BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049M02

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  105   1e-24   Citrus sinensis [apfelsine]
gb|KJB30572.1|  hypothetical protein B456_005G149900                    108   2e-24   Gossypium raimondii
gb|KJB30571.1|  hypothetical protein B456_005G149900                    108   3e-24   Gossypium raimondii
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            108   8e-24   
emb|CDM86692.1|  unnamed protein product                                107   9e-24   Triticum aestivum [Canadian hard winter wheat]
emb|CDM86696.1|  unnamed protein product                                107   1e-23   Triticum aestivum [Canadian hard winter wheat]
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            105   2e-23   
emb|CDM86687.1|  unnamed protein product                                106   2e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             106   2e-23   Citrus clementina [clementine]
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            105   3e-23   Triticum urartu
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    105   6e-23   Pyrus x bretschneideri [bai li]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            105   6e-23   Glycine max [soybeans]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   7e-23   Cicer arietinum [garbanzo]
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              104   1e-22   Gossypium arboreum [tree cotton]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            104   1e-22   Phoenix dactylifera
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   1e-22   Fragaria vesca subsp. vesca
emb|CBI28940.3|  unnamed protein product                              97.8    1e-22   Vitis vinifera
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-22   Populus euphratica
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-22   Populus euphratica
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            103   2e-22   Solanum lycopersicum
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       103   2e-22   
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    103   3e-22   Pyrus x bretschneideri [bai li]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   103   3e-22   Citrus sinensis [apfelsine]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    103   3e-22   
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   3e-22   Citrus sinensis [apfelsine]
ref|XP_007026054.1|  MATE efflux family protein isoform 1               103   3e-22   
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             103   3e-22   Citrus clementina [clementine]
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   4e-22   Populus euphratica
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            102   4e-22   Solanum lycopersicum
gb|KJB69293.1|  hypothetical protein B456_011G014800                    102   4e-22   Gossypium raimondii
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like  98.6    4e-22   
ref|XP_007045633.1|  MATE efflux family protein isoform 1               102   5e-22   
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g           99.0    5e-22   
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   6e-22   Cicer arietinum [garbanzo]
emb|CDM86680.1|  unnamed protein product                                100   8e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   9e-22   Populus euphratica
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    100   9e-22   Brachypodium distachyon [annual false brome]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            102   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   1e-21   Oryza brachyantha
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   1e-21   
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP11780.1|  unnamed protein product                                101   1e-21   Coffea canephora [robusta coffee]
gb|AFW68307.1|  putative MATE efflux family protein                     100   2e-21   
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    101   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   2e-21   Elaeis guineensis
ref|XP_007026056.1|  MATE efflux family protein                         101   2e-21   
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            100   2e-21   
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                          99.8    2e-21   Triticum urartu
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   2e-21   Glycine max [soybeans]
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             100   2e-21   
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            100   2e-21   Glycine soja [wild soybean]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   2e-21   Elaeis guineensis
ref|XP_003596992.1|  Transparent testa 12 protein                       100   2e-21   Medicago truncatula
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             100   2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   3e-21   
ref|NP_001148084.1|  transparent testa 12 protein                       100   3e-21   Zea mays [maize]
emb|CDX98711.1|  BnaA03g44960D                                          100   3e-21   
gb|ACF85423.1|  unknown                                                 100   3e-21   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                      100   3e-21   Zea mays [maize]
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   3e-21   Brassica rapa
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            100   3e-21   Nelumbo nucifera [Indian lotus]
gb|ACZ55932.1|  MATE transporter 2                                      100   3e-21   Zea mays [maize]
emb|CDX94061.1|  BnaC07g36950D                                          100   3e-21   
gb|AAR00628.1|  putative MATE family protein                          99.4    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    100   3e-21   Vitis vinifera
emb|CBI28938.3|  unnamed protein product                              99.4    4e-21   Vitis vinifera
ref|NP_188806.1|  MATE efflux family protein                            100   4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20595.1|  integral membrane protein, putative                     100   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883313.1|  mate efflux family protein                         100   4e-21   
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            100   4e-21   Vitis vinifera
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   4e-21   Nicotiana sylvestris
emb|CDP11781.1|  unnamed protein product                              99.0    5e-21   Coffea canephora [robusta coffee]
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   5e-21   Nicotiana tomentosiformis
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   5e-21   Solanum tuberosum [potatoes]
ref|XP_002518492.1|  multidrug resistance pump, putative              99.8    5e-21   Ricinus communis
emb|CDM86677.1|  unnamed protein product                              99.8    5e-21   Triticum aestivum [Canadian hard winter wheat]
emb|CAN73203.1|  hypothetical protein VITISV_008169                   97.4    5e-21   Vitis vinifera
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                          99.8    5e-21   
gb|ACL53378.1|  unknown                                               99.4    5e-21   Zea mays [maize]
emb|CBI28937.3|  unnamed protein product                                100   6e-21   Vitis vinifera
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12          99.8    6e-21   Vitis vinifera
gb|EEC75604.1|  hypothetical protein OsI_12313                        99.4    7e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g           99.4    7e-21   Phaseolus vulgaris [French bean]
ref|NP_001050520.1|  Os03g0570800                                     99.4    7e-21   
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  99.4    8e-21   
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  99.0    9e-21   Nicotiana tomentosiformis
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.4    9e-21   Setaria italica
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g           99.0    9e-21   
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                          99.4    1e-20   Glycine soja [wild soybean]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  99.0    1e-20   Cicer arietinum [garbanzo]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.0    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  99.0    1e-20   Cicer arietinum [garbanzo]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.0    1e-20   Sesamum indicum [beniseed]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     99.0    1e-20   Cucumis melo [Oriental melon]
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  99.0    1e-20   Nicotiana tomentosiformis
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    1e-20   Setaria italica
gb|KJB57729.1|  hypothetical protein B456_009G178100                  97.1    2e-20   Gossypium raimondii
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.7    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002886501.1|  mate efflux family protein                       98.6    2e-20   
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.2    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.1    2e-20   Populus euphratica
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...  94.0    2e-20   Nicotiana alata [flowering tobacco]
dbj|BAH20308.1|  AT1G61890                                            96.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.2    2e-20   Elaeis guineensis
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                          98.2    2e-20   Triticum urartu
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410        97.4    3e-20   
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.8    3e-20   Nicotiana sylvestris
emb|CDY34833.1|  BnaA09g47590D                                        97.1    3e-20   Brassica napus [oilseed rape]
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.4    3e-20   Brassica rapa
emb|CDX76391.1|  BnaA08g10090D                                        97.4    3e-20   
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg           96.3    4e-20   
gb|KDP20758.1|  hypothetical protein JCGZ_21229                       97.4    4e-20   Jatropha curcas
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g           97.4    4e-20   Phaseolus vulgaris [French bean]
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.4    4e-20   Elaeis guineensis
ref|NP_001147791.1|  transparent testa 12 protein                     97.4    4e-20   Zea mays [maize]
ref|NP_564787.1|  MATE efflux family protein                          97.1    4e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47166.1|  BnaA01g22920D                                        97.1    5e-20   Brassica napus [oilseed rape]
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.1    5e-20   Cucumis sativus [cucumbers]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.1    5e-20   Brassica rapa
gb|KJB57730.1|  hypothetical protein B456_009G178100                  97.1    5e-20   Gossypium raimondii
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12          97.1    5e-20   Tarenaya hassleriana [spider flower]
gb|KJB57728.1|  hypothetical protein B456_009G178100                  97.1    5e-20   Gossypium raimondii
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.1    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12          97.1    6e-20   
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.1    6e-20   Malus domestica [apple tree]
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.1    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12          96.7    6e-20   Brassica rapa
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    6e-20   Cucumis melo [Oriental melon]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    7e-20   Fragaria vesca subsp. vesca
dbj|BAJ34540.1|  unnamed protein product                              96.7    7e-20   Eutrema halophilum
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    7e-20   Sesamum indicum [beniseed]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    7e-20   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.7    7e-20   
gb|AAK82541.1|  At1g61890/F8K4_9                                      96.7    8e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25329.1|  BnaC01g29980D                                        96.3    8e-20   Brassica napus [oilseed rape]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.9    8e-20   
ref|XP_002867813.1|  mate efflux family protein                       96.7    8e-20   Arabidopsis lyrata subsp. lyrata
gb|ACF85024.1|  unknown                                               92.8    8e-20   Zea mays [maize]
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg           96.3    8e-20   Eutrema salsugineum [saltwater cress]
gb|AHI48506.1|  multidrug and toxic extrusion transporter             96.7    8e-20   Vaccinium corymbosum [American blueberry]
emb|CDY19507.1|  BnaC09g13960D                                        96.3    9e-20   Brassica napus [oilseed rape]
emb|CDY12916.1|  BnaA09g13580D                                        96.3    9e-20   Brassica napus [oilseed rape]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.3    9e-20   Brassica rapa
emb|CBI23253.3|  unnamed protein product                              93.6    9e-20   Vitis vinifera
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg           96.3    1e-19   Capsella rubella
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.3    1e-19   Solanum tuberosum [potatoes]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein            96.3    1e-19   Gossypium arboreum [tree cotton]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     96.3    1e-19   Eucalyptus grandis [rose gum]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg              96.3    1e-19   Erythranthe guttata [common monkey flower]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein         95.9    1e-19   Nicotiana tabacum [American tobacco]
emb|CBI23254.3|  unnamed protein product                              95.1    1e-19   Vitis vinifera
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.5    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_003605914.1|  Transparent testa 12 protein                     95.9    1e-19   Medicago truncatula
