASKVPFTP  109

Query  271  KVYPYDNLKVELGGEP  224
            +VYPYDNL+VELGGEP
Sbjct  110  RVYPYDNLRVELGGEP  125



>ref|XP_010264245.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Nelumbo nucifera]
Length=115

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            NDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIPF 
Sbjct  50   NDELLWDNGTPFPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPFV  108



>ref|XP_010258984.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=113

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            NDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS IPF
Sbjct  50   NDELVWDNGTPFPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASXIPF  107



>gb|AGL09489.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hernandia 
nymphaeifolia]
Length=78

 Score =   117 bits (294),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPC+DRIA T+GKYE L W  GGLGFFAS+GL+AVWNDKASKIP+TP
Sbjct  12   NDELVWDNGTPFPEPCLDRIAPTMGKYETLVWWFGGLGFFASIGLLAVWNDKASKIPYTP  71

Query  271  KVYPYDN  251
            KV PYD 
Sbjct  72   KVXPYDK  78



>gb|ABK23873.1| unknown [Picea sitchensis]
 gb|ABR17760.1| unknown [Picea sitchensis]
 gb|ACN39914.1| unknown [Picea sitchensis]
Length=130

 Score =   119 bits (298),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIAD-TVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
              EL+WD+G+ +PEP +DRIA   +GKYEALAW+CGGL FF  +GL+AVWNDKASKIP+T
Sbjct  45   QHELIWDDGSAYPEPALDRIAAPQIGKYEALAWLCGGLSFFGLVGLLAVWNDKASKIPYT  104

Query  274  PKVYPYDNLKVELGGEP  224
            PK YP+DNL+VELGG+P
Sbjct  105  PKEYPFDNLRVELGGDP  121



>gb|KDP39850.1| hypothetical protein JCGZ_03381 [Jatropha curcas]
Length=117

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIP+ 
Sbjct  50   NEELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPYN  108



>gb|AGL09495.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Verhuellia 
lunaria]
Length=77

 Score =   115 bits (289),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  445  ELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKV  266
            +L+WDNG+ F EPCIDRIA TVGKYEAL W+CGGL FFA LGL+AVWNDKASKIPFTPKV
Sbjct  14   DLIWDNGSAFQEPCIDRIAPTVGKYEALGWLCGGLSFFAGLGLLAVWNDKASKIPFTPKV  73

Query  265  YPYD  254
            YPYD
Sbjct  74   YPYD  77



>gb|ABD64927.1| hypothetical protein 24.t00002 [Brassica oleracea]
Length=126

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF  
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFVS  109

Query  271  KVY  263
             +Y
Sbjct  110  DLY  112



>gb|ABD64969.1| hypothetical protein 25.t00006 [Brassica oleracea]
Length=134

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF  
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFVS  109

Query  271  KV  266
            ++
Sbjct  110  EI  111



>ref|XP_011018295.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Populus euphratica]
Length=118

 Score =   116 bits (290),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            NDELMWDNGT FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPF  107



>emb|CDY25957.1| BnaC09g20300D [Brassica napus]
Length=553

 Score =   123 bits (308),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF  
Sbjct  477  NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFVS  536

Query  271  KVY  263
             +Y
Sbjct  537  DLY  539



>ref|XP_010695116.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=128

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            NDEL WDNGT FPEPCIDRIADTVGKYEALAW+CGGLGFFA+LGL AVWNDKASK PF 
Sbjct  50   NDELTWDNGTSFPEPCIDRIADTVGKYEALAWLCGGLGFFATLGLAAVWNDKASKYPFV  108



>ref|XP_001753451.1| predicted protein [Physcomitrella patens]
 gb|EDQ81674.1| predicted protein [Physcomitrella patens]
Length=102

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            N EL+WD+G+PFPEPC+D +A  VGKYEALAW+ GG+G FA +G +A WNDKAS+IP+ P
Sbjct  28   NAELIWDDGSPFPEPCLDNVAPMVGKYEALAWLLGGMGLFAGIGGLAAWNDKASRIPWAP  87

Query  271  KVYPYDNLKVELGGE  227
            + YPYD+LKVELG E
Sbjct  88   REYPYDDLKVELGKE  102



>ref|XP_006368197.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
 gb|ERP64766.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
Length=118

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            NDEL WDNGT FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  50   NDELTWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPF  107



>emb|CBI31907.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            NDEL+WDNGTPFPEPCIDRIA+TVGKYEALAWMCGGL FFASLGL+AVWNDKASKIPF
Sbjct  18   NDELIWDNGTPFPEPCIDRIAETVGKYEALAWMCGGLSFFASLGLLAVWNDKASKIPF  75



>ref|XP_006355519.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=142

 Score =   114 bits (286),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPF P
Sbjct  50   NDELTWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFFP  109

Query  271  KVYPYDNL  248
               P ++L
Sbjct  110  TT-PSEHL  116



>gb|ABD64995.1| hypothetical protein 26.t00015 [Brassica oleracea]
Length=125

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGL FFA+LG++AV NDKASK+PF  
Sbjct  50   NDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLSFFAALGMLAVLNDKASKVPFVS  109