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                  95.9    1e-19   Arabis alpina [alpine rockcress]
emb|CDY07257.1|  BnaC04g19140D                                        94.0    2e-19   
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.9    2e-19   
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  95.5    2e-19   Nicotiana tomentosiformis
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.9    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.9    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.9    2e-19   Prunus mume [ume]
emb|CDY27431.1|  BnaC03g64710D                                        95.5    2e-19   Brassica napus [oilseed rape]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g           95.5    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.5    2e-19   Brassica rapa
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg           95.5    2e-19   Capsella rubella
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.1    2e-19   
gb|AAM62936.1|  unknown                                               95.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567640.1|  MATE efflux family protein                          95.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.5    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP04390.1|  unnamed protein product                              94.7    2e-19   Coffea canephora [robusta coffee]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12          95.5    2e-19   Vitis vinifera
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                   94.0    2e-19   Eucalyptus grandis [rose gum]
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                          94.7    2e-19   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.5    2e-19   
dbj|BAH19969.1|  AT4G21910                                            95.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                          95.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.5    2e-19   
emb|CAN82750.1|  hypothetical protein VITISV_014577                   94.0    2e-19   Vitis vinifera
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     95.1    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.5    2e-19   
emb|CDX94063.1|  BnaC07g36970D                                        95.1    2e-19   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  95.1    3e-19   
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12          95.1    3e-19   
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.0    3e-19   
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  94.7    3e-19   Nicotiana sylvestris
emb|CDY34637.1|  BnaC08g41960D                                        94.4    3e-19   Brassica napus [oilseed rape]
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg           94.4    4e-19   Eutrema salsugineum [saltwater cress]
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    5e-19   Solanum lycopersicum
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg           94.4    5e-19   Capsella rubella
emb|CDY27434.1|  BnaC03g64740D                                        94.4    5e-19   Brassica napus [oilseed rape]
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.4    5e-19   Solanum lycopersicum
emb|CDP17486.1|  unnamed protein product                              94.4    5e-19   Coffea canephora [robusta coffee]
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  94.0    5e-19   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg           94.0    6e-19   
ref|NP_001149176.1|  transparent testa 12 protein                     94.0    6e-19   Zea mays [maize]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein             94.0    6e-19   
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.0    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  94.0    7e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.0    7e-19   Vitis vinifera
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.6    7e-19   Nicotiana tomentosiformis
gb|EEC75606.1|  hypothetical protein OsI_12318                        94.0    8e-19   Oryza sativa Indica Group [Indian rice]
gb|ABF97209.1|  MATE efflux family protein, expressed                 93.6    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007026057.1|  MATE efflux family protein                       93.6    8e-19   
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.4    9e-19   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.6    1e-18   
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg           92.0    1e-18   
emb|CDX98712.1|  BnaA03g44970D                                        93.2    1e-18   
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  93.2    1e-18   Elaeis guineensis
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100        93.2    1e-18   Sorghum bicolor [broomcorn]
emb|CBI23251.3|  unnamed protein product                              92.4    1e-18   Vitis vinifera
ref|NP_001050524.1|  Os03g0572900                                     92.8    1e-18   
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12          93.2    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.2    1e-18   Prunus mume [ume]
gb|EEC75610.1|  hypothetical protein OsI_12322                        92.8    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  92.8    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    2e-18   
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg           92.4    2e-18   Citrus clementina [clementine]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.4    2e-18   Cucumis sativus [cucumbers]
ref|NP_001142368.1|  uncharacterized protein LOC100274540             92.0    2e-18   Zea mays [maize]
emb|CDX98713.1|  BnaA03g44980D                                        92.0    2e-18   
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12          92.4    2e-18   Vitis vinifera
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140        92.0    3e-18   Sorghum bicolor [broomcorn]
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg           92.0    3e-18   Eutrema salsugineum [saltwater cress]
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg           92.0    3e-18   Capsella rubella
gb|AGT17221.1|  transparent testa 12 protein                          92.0    3e-18   Saccharum hybrid cultivar R570
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     92.0    4e-18   Prunus mume [ume]
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g           91.7    4e-18   
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    4e-18   Cucumis melo [Oriental melon]
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                          90.5    4e-18   
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  91.7    4e-18   Citrus sinensis [apfelsine]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    4e-18   Glycine max [soybeans]
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg           91.7    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    4e-18   Setaria italica
emb|CDY64933.1|  BnaCnng45550D                                        91.7    4e-18   Brassica napus [oilseed rape]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                          91.7    4e-18   Glycine soja [wild soybean]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  91.7    4e-18   Populus euphratica
dbj|BAD95082.1|  hypothetical protein                                 88.6    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    5e-18   Fragaria vesca subsp. vesca
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    5e-18   Brassica rapa
emb|CDX79109.1|  BnaA01g11760D                                        91.3    5e-18   
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    5e-18   Brassica rapa
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    5e-18   Brassica rapa
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.3    6e-18   Populus euphratica
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg           91.3    6e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.9    7e-18   Brachypodium distachyon [annual false brome]
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720        90.9    7e-18   Sorghum bicolor [broomcorn]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.9    8e-18   Prunus mume [ume]
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                 89.7    8e-18   Citrus sinensis [apfelsine]
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.5    9e-18   Zea mays [maize]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.5    1e-17   Populus euphratica
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.5    1e-17   Cucumis melo [Oriental melon]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.5    1e-17   Nicotiana sylvestris
ref|XP_006389638.1|  MATE efflux family protein                       90.5    1e-17   
gb|KGN43526.1|  hypothetical protein Csa_7G043680                     90.1    1e-17   Cucumis sativus [cucumbers]
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                  90.1    2e-17   Arabis alpina [alpine rockcress]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                  90.1    2e-17   Arabis alpina [alpine rockcress]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                     90.1    2e-17   Cucumis sativus [cucumbers]
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     90.1    2e-17   Prunus mume [ume]
gb|KEH36840.1|  MATE efflux family protein                            89.7    2e-17   Medicago truncatula
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                 89.7    2e-17   Citrus sinensis [apfelsine]
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg              89.7    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  89.7    2e-17   Sesamum indicum [beniseed]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.4    3e-17   Brachypodium distachyon [annual false brome]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.4    3e-17   Zea mays [maize]
ref|XP_002518495.1|  multidrug resistance pump, putative              89.4    3e-17   Ricinus communis
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  89.0    3e-17   Populus euphratica
emb|CDY71092.1|  BnaAnng36070D                                        84.3    4e-17   Brassica napus [oilseed rape]
gb|EEE67272.1|  hypothetical protein OsJ_24453                        88.2    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    4e-17   Populus euphratica
gb|AGT17223.1|  MATE efflux family protein                            89.0    4e-17   Saccharum hybrid cultivar R570
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    4e-17   Brassica rapa
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.6    4e-17   Brassica rapa
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg           88.6    5e-17   
ref|XP_002518493.1|  multidrug resistance pump, putative              88.6    5e-17   Ricinus communis
ref|NP_001119025.1|  mate efflux domain-containing protein            88.6    5e-17   Arabidopsis thaliana [mouse-ear cress]
gb|EEC82143.1|  hypothetical protein OsI_26198                        88.2    5e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001059785.1|  Os07g0516600                                     88.2    5e-17   
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                  88.2    6e-17   
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    6e-17   
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g           88.2    6e-17   
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg           88.2    6e-17   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  88.2    7e-17   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.8    8e-17   
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.8    8e-17   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.8    9e-17   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1    87.8    9e-17   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...  87.8    1e-16   
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.4    1e-16   
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g           87.4    1e-16   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.0    2e-16   
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.0    2e-16   
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.0    2e-16   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  87.0    2e-16   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  86.7    2e-16   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg           86.7    2e-16   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    3e-16   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  86.3    3e-16   
ref|XP_002867814.1|  mate efflux family protein                       86.3    3e-16   
ref|NP_172632.1|  MATE efflux family protein                          85.9    4e-16   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.9    4e-16   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                       87.0    4e-16   
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.5    6e-16   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    7e-16   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    7e-16   
gb|KGN43522.1|  Mate efflux family protein                            85.1    8e-16   
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    8e-16   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.8    1e-15   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg           84.3    1e-15   
ref|XP_002892653.1|  mate efflux family protein                       84.3    1e-15   
emb|CDM85992.1|  unnamed protein product                              84.3    2e-15   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    2e-15   
emb|CDY33129.1|  BnaCnng07000D                                        84.0    2e-15   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    2e-15   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    2e-15   
gb|AAM98160.1|  unknown protein                                       83.6    3e-15   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  83.2    3e-15   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                          84.0    3e-15   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     82.8    4e-15   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  82.8    5e-15   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                          82.4    8e-15   
gb|EPS67796.1|  hypothetical protein M569_06975                       81.6    1e-14   
emb|CAN69304.1|  hypothetical protein VITISV_021604                   82.8    1e-14   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg           81.6    1e-14   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                          81.6    1e-14   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...  80.9    2e-14   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.9    2e-14   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.5    3e-14   
gb|ADE77677.1|  unknown                                               80.5    3e-14   
gb|ABF97208.1|  MATE efflux family protein, expressed                 79.0    3e-14   
ref|NP_001050521.1|  Os03g0571700                                     79.3    3e-14   
dbj|BAJ90668.1|  predicted protein                                    80.1    4e-14   
gb|EEE59383.1|  hypothetical protein OsJ_11499                        79.3    4e-14   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                     80.1    5e-14   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     79.7    5e-14   
emb|CDY39494.1|  BnaA01g24940D                                        79.7    6e-14   
emb|CDY39493.1|  BnaA01g24950D                                        79.0    1e-13   
emb|CDX94064.1|  BnaC07g36980D                                        78.6    1e-13   
emb|CAN60226.1|  hypothetical protein VITISV_039920                   79.0    1e-13   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                  79.0    1e-13   
emb|CDY38631.1|  BnaA05g19560D                                        78.6    1e-13   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  79.7    1e-13   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.6    1e-13   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg              78.2    2e-13   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg              77.8    2e-13   
emb|CDP04391.1|  unnamed protein product                              77.8    3e-13   
emb|CDY24252.1|  BnaC03g42250D                                        74.7    3e-13   
emb|CDY19294.1|  BnaC01g31860D                                        77.4    3e-13   
emb|CDP22168.1|  unnamed protein product                              71.2    4e-13   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                          77.4    5e-13   
gb|EPS59093.1|  hypothetical protein M569_15717                       73.9    5e-13   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120        76.6    7e-13   
ref|NP_001190793.1|  MATE efflux family protein                       76.3    9e-13   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg              76.3    9e-13   
emb|CDY33131.1|  BnaCnng07020D                                        72.4    1e-12   
emb|CDX92916.1|  BnaA03g36380D                                        75.1    2e-12   
emb|CDY65669.1|  BnaCnng48120D                                        74.7    2e-12   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.7    2e-12   
gb|AGT17222.1|  MATE efflux family protein                            74.3    4e-12   
gb|ABK24492.1|  unknown                                               73.9    5e-12   
emb|CAA17157.1|  putative protein                                     74.3    6e-12   
gb|AAS01962.1|  putative MATE efflux family protein                   73.6    6e-12   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg           73.6    7e-12   
ref|NP_001176767.1|  Os12g0125500                                     68.9    7e-12   
gb|EEC68782.1|  hypothetical protein OsI_37323                        69.7    1e-11   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    2e-11   
gb|ACF80989.1|  unknown                                               66.6    2e-11   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                     72.0    2e-11   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.9    3e-11   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.9    3e-11   
ref|NP_001065641.2|  Os11g0129000                                     68.2    4e-11   
ref|NP_001190792.1|  mate efflux domain-containing protein            70.5    6e-11   
gb|EEE51571.1|  hypothetical protein OsJ_32800                        69.7    8e-11   
emb|CDP20703.1|  unnamed protein product                              69.7    1e-10   
ref|NP_001176328.1|  Os11g0128900                                     69.3    1e-10   
gb|ABA91295.1|  MATE efflux family protein, expressed                 69.3    2e-10   
ref|NP_001066047.1|  Os12g0126000                                     69.3    2e-10   
gb|EEC68785.1|  hypothetical protein OsI_37326                        69.3    2e-10   
gb|ABF97220.1|  MATE efflux family protein, expressed                 68.9    2e-10   
gb|EEC68781.1|  hypothetical protein OsI_37322                        68.6    3e-10   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    4e-10   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    4e-10   
emb|CDP13215.1|  unnamed protein product                              67.8    5e-10   
ref|NP_001176768.1|  Os12g0125800                                     66.2    5e-10   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.1    5e-10   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.8    5e-10   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.4    6e-10   
ref|XP_008455546.1|  PREDICTED: MATE efflux family protein LAL5-like  64.3    9e-10   
ref|XP_006856151.1|  hypothetical protein AMTR_s00059p00169290        66.6    1e-09   
ref|NP_001141051.1|  putative MATE efflux family protein              66.6    1e-09   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     66.6    1e-09   
gb|AHI48503.1|  multidrug and toxic extrusion transporter             66.6    1e-09   
gb|ABA26978.1|  TO22-3                                                62.4    2e-09   
ref|XP_011086620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     66.2    2e-09   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                          66.2    2e-09   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                          66.6    2e-09   
ref|XP_006852295.1|  hypothetical protein AMTR_s00049p00187620        62.8    2e-09   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein            66.2    2e-09   
ref|NP_001065623.1|  Os11g0126100                                     66.2    2e-09   
emb|CDX83628.1|  BnaC07g23680D                                        65.9    2e-09   
dbj|BAJ95959.1|  predicted protein                                    65.9    2e-09   
gb|KJB31160.1|  hypothetical protein B456_005G179100                  66.2    2e-09   
ref|XP_007044785.1|  MATE efflux family protein isoform 2             65.9    2e-09   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.9    2e-09   
ref|XP_007044784.1|  MATE efflux family protein isoform 1             65.9    2e-09   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                        65.9    2e-09   
ref|XP_007044786.1|  MATE efflux family protein isoform 3             65.5    2e-09   
gb|AFK46935.1|  unknown                                               65.9    2e-09   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.9    2e-09   
emb|CBI31189.3|  unnamed protein product                              65.9    2e-09   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.2    3e-09   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.5    3e-09   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                          65.9    3e-09   
ref|XP_006856152.1|  hypothetical protein AMTR_s00059p00169820        65.5    3e-09   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.5    3e-09   
ref|XP_011468929.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    4e-09   
dbj|BAJ90744.1|  predicted protein                                    65.1    4e-09   
ref|XP_004239125.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.1    5e-09   
ref|XP_006852301.1|  hypothetical protein AMTR_s00049p00190450        62.4    5e-09   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.7    5e-09   
gb|ABR16195.1|  unknown                                               64.7    6e-09   
gb|EEE51569.1|  hypothetical protein OsJ_32798                        64.3    6e-09   
ref|XP_010905904.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.7    6e-09   
gb|EEC73528.1|  hypothetical protein OsI_07920                        64.3    7e-09   
gb|AAN64140.1|  Putative ripening regulated protein                   63.9    7e-09   
ref|XP_009605336.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.3    7e-09   
emb|CAN63841.1|  hypothetical protein VITISV_021179                   64.3    7e-09   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.9    7e-09   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.3    7e-09   
ref|XP_010243275.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  63.9    8e-09   
ref|XP_010243273.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  64.3    8e-09   
gb|EEC74654.1|  hypothetical protein OsI_10313                        63.9    8e-09   
ref|XP_010243274.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  63.9    8e-09   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.9    9e-09   
gb|EEE58464.1|  hypothetical protein OsJ_09708                        63.9    9e-09   
gb|KDP46214.1|  hypothetical protein JCGZ_10054                       63.9    1e-08   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710        63.9    1e-08   
ref|XP_010270616.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.5    1e-08   
gb|EAZ06832.1|  hypothetical protein OsI_29069                        63.5    1e-08   
ref|XP_007051759.1|  MATE efflux family protein                       63.5    1e-08   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.5    1e-08   
emb|CDP13216.1|  unnamed protein product                              63.5    2e-08   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                          63.5    2e-08   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  63.2    2e-08   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12          63.2    2e-08   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein             63.2    2e-08   
gb|KFK28220.1|  hypothetical protein AALP_AA8G488200                  60.1    2e-08   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.2    2e-08   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.8    2e-08   
ref|XP_006395543.1|  hypothetical protein EUTSA_v10005286mg           62.8    2e-08   
ref|XP_009380883.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.8    2e-08   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340        62.8    2e-08   
ref|XP_002272214.2|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.8    2e-08   
ref|XP_010646478.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.8    2e-08   
emb|CAN77557.1|  hypothetical protein VITISV_033224                   62.8    2e-08   
ref|XP_006357608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.8    2e-08   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                          62.4    3e-08   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760        62.8    3e-08   
emb|CDY13643.1|  BnaA06g32800D                                        62.4    3e-08   
ref|XP_006438289.1|  hypothetical protein CICLE_v10031274mg           62.4    3e-08   
ref|XP_006483933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    3e-08   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    3e-08   
ref|XP_009152044.1|  PREDICTED: protein TRANSPARENT TESTA 12          62.4    3e-08   
emb|CDX83627.1|  BnaC07g23670D                                        62.4    3e-08   
ref|XP_008240646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    3e-08   
ref|XP_006438288.1|  hypothetical protein CICLE_v10031274mg           62.4    3e-08   
ref|XP_002865386.1|  mate efflux family protein                       62.4    3e-08   
emb|CBI23362.3|  unnamed protein product                              62.8    3e-08   
ref|XP_006437275.1|  hypothetical protein CICLE_v10032747mg           60.5    3e-08   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                        62.4    3e-08   
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                  62.4    3e-08   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    4e-08   
ref|XP_006445000.1|  hypothetical protein CICLE_v10018703mg           62.4    4e-08   
ref|XP_006437283.1|  hypothetical protein CICLE_v10032663mg           60.5    4e-08   
ref|XP_011087098.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    4e-08   
ref|XP_004985412.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.0    4e-08   
ref|XP_002468362.1|  hypothetical protein SORBIDRAFT_01g044660        62.0    4e-08   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    4e-08   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g           62.0    5e-08   
emb|CDY68535.1|  BnaCnng59430D                                        59.3    5e-08   
ref|XP_002530955.1|  multidrug resistance pump, putative              61.6    5e-08   
ref|XP_004957085.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    5e-08   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg           61.6    5e-08   
ref|XP_011086624.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  61.6    5e-08   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    5e-08   
ref|XP_011086625.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  61.6    5e-08   
ref|NP_199218.1|  MATE efflux family protein                          61.6    5e-08   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                   60.1    5e-08   
dbj|BAD09618.1|  putative ripening regulated protein DDTFR18          61.6    5e-08   
ref|XP_008777525.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  59.3    6e-08   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    6e-08   
ref|XP_002460370.1|  hypothetical protein SORBIDRAFT_02g027130        61.6    6e-08   
ref|XP_004249274.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.2    6e-08   
ref|NP_001062523.2|  Os08g0562800                                     61.2    6e-08   
emb|CDY69605.1|  BnaA06g39220D                                        58.9    6e-08   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.2    6e-08   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  61.2    7e-08   
ref|XP_011086627.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.2    7e-08   
gb|KJB31143.1|  hypothetical protein B456_005G178900                  61.2    8e-08   