Query  271  K  269
            +
Sbjct  110  E  110



>ref|XP_003608733.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90930.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
Length=117

 Score =   110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            N+EL WDNGTPFPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASK PF 
Sbjct  50   NEELTWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKTPFV  108



>ref|XP_008796813.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Phoenix dactylifera]
Length=132

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            +DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+ 
Sbjct  50   HDELVWDNGTPYPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPYV  108



>ref|XP_008796814.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X3 [Phoenix dactylifera]
Length=128

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            +DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+
Sbjct  50   HDELVWDNGTPYPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPY  107



>ref|XP_008796812.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Phoenix dactylifera]
Length=156

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            +DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+
Sbjct  50   HDELVWDNGTPYPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPY  107



>gb|AFW87915.1| hypothetical protein ZEAMMB73_145461 [Zea mays]
Length=117

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+
Sbjct  48   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPY  105



>gb|EMT16400.1| hypothetical protein F775_28617 [Aegilops tauschii]
Length=115

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            NDEL+WDNGTPFPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASK+P+ 
Sbjct  50   NDELVWDNGTPFPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVVNDKASKMPYA  108



>ref|XP_002440834.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
 gb|EES19264.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
Length=61

 Score =   101 bits (251),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+C GLGFFA+LG+ A  NDKASKIP+
Sbjct  4    NDELLWDNGTPFPEPCIDRLAPHIGKYEALAWLCRGLGFFAALGVAAAVNDKASKIPY  61



>ref|XP_006440354.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|ESR53594.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61491.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=112

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGTPFPEPCIDRIADTVGKYEAL W+ GGLGFFASLG +AVWNDKASKIPF  
Sbjct  50   NDELVWDNGTPFPEPCIDRIADTVGKYEALGWLLGGLGFFASLGALAVWNDKASKIPFVS  109

Query  271  K  269
            +
Sbjct  110  R  110



>gb|ADY38662.1| hypothetical protein [Wolffia arrhiza]
Length=91

 Score = 91.7 bits (226),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMA  311
            NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFASLGL+A
Sbjct  44   NDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFASLGLLA  90



>ref|XP_010934141.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 beta subcomplex subunit 8, mitochondrial [Elaeis guineensis]
Length=160

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            +DEL+ DNGTP PEPC DR+A T+GKYEAL W+ GGLGFFA+LGL+AVWNDKASK+P+
Sbjct  52   HDELVXDNGTPCPEPCXDRLAATIGKYEALGWLGGGLGFFATLGLLAVWNDKASKVPY  109



>gb|AGU36714.1| kinesin-related protein, partial [Helianthus petiolaris]
 gb|AGU36719.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36720.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36722.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36723.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36725.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36726.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36730.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36732.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36733.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36735.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36736.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36737.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36738.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  400  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+ 
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPYV  42



>gb|AGU36718.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  400  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+ 
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPYV  42



>gb|AGU36715.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36717.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36721.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36727.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36728.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36729.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36731.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36734.1| kinesin-related protein, partial [Helianthus annuus]
Length=41

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  400  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36716.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  400  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36724.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  400  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  278
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|KJB51917.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=93

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 42/76 (55%), Gaps = 32/76 (42%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGK                                 P
Sbjct  50   NDELIWDNGTAFPEPCIDRIADTVGK--------------------------------AP  77

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  78   KVYPYDNLRVELGGEP  93



>gb|KJB21489.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=93

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 42/76 (55%), Gaps = 32/76 (42%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            NDEL+WDNGT FPEPCIDRIADTVGK                                 P
Sbjct  50   NDELIWDNGTAFPEPCIDRIADTVGK--------------------------------AP  77

Query  271  KVYPYDNLKVELGGEP  224
            KVYPYDNL+VELGGEP
Sbjct  78   KVYPYDNLRVELGGEP  93



>ref|NP_001236148.1| uncharacterized protein LOC100306514 [Glycine max]
 gb|ACU14719.1| unknown [Glycine max]
Length=166

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  214  QIPTALLQAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQ  393
             +P    QAPL+ CHM I  V    W+LCHS QP++   +K  I HT++PMLHTF++ +Q
Sbjct  31   DLPMVHHQAPLADCHMDILWVQTVSWRLCHSTQPTIPATRKNSIPHTARPMLHTFRQCQQ  90

Query  394  YDQYRVPGTESHCPT*VHH  450
            YD Y V   +  CPT V H
Sbjct  91   YDLYTVREMQCRCPTGVPH  109



>ref|XP_003064828.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51162.1| predicted protein [Micromonas pusilla CCMP1545]
Length=303

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -1

Query  445  ELMWDNGTPFPEPCIDRIADTV-GKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  269
            EL WD G   PE  +D++ + V  K  A A +  GLGFF  L   A + DKAS +PF P+
Sbjct  222  ELTWDIGDGNPESALDKVPENVLSKRGAAALLATGLGFFVGLYHFAGYLDKASTVPFAPR  281

Query  268  VYPYDNLKVELGGE  227
             YPY+NLK ELGG 
Sbjct  282  TYPYNNLKEELGGH  295



>ref|XP_005649552.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25008.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
Length=144