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RT
Sbjct  84   GCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRT  143

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRL++W+ K++PLL
Sbjct  144  DWNKEVQEALKRLDRWEDKKKPLL  167



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RT
Sbjct  312  GCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRT  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KR++ W+ K EPLL
Sbjct  372  DWKKEVEEARKRMDAWEVKEEPLL  395



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RT
Sbjct  421  GCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KR++ W+ K EPLL
Sbjct  481  DWKKEVEEARKRMDAWEVKEEPLL  504



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT
Sbjct  479  GCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRT  538

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRLN+WD K+EPLL
Sbjct  539  DWTKEVEEAQKRLNKWDEKKEPLL  562



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT
Sbjct  408  GCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRT  467

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRLN+WD K++PLL
Sbjct  468  DWTKEVEEAQKRLNKWDEKKQPLL  491



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVT+RT
Sbjct  408  GCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTMRT  467

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRLN+WD K+EPLL
Sbjct  468  DWTKEVEEAQKRLNKWDEKKEPLL  491



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT
Sbjct  312  GCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRT  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRLN+W  K+EPLL
Sbjct  372  DWTKEVEEAQKRLNKWSEKKEPLL  395



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT
Sbjct  410  GCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRT  469

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRLN+WD K++PLL
Sbjct  470  DWSKEVEEAQKRLNKWDEKKQPLL  493



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RT
Sbjct  436  GCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRT  495

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRL++W+ K++PLL
Sbjct  496  DWNKEVQEALKRLDRWEDKKKPLL  519



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT
Sbjct  347  GCGWQKFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRT  406

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W +EVE A+KRLN+WD K+EPLL
Sbjct  407  NWTEEVEEAQKRLNKWDEKKEPLL  430



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRT
Sbjct  430  GCGWQAFVAYVNIGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE AKKRLN+WD K EPL
Sbjct  490  DWNKEVEEAKKRLNKWDVK-EPL  511



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+GAVLGFYF  GAKGIW GM+GGTVMQTIILLWVT RT
Sbjct  420  GCGWQAFVAYVNVGCYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTVMQTIILLWVTFRT  479

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRL +W+ K+EPLL
Sbjct  480  DWTKEVEEAAKRLTKWEDKKEPLL  503



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQTIIL+WVT RT
Sbjct  422  GCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTIILIWVTFRT  481

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE + KRLN+WD K+EPLL
Sbjct  482  DWNKEVEESAKRLNKWDDKKEPLL  505



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RT
Sbjct  421  GCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKR-EPLL  322
            DW KEVE A+KR++ W  K+ EPLL
Sbjct  481  DWKKEVEEARKRMDAWQVKKEEPLL  505



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNV CYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+ILLWVT RT
Sbjct  435  GCGWQAFVAYVNVACYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILLWVTFRT  494

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRLN+W+ K++PLL
Sbjct  495  DWNKEVEQAIKRLNKWEGKKQPLL  518



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G +LGFYFN GAKGIW GM+ GT+MQTIILLW+TIRT
Sbjct  103  GCGWQAFVAYVNVGCYYLVGVPLGVLLGFYFNFGAKGIWLGMMAGTLMQTIILLWITIRT  162

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A +RLN WD K EPL
Sbjct  163  DWKKEVEEAARRLNNWDVK-EPL  184



>emb|CBI28940.3| unnamed protein product [Vitis vinifera]
Length=100

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT
Sbjct  15   GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTART  74

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE AK+RL +WD K++PLL
Sbjct  75   NWNKEVEKAKERLEKWDDKKQPLL  98



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++GVPVG +LGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RT
Sbjct  414  GCGWQAFVAYVNVGCYYLIGVPVGVLLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRT  473

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL+ WD KR+PLL
Sbjct  474  DWDKEVESAKNRLSSWDEKRQPLL  497



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RT
Sbjct  414  GCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRT  473

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE AK RLN WD KR+P LP+
Sbjct  474  DWDKEVENAKNRLNTWDDKRQPPLPE  499



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT+IL+W+TIRT
Sbjct  418  GCGWQTFVAYVNVGCYYIVGVPLGALLGFYFKLGAKGIWLGMMGGTVMQTVILIWITIRT  477

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+ RLN+W  K+EP L
Sbjct  478  DWNKEVEAAQGRLNKWGDKKEPEL  501



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT VAY+NVGCYY VGVP+G++LGFYF LG KGIW GMIGGTVMQT+IL W+T RT
Sbjct  412  GCGWQTLVAYINVGCYYAVGVPLGSLLGFYFKLGVKGIWLGMIGGTVMQTLILFWITFRT  471

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRL++WDA +EP+L
Sbjct  472  DWNKEVEEATKRLSKWDASKEPIL  495



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++GVP G++LGF F LGAKGIW GMIGGT MQT+ILLWVT RT
Sbjct  402  GCGWQAFVAYVNVGCYYIIGVPFGSLLGFKFGLGAKGIWGGMIGGTFMQTLILLWVTFRT  461

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AKKRLN+W+ K+EPLL
Sbjct  462  DWNKEVEEAKKRLNKWEDKKEPLL  485



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRT
Sbjct  430  GCGWQAFVAYVNIGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A KRLN+WD K EPL
Sbjct  490  DWNKEVEEANKRLNKWDVK-EPL  511



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRT
Sbjct  416  GCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL++W+ K++PLL
Sbjct  476  DWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RT
Sbjct  431  GCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRT  490

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL++W+ K+EPLL
Sbjct  491  DWNKEVETARKRLDKWEDKKEPLL  514



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRT
Sbjct  416  GCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL++W+ K++PLL
Sbjct  476  DWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RT
Sbjct  430  GCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL++W+ K+EPLL
Sbjct  490  DWNKEVETARKRLDKWEDKKEPLL  513



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRT
Sbjct  416  GCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL++W+ K++PLL
Sbjct  476  DWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RT
Sbjct  320  GCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRT  379

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVEVAK RL+ WD +R+PLL
Sbjct  380  DWNKEVEVAKNRLSSWDDRRQPLL  403



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVN+GCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RT
Sbjct  427  GCGWQTFVAYVNIGCYYIVGVPLGALLGFYFKLGAKGIWSGMLGGTVMQTIILIWITART  486

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ RL +WD K+E +L +
Sbjct  487  DWNKEVEAAQSRLKKWDDKKESILEE  512



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVG+P+G +LGF ++LGAKGIW GMIGGT+MQT+ILLWVT RT
Sbjct  437  GCGWQTFVAYVNVGCYYVVGIPLGCLLGFIYHLGAKGIWSGMIGGTLMQTLILLWVTFRT  496

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AKKRL++W+ KRE LL
Sbjct  497  DWNKEVETAKKRLDKWEDKRETLL  520



>ref|XP_008342112.1| PREDICTED: MATE efflux family protein ALF5-like [Malus domestica]
Length=179

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRT
Sbjct  101  GCGWQAFVAYVNVGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRT  160

Query  393  DWVKEVEVAKKRLNQWD  343
            DW KEVE AKKRLN+WD
Sbjct  161  DWNKEVEEAKKRLNKWD  177



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G++LGFYF LGAKGIW GMIGGT MQT+IL+WVT RT
Sbjct  420  GCGWQAFVAYVNVGCYYVVGIPLGSLLGFYFKLGAKGIWSGMIGGTAMQTLILVWVTFRT  479

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL  W+ K+EPLL
Sbjct  480  DWKKEVEEARKRLVTWEDKKEPLL  503



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMI G V+QT+ILLWVTIRT
Sbjct  110  GCGWQAFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIAGIVLQTVILLWVTIRT  169

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRL  W+ K EPL+
Sbjct  170  DWNKEVQEALKRLETWEGKEEPLV  193



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQT+IL+WVT RT
Sbjct  418  GCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTVILMWVTFRT  477

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRLN+W+ K+EPLL
Sbjct  478  DWNKEVQEADKRLNKWEDKKEPLL  501



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRT
Sbjct  312  GCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWSGMIGGTTMQTAILLWVTIRT  371

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE A KRLN+W D K++PLL
Sbjct  372  DWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RT
Sbjct  415  GCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRT  474

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVEVAK RL+ WD +R+PLL
Sbjct  475  DWNKEVEVAKNRLSSWDDRRQPLL  498



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRT
Sbjct  312  GCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRT  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL++W+  +EPLL
Sbjct  372  DWNKEVEEAQKRLSKWEGSKEPLL  395



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ+FVAYVNV CYYVVG+PVG +LGFYF LG KGIW GMIGGTV+QT+ILLWVT RT
Sbjct  424  GCGWQSFVAYVNVACYYVVGIPVGVLLGFYFKLGVKGIWGGMIGGTVIQTVILLWVTFRT  483

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A  RL++W+A +EPLL
Sbjct  484  DWQKEVEKAASRLDKWEAVKEPLL  507



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+NVGCYY VGVP+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RT
Sbjct  409  GCGWQKTVAYINVGCYYFVGVPLGFLLGFKFHLGAKGIWSGMLGGTCMQTLILFWITFRT  468

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPKT  313
            DW KEVE AKKRLNQWD K++PLL  T
Sbjct  469  DWNKEVEQAKKRLNQWDDKKQPLLAST  495



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY++GVP+G +LGF FNLG KGIW GM+GGT MQT IL+WVT+RT
Sbjct  409  GCGWQQFVAYVNIGCYYIIGVPLGVLLGFVFNLGVKGIWGGMLGGTCMQTAILVWVTLRT  468

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRLN+WD K+EPLL
Sbjct  469  DWKKEVEEAQKRLNKWDDKKEPLL  492



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP G++LGF F LGAKGIW GMIGGT+MQT+IL+WVT RT
Sbjct  436  GCGWQAFVAYVNVGCYYIVGVPFGSLLGFKFGLGAKGIWGGMIGGTIMQTLILMWVTFRT  495

Query  393  DWVKEVEVAKKRLNQWDAKR-EPLL  322
            DW KEVE AKKRLN+WD K+ EPLL
Sbjct  496  DWNKEVEEAKKRLNKWDGKKEEPLL  520



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G++LGFYF LGAKG+W GM+GGT MQTIILLWVTIRT
Sbjct  415  GCGWQAFVAYVNVGCYYLVGIPLGSLLGFYFQLGAKGLWSGMLGGTTMQTIILLWVTIRT  474

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVEVA KRL++W D K+E LL
Sbjct  475  DWNKEVEVALKRLDKWEDQKKEALL  499



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  314  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRT  373

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A+KRLN+WD  + PLL
Sbjct  374  NWNKEVEEAQKRLNKWDDGKAPLL  397



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRT
Sbjct  404  GCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRT  463

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL++W+  +EPLL
Sbjct  464  DWNKEVEEAQKRLSKWEGSKEPLL  487



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNV CYY+VGVP+GA+LGF FNLGAKGIW GMIGGT+MQT+IL+WVT RT
Sbjct  436  GCGWQAFVAYVNVACYYIVGVPLGALLGFKFNLGAKGIWSGMIGGTLMQTLILIWVTFRT  495

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV  A KRLN+W+ K++PLL
Sbjct  496  DWNKEVNEAIKRLNKWEDKKKPLL  519



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF F LGAKGIW GMIGGT+MQT+ILLWVT  T
Sbjct  434  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFGLGAKGIWSGMIGGTLMQTVILLWVTFTT  493

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AKKRL++W+ K+EPLL
Sbjct  494  DWNKEVETAKKRLDRWEDKKEPLL  517



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRT
Sbjct  312  GCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRT  371

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE A KRLN+W D K++PLL
Sbjct  372  DWSKEVEEAHKRLNKWDDTKKQPLL  396



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRT
Sbjct  312  GCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRT  371

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE A KRLN+W D K++PLL
Sbjct  372  DWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RT
Sbjct  433  GCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRT  492

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW  EVE A KRLN+W+ K EPL+
Sbjct  493  DWNNEVEEAAKRLNKWENKTEPLV  516



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RT
Sbjct  414  GCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRT  473

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RLN WD KR+P L
Sbjct  474  DWNKEVENAKNRLNTWDDKRQPPL  497



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RT
Sbjct  433  GCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRT  492

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW  EVE A KRLN+W+ K EPL+
Sbjct  493  DWNNEVEEAAKRLNKWENKTEPLV  516



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+IL+WVT RT
Sbjct  435  GCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILIWVTFRT  494

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRLN+W+ K++PLL
Sbjct  495  DWNKEVDEAIKRLNKWEDKKQPLL  518



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+GAVLGFYFN GAKGIW GM+GGT MQTIIL+WVT RT
Sbjct  422  GCGWQAFVAYVNVGCYYIVGIPLGAVLGFYFNFGAKGIWLGMLGGTTMQTIILMWVTFRT  481