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTP  272
            +DEL+WD+G+  PE C+D+    V KYEAL ++ GGLGF+  LG +A +NDKASK P+  
Sbjct  45   HDELLWDDGSAQPEHCLDQFP-LVPKYEALGFLLGGLGFYFLLGQLARFNDKASKKPYVD  103

Query  271  KVYPYDNLKVELGG  230
            K YPYDNLK E+GG
Sbjct  104  KEYPYDNLKAEMGG  117



>ref|XP_002504368.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65626.1| predicted protein [Micromonas sp. RCC299]
Length=132

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGK-YEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
              EL WD G  +PEP +D +   + K  EA A++ GGLG F S+  +A   DK S  PF 
Sbjct  58   ESELTWDCGDAYPEPALDVVPPHIVKPAEAAAYLFGGLGVFYSIYSLAKVVDKPSTQPFA  117

Query  274  PKVYPYDNLKVELG  233
             K +P+DNLK ELG
Sbjct  118  DKQFPFDNLKTELG  131



>gb|AFK49234.1| unknown [Lotus japonicus]
Length=125

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +1

Query  235  QAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQYDQYRVP  414
            ++ L  CHM    V M  W+L HS  P++ E Q   I H ++PMLHTFQ+Y+Q D YRV 
Sbjct  5    KSSLPDCHMDTLWVQMESWRLYHSTLPTIPETQNNSIPHRARPMLHTFQQYQQCDLYRVR  64

Query  415  GTESHCPT*VHH  450
              + H PT VHH
Sbjct  65   VMKYHYPTQVHH  76



>ref|XP_001420082.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98375.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=125

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (53%), Gaps = 1/72 (1%)
 Frame = -1

Query  445  ELMWDNGTPFPEPCIDRI-ADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  269
            EL WD G   PEP +D + A  V K  A  ++     F   +  +A   DK S  PF PK
Sbjct  52   ELTWDAGDAHPEPALDDVPARIVTKARAATYLASAFAFLGGVYGLATMVDKPSTTPFAPK  111

Query  268  VYPYDNLKVELG  233
             +PY+ L+VELG
Sbjct  112  TFPYNGLEVELG  123



>gb|KCW71992.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=91

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGK  374
            NDEL+WDNGT FPEPCIDRIADTVGK
Sbjct  50   NDELVWDNGTAFPEPCIDRIADTVGK  75



>gb|KJB21490.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=100

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKY  371
            NDEL+WDNGT FPEPCIDRIADTVGK 
Sbjct  50   NDELIWDNGTAFPEPCIDRIADTVGKV  76



>emb|CEF99290.1| unnamed product [Ostreococcus tauri]
Length=93

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = -1

Query  445  ELMWDNGTPFPEPCIDRIAD-TVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  269
            EL WD G    EP +D + +  V K  A  ++ G   F   +   AV  DK SK PF PK
Sbjct  20   ELTWDAGDKHHEPALDDVPEHIVTKNRAATYLVGAFCFLGCVYGTAVMVDKPSKTPFVPK  79

Query  268  VYPYDNLKVELGGE  227
             +PY+ L  ELG E
Sbjct  80   EFPYNGLAKELGRE  93



>ref|XP_003081497.1| unnamed protein product [Ostreococcus tauri]
Length=123

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = -1

Query  445  ELMWDNGTPFPEPCIDRIAD-TVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  269
            EL WD G    EP +D + +  V K  A  ++ G   F   +   AV  DK SK PF PK
Sbjct  50   ELTWDAGDKHHEPALDDVPEHIVTKNRAATYLVGAFCFLGCVYGTAVMVDKPSKTPFVPK  109

Query  268  VYPYDNLKVELGGE  227
             +PY+ L  ELG E
Sbjct  110  EFPYNGLAKELGRE  123



>ref|XP_010229345.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brachypodium distachyon]
Length=108

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 41/100 (41%), Gaps = 37/100 (37%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIP---  281
            N+EL+WDNGTPFP           G             FFA+LGL AV + K   +P   
Sbjct  18   NEELVWDNGTPFP-----------GDLRRPPRAPTSARFFAALGLAAVVSAKMPHVPDLG  66

Query  280  -----------------------FTPKVYPYDNLKVELGG  230
                                     PKVYPYDNL VELGG
Sbjct  67   EVRRASEPLSLTILLSSTLAWQCLAPKVYPYDNLTVELGG  106



>ref|XP_007510211.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18556.1| predicted protein [Bathycoccus prasinos]
Length=145

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 40/76 (53%), Gaps = 2/76 (3%)
 Frame = -1

Query  451  NDELMWDNGTPFPEPCIDRI-ADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  275
              EL+WD G   PE  +D + A  VGKYEAL  + G L F   +   A + DKA+  PF 
Sbjct  71   EHELIWDAGDKHPETALDNLPAKIVGKYEALGMLVGALCFMGGVYTFAGYYDKAASRPFV  130

Query  274  PKVYPYDNLKVELGGE  227
             +     +LK ELGG 
Sbjct  131  ERDME-KSLKKELGGR  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553272586920