Query  393  DWVKEVEVAKKRLNQWDA-KREPLL  322
            DW KEV+ A KRLN+W+  K+EPLL
Sbjct  482  DWNKEVKEAAKRLNKWEEKKKEPLL  506



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++GVPVG VLGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RT
Sbjct  414  GCGWQAFVAYVNVGCYYLIGVPVGVVLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRT  473

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL+ WD K +PLL
Sbjct  474  DWDKEVESAKNRLSSWDEKGQPLL  497



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNV CYY+VG+P+GA+LGF FNLGAKGIW GMIGGT MQT+IL+WVT RT
Sbjct  405  GCGWQAFVAYVNVACYYIVGIPLGALLGFKFNLGAKGIWSGMIGGTFMQTVILIWVTFRT  464

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRLN+W+ +++PLL
Sbjct  465  DWNKEVDEAIKRLNKWEDEKQPLL  488



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  424  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRT  483

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A+KRLN+WD  + PLL
Sbjct  484  NWNKEVEEAQKRLNKWDDGKAPLL  507



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A+KRL+ WD K+EPLL
Sbjct  483  DWDKEVKKARKRLDMWDDKKEPLL  506



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  426  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRT  485

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A+KRLN+WD  + PLL
Sbjct  486  NWNKEVEEAQKRLNKWDDGKAPLL  509



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  424  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRT  483

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A+KRLN+WD  + PLL
Sbjct  484  NWNKEVEEAQKRLNKWDDGKAPLL  507



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A+KRL+ WD K+EPLL
Sbjct  483  DWDKEVKKARKRLDMWDDKKEPLL  506



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+GA+LGF F+LGAKGIW GMIGGT+MQT+ILLWVT RT
Sbjct  427  GCGWQAFVAYVNVGCYYILGIPLGALLGFKFDLGAKGIWSGMIGGTMMQTLILLWVTYRT  486

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A KRLN+W+ K EPLL
Sbjct  487  NWNKEVEEATKRLNKWEDKPEPLL  510



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  426  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRT  485

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A+KRLN+WD  + PLL
Sbjct  486  NWNKEVEEAQKRLNKWDDGKAPLL  509



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A+KRL+ WD K+EPLL
Sbjct  483  DWDKEVKKARKRLDMWDDKKEPLL  506



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RT
Sbjct  312  GCGWQKIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRT  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPKT  313
            DW KEVE AKKRLNQW+ K++PLL  T
Sbjct  372  DWNKEVEEAKKRLNQWEDKKQPLLAGT  398



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT
Sbjct  422  GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTART  481

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE AK+RL +WD K++PLL
Sbjct  482  NWNKEVEKAKERLEKWDDKKQPLL  505



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT
Sbjct  349  GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTART  408

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE AK+R+ +WD K++PLL
Sbjct  409  NWNKEVEKAKERMEKWDDKKQPLL  432



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  421  GCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KRL++W  K++ ++P+
Sbjct  481  DWTKEVEEASKRLDKWSNKKQEVVPE  506



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  421  GCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KRL++W  K++ ++P+
Sbjct  481  DWTKEVEEASKRLDKWSNKKQEVVPE  506



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  421  GCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KRL++W  K++ ++P+
Sbjct  481  DWTKEVEEASKRLDKWSNKKQEVVPE  506



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT
Sbjct  422  GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRT  481

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A++RL +WD K++PLL
Sbjct  482  NWNKEVEKARERLEKWDDKKQPLL  505



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VGVP+GA+LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RT
Sbjct  428  GCGWQTFVAYVNVGCYYIVGVPLGALLGFHFKLGAKGIWSGMLGGTVMQTIILIWITART  487

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ RL +WD K+E +L +
Sbjct  488  DWNKEVESAQYRLKKWDDKKESILEE  513



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G+VLGFYF LGAKG+W GM+GGT+MQTIILLWVTIRT
Sbjct  347  GCGWQAFVAYVNVGCYYLVGIPLGSVLGFYFQLGAKGLWSGMLGGTIMQTIILLWVTIRT  406

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW+KEVE A +RL++W+  ++
Sbjct  407  DWIKEVEAALRRLDKWEVLKD  427



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VGVPVG +LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RT
Sbjct  428  GCGWQTFVAYVNVGCYYIVGVPVGVLLGFHFKLGAKGIWSGMLGGTVMQTIILIWITART  487

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ RL +WD K+E +L +
Sbjct  488  DWNKEVESAQYRLKKWDDKKEAILEE  513



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G +LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RT
Sbjct  427  GCGWQAFVAYVNIGCYYIVGVPLGVLLGFYFKLGAKGIWSGMLGGTVMQTIILIWITART  486

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ RL  WD K+E +L +
Sbjct  487  DWNKEVESAQSRLKMWDDKKESILEE  512



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RT
Sbjct  412  GCGWQAFVAYVNVGCYYLIGVPLGVLLGFKFDLGAKGIWSGMIGGTFLQTLILIWVTYRT  471

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A++RLN W+ K+EPLL
Sbjct  472  DWNKEVEKARQRLNSWEDKKEPLL  495



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRT
Sbjct  404  GCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRT  463

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE A+KRLN+W D K+EPLL
Sbjct  464  DWSKEVEEAQKRLNKWDDTKKEPLL  488



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT
Sbjct  180  GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTART  239

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE AK+R  +WD K++PLL
Sbjct  240  NWNKEVEKAKERXEKWDDKKQPLL  263



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRT
Sbjct  407  GCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRT  466

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE A+KRLN+W D K+EPLL
Sbjct  467  DWSKEVEEAQKRLNKWDDTKKEPLL  491



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIR  397
            GCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT R
Sbjct  377  GCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFR  436

Query  396  TDWVKEVEVAKKRLNQWDAKREPLL  322
            TDW KEVE A+ RL++WD K++PLL
Sbjct  437  TDWTKEVENARARLDKWDDKKQPLL  461



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT
Sbjct  458  GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRT  517

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A++RL +WD K++PLL
Sbjct  518  NWNKEVEKARERLEKWDDKKQPLL  541



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT
Sbjct  422  GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTART  481

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE AK+R+ +WD K++PLL
Sbjct  482  NWNKEVEKAKERMEKWDDKKQPLL  505



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RT
Sbjct  411  GCGWQKIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRT  470

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPKT  313
            DW KEVE AKKRLNQW+ K++PLL  T
Sbjct  471  DWNKEVEEAKKRLNQWEDKKQPLLAGT  497



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+G++LGFYF+ GAKGIW GM+GGT MQT+IL+WVT RT
Sbjct  423  GCGWQAFVAYVNVGCYYGVGLPLGSLLGFYFDFGAKGIWLGMLGGTAMQTVILIWVTFRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRL+ W+ K+EP+L
Sbjct  483  DWNKEVEEAAKRLSIWEDKKEPVL  506



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RT
Sbjct  411  GCGWQKIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRT  470

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPKT  313
            DW KEVE AKKRLNQW+ K++PLL  T
Sbjct  471  DWNKEVEEAKKRLNQWEDKKQPLLAGT  497



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIR  397
            GCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT R
Sbjct  427  GCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFR  486

Query  396  TDWVKEVEVAKKRLNQWDAKREPLL  322
            TDW KEVE A+ RL++WD K++PLL
Sbjct  487  TDWTKEVENARARLDKWDDKKQPLL  511



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT
Sbjct  403  GCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWVTFRT  462

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ RLN+W+  + P +PK
Sbjct  463  DWNKEVEAAQGRLNKWEDNKGP-VPK  487



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  428  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRT  487

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +WVKEVE A+KRLN+W+ ++ PLL
Sbjct  488  NWVKEVEEAQKRLNKWE-EKSPLL  510



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++GVP+G +LGF F+LG KGIW GM+GGTV+QT+ILLWVT RT
Sbjct  416  GCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGVKGIWSGMLGGTVLQTLILLWVTWRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW  EVEVAK RL+ WD KR+PLL
Sbjct  476  DWNTEVEVAKNRLSSWDDKRQPLL  499



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT  T
Sbjct  432  GCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFGT  491

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRLN+W+ K EPL+
Sbjct  492  DWNKEVEEAAKRLNKWEDKTEPLV  515



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RT
Sbjct  427  GCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRT  486

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE + KRLN+W+ + E L+
Sbjct  487  DWNKEVEESNKRLNKWEDRTETLI  510



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RT
Sbjct  423  GCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK R+ +WD K++PLL
Sbjct  483  DWDKEVENAKSRVEKWDDKKQPLL  506



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RT
Sbjct  425  GCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRT  484

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE + KRLN+W+ + E L+
Sbjct  485  DWNKEVEESNKRLNKWEDRTETLI  508



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ+FVA +NVGCYY+VG+P+G +LGF FNLG KGIW GMIGGT+MQT+ILLWVT RT
Sbjct  424  GCGWQSFVACINVGCYYMVGIPIGCLLGFKFNLGVKGIWSGMIGGTMMQTLILLWVTFRT  483

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL++W+   EPLL
Sbjct  484  DWNKEVEKARKRLDKWEEITEPLL  507



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+GA+LGFYF LGAKGIW GMIGGT MQT+IL+WVT RT
Sbjct  425  GCGWQAFVAYVNVGCYYVVGIPLGALLGFYFKLGAKGIWVGMIGGTFMQTVILIWVTYRT  484

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE + KRLN+WD K+E
Sbjct  485  DWNKEVEESMKRLNKWDDKQE  505



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT
Sbjct  428  GCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWVTFRT  487

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ RLN+W+  + P +PK
Sbjct  488  DWNKEVEAAQGRLNKWEDNKGP-VPK  512



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVGVP+GA+LGF F LG KGIW GMIGGTVMQT ILLWVT+RT
Sbjct  408  GCGWQQFVAYVNIGCYYVVGVPLGALLGFVFKLGVKGIWGGMIGGTVMQTAILLWVTLRT  467

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE A+KRLN+W D K EPLL
Sbjct  468  DWSKEVEEAQKRLNKWEDKKTEPLL  492



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  T
Sbjct  272  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTT  331

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE+A++RL++W+ K++PL
Sbjct  332  DWNKEVEIARRRLDRWEDKKQPL  354



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  103  GCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRT  162

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KR+++W  K++ L+
Sbjct  163  DWTKEVEEASKRMDKWSDKKQELV  186



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+PVG VLGF F++GAKGIW GMIGGT+MQTIIL+ VT+RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPVGFVLGFTFDMGAKGIWTGMIGGTLMQTIILVIVTLRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  421  GCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KR+++W  K++ ++P+
Sbjct  481  DWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMIGG V++T+ILLWVT RT
Sbjct  317  GCGWQGFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIGGVVLRTVILLWVTCRT  376

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRL  W+ K+EPL+
Sbjct  377  DWNKEVQEALKRLETWEGKKEPLV  400



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RT
Sbjct  86   GCGWQTFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTMMQTIILLWVTFRT  145

Query  393  DWVKEVEVAKKRLNQWD  343
            DW KEVE AKKRL++W+
Sbjct  146  DWNKEVESAKKRLDKWE  162



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RT
Sbjct  209  GCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRT  268

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  269  DWDKEVEKASSRLDQWEESREPLLKQ  294



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNV CYY+VGVP+G +LGF FN GAKGIW GMIGGT+MQT+ILLWVT RT
Sbjct  436  GCGWQTFVAYVNVTCYYLVGVPLGILLGFKFNFGAKGIWSGMIGGTLMQTVILLWVTFRT  495

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRL++W+ K++ LL
Sbjct  496  DWNKEVDQALKRLDKWEDKKQHLL  519



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT +QT ILLWVTIRT
Sbjct  407  GCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAIQTAILLWVTIRT  466

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE A+KRLN+W D K+EPLL
Sbjct  467  DWSKEVEEAQKRLNKWDDTKKEPLL  491



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VGVP G +LGFYFNLGA GIW GMIGGT+MQTIIL WVT+RT
Sbjct  375  GCGWQAFVAYVNVGCYYFVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQTIILTWVTLRT  434

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A++RLN+W  K+  L
Sbjct  435  DWSKEVETAQQRLNKWGDKQPAL  457



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RT
Sbjct  415  GCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRT  474

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE AKKRL++W+  + PL
Sbjct  475  DWNKEVECAKKRLDKWENLKGPL  497



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRT
Sbjct  374  GCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRT  433

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A +RL+QW+  + PLL
Sbjct  434  DWDKEVETASRRLDQWEGSQAPLL  457



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  418  GCGWQAFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRT  477

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  478  DWDKEVEKARKRLDMWDDKKEPL  500



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  418  GCGWQAFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRT  477

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  478  DWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RT
Sbjct  312  GCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRT  371

Query  393  DWVKEVEVAKKRLNQWDAKR  334
            DWVKEVE A KRL+ W  K+
Sbjct  372  DWVKEVEEASKRLDIWSNKK  391



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+PVG VLGF F+ GAKGIW GMIGGTVMQTIILLWVT RT
Sbjct  421  GCGWQAFVAYVNVGCYYLVGIPVGCVLGFKFDFGAKGIWSGMIGGTVMQTIILLWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW+KEVE AK RL++WD  ++ L
Sbjct  481  DWIKEVEKAKMRLDKWDDDKQTL  503



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY +G+P+GAV+GFYF   AKGIW GM+GGTV+QT+IL+WVT RT
Sbjct  432  GCGWQTFVAYVNVGCYYGIGIPLGAVMGFYFKFNAKGIWLGMLGGTVLQTLILMWVTFRT  491

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV  A++RLNQW+  +EPLL
Sbjct  492  DWNKEVVEAERRLNQWEDVKEPLL  515



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNV CYY+VG+P+GA+LGF F+LGAKGIW GMIGGT +QT+IL+WVT RT
Sbjct  435  GCGWQAFVAYVNVACYYIVGIPLGALLGFKFDLGAKGIWSGMIGGTFIQTLILIWVTFRT  494

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV  A KRLN+W+ K++PLL
Sbjct  495  DWNKEVYEATKRLNKWEDKKQPLL  518



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIR  397
            GCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKG+W GM IGGT+ QT+ILLWVT+R
Sbjct  426  GCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGVWSGMVIGGTLTQTLILLWVTVR  485

Query  396  TDWVKEVEVAKKRLNQWDAKREPLL  322
            TDW KEVE AK RL++WD K++PLL
Sbjct  486  TDWNKEVENAKARLDKWDDKKQPLL  510



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVGVP+GA+LGFYF LGAKGIW GMIGGT MQTIIL+WVT RT
Sbjct  425  GCGWQAFVAYVNVGCYYVVGVPLGALLGFYFKLGAKGIWLGMIGGTCMQTIILIWVTYRT  484

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE A KRLN+W+ K++
Sbjct  485  DWNKEVEEATKRLNKWEDKQQ  505



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  T
Sbjct  414  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTT  473

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE+A++RL++W+ K++PL
Sbjct  474  DWNKEVEIARRRLDRWEDKKQPL  496



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY+VG+P+GA+ GFYF  GAKGIW GMI GTVMQTIIL WVT  T
Sbjct  419  GCGWQTFVAKVNVGCYYIVGIPLGALFGFYFKFGAKGIWTGMICGTVMQTIILAWVTFST  478

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEV++A KRL+QW  ++EPL
Sbjct  479  DWNKEVDLATKRLDQWSDRKEPL  501



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  T
Sbjct  433  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTT  492

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE+A++RL++W+ K++PL
Sbjct  493  DWNKEVEIARRRLDRWEDKKQPL  515



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGT+ QT IL WVT RT
Sbjct  421  GCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTITQTFILAWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KR+++W  K++ ++P+
Sbjct  481  DWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAY+NVGCYYV+G+P+G++LGFYF LGAKGIW GM+ GT+MQT+IL+W+T RT
Sbjct  435  GCGWQAFVAYINVGCYYVLGIPLGSLLGFYFRLGAKGIWGGMLAGTIMQTLILMWITFRT  494

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KRL++W   +EP L +
Sbjct  495  DWNKEVEEAMKRLDEWQDNKEPFLKE  520



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RT
Sbjct  423  GCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K +PLL
Sbjct  483  DWDKEVDNAKSRVEKWDDKEQPLL  506



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  424  GCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRT  483

Query  393  DWVKEVEVAKKRLNQWDAKREP  328
            DW KEVE AKKRL+ WD K+EP
Sbjct  484  DWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRT
Sbjct  419  GCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRT  478

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A +RL+QW+  + PLL
Sbjct  479  DWDKEVETASRRLDQWEDSQAPLL  502



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G +LGFY+  GAKGIW GM+GGT MQTIIL+WVT RT
Sbjct  411  GCGWQAFVAYVNIGCYYIVGVPLGVLLGFYYKFGAKGIWLGMMGGTCMQTIILIWVTFRT  470

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE + KRLN+WD K+E  L
Sbjct  471  DWNKEVEESMKRLNKWDVKQESTL  494



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G VLGF F+ GA+GIW GMIGGT +QT+ILLWVT RT
Sbjct  421  GCGWQAFVAYVNVGCYYIIGIPLGCVLGFKFDFGAQGIWSGMIGGTFIQTLILLWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE  K RL++WD K+EPLL +
Sbjct  481  DWKKEVENVKNRLDRWDDKKEPLLTE  506



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RT
Sbjct  420  GCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRT  479

Query  393  DWVKEVEVAKKRLNQWDAKR  334
            DWVKEVE A KRL+ W  K+
Sbjct  480  DWVKEVEEASKRLDIWSNKK  499



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVG YY +G+P+GAVLGF F LGAKGIW GM+GGT +QTIIL+WVT+RT
Sbjct  422  GCGWQAFVAYVNVGSYYFLGIPLGAVLGFVFKLGAKGIWSGMLGGTALQTIILIWVTVRT  481

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE+A+ RLN+W+ K+E
Sbjct  482  DWNKEVEIARGRLNRWEDKKE  502



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVGVP GA+LGFYF LGAKGIW GM+ GT+MQT+ILLWVTIRT
Sbjct  428  GCGWQAFVAYVNVGCYYVVGVPFGALLGFYFKLGAKGIWLGMVWGTLMQTLILLWVTIRT  487

Query  393  DWVKEVEVAKKRLNQWD  343
            DW KEVE AKKRLN+WD
Sbjct  488  DWNKEVEEAKKRLNKWD  504



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIWCGMIGGT+MQT+IL+WVT RT
Sbjct  434  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWCGMIGGTLMQTLILVWVTFRT  493

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A KRLN+W+ K  P+L
Sbjct  494  NWNKEVEEALKRLNKWEDK-SPIL  516



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI+L+ VT+RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIVLVIVTLRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  353  GCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRT  412

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KR+++W  +++ ++P+
Sbjct  413  DWNKEVEEASKRMDKWSNQKQEVVPE  438



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT MQT+ILL+VT RT
Sbjct  423  GCGWQTYVAYVNVGCYYVVGIPVGCILGFAFDFQAKGIWTGMIGGTFMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  483  DWDKEVETARKRLDMWDDKKEPL  505



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  103  GCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRT  162

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            +W KEVE A+KRLN+W+  + P+
Sbjct  163  NWNKEVEEAQKRLNKWEDSKAPV  185



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+G VLGF F+LGAKGIW GMIGGTV+QT IL+W T +T
Sbjct  438  GCGWQAFVAYVNVGCYYFVGLPIGCVLGFKFDLGAKGIWSGMIGGTVLQTAILIWTTYQT  497

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPKT  313
            DW+KEVE AKKRL++WD   +PLL  +
Sbjct  498  DWIKEVEKAKKRLDKWDDINQPLLKAS  524



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G +LGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFILGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A  RL+QW+  REPLL +
Sbjct  476  DWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RT
Sbjct  135  GCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRT  194

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEV  AK+RL++W D + EPLL
Sbjct  195  DWSKEVGKAKQRLDKWEDKEDEPLL  219



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGG++MQT+ILL+VT RT
Sbjct  420  GCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGSLMQTLILLYVTYRT  479

Query  393  DWVKEVEVAKKRLNQWDAKREP  328
            DW KEVE AKKRL+ WD K+EP
Sbjct  480  DWDKEVEKAKKRLDMWDEKKEP  501



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGFYFNL AKGIW GM+GGT MQTIILLWVT RT
Sbjct  414  GCGWQAFVAYVNVGCYYVVGIPLGIVLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRT  473

Query  393  DWVKEVEVAKKRLNQW-DAKREPL  325
            DW KEVE AK RLN W +  ++PL
Sbjct  474  DWEKEVEQAKSRLNMWQNNSKKPL  497



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF  +LGAKGIW GMIGGT+MQT+ILLWVT  T
Sbjct  433  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKNDLGAKGIWSGMIGGTMMQTLILLWVTFTT  492

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE+A++RL++W+ K++PLL
Sbjct  493  DWNKEVEIARRRLDRWEDKKQPLL  516



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL+WVT RT
Sbjct  427  GCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMLGGTTMQTLILIWVTYRT  486

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL++W+ K++PLL
Sbjct  487  DWNKEVEKAKGRLDKWEDKKKPLL  510



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ +VAYVN+GCYYVVG+P+G +LGF FNLG KGIW GMIGGT MQT+ILLWVT RT
Sbjct  431  GCGWQAYVAYVNIGCYYVVGIPIGCLLGFKFNLGVKGIWTGMIGGTAMQTLILLWVTFRT  490

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRL  WD  +EPLL
Sbjct  491  DWNKEVEKAGKRLAMWDDIKEPLL  514



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RT
Sbjct  415  GCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRT  474

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW K+VE AKKRL++W+  + PL
Sbjct  475  DWNKKVECAKKRLDKWENLKGPL  497



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RT
Sbjct  349  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRT  408

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE AK+RL++W D + +PLL
Sbjct  409  DWSKEVEKAKQRLDKWEDKEDQPLL  433



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RT
Sbjct  370  GCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRT  429

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  430  DWNKEVDKAKNRVEKWDDKKQPLL  453



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY +G+P+GAVLGFYF  GAKGIW GM+GGTV+QTIIL+WVT RT
Sbjct  434  GCGWQTFVAYVNVGCYYGLGIPLGAVLGFYFKFGAKGIWLGMLGGTVLQTIILMWVTFRT  493

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW  EV  + KRLN+W+ K E LL
Sbjct  494  DWNNEVVESNKRLNKWEGKTESLL  517



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEV  A  RL+QW+  REPLL +
Sbjct  476  DWDKEVAKASSRLDQWEESREPLLKQ  501



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT++T
Sbjct  242  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLKT  301

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE +  RL+QW+  REPLL +
Sbjct  302  DWDKEVEKSSSRLDQWEESREPLLKQ  327



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VN+GCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  432  GCGWQTFVAKVNIGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRT  491

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KE E A KR+++W  K++ ++P+
Sbjct  492  DWTKEEEEASKRMDKWSNKKQEVVPE  517



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RT
Sbjct  418  GCGWQAFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTVMQTIILLWFTYRT  477

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+ RL++W+  +EPL
Sbjct  478  DWNKEVEKARTRLDKWENVKEPL  500



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RT
Sbjct  443  GCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRT  502

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  503  DWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RT
Sbjct  443  GCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRT  502

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  503  DWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RT
Sbjct  435  GCGWQAFVAYVNVGCYYLVGVPFGALLGFYFKCGAKGIWLGMMAGTLMQTIILIWVTYRT  494

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A KRLN+W   +EPL
Sbjct  495  DWKKEVEEAAKRLNKWGKVKEPL  517



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE AKKRL+ WD K++
Sbjct  483  DWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGTV+QT+ILL VT RT
Sbjct  416  GCGWQAFVAYVNVGCYYLIGIPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLGVTWRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE AK RL+ WD K EPLL K
Sbjct  476  DWNKEVEGAKNRLSTWDDKSEPLLQK  501



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE AKKRL+ WD K++
Sbjct  483  DWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY++G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  422  GCGWQTFVAKVNVGCYYIIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRT  481

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A KRL++W  K++ ++ +
Sbjct  482  DWTKEVEEASKRLDKWSNKKQDVVSE  507



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RT
Sbjct  377  GCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRT  436

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  437  DWNKEVDKAKNRVEKWDDKKQPLL  460



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  483  DWDKEVEKARKRLDLWDDKKEPL  505



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  483  DWDKEVEKARKRLDLWDDKKEPL  505



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP G +LGF F LG KGIWCG+I GTV QT+ILL VT RT
Sbjct  440  GCGWQAFVAYVNVGCYYIVGVPAGCLLGFKFGLGVKGIWCGLIAGTVNQTLILLVVTFRT  499

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AKKRL++W+ K EPLL
Sbjct  500  DWNKEVEEAKKRLDKWEEKEEPLL  523



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ +VAYVNVGCYYVVG+P+G +LGF + LGAKGIW GMIGGT+MQT+IL+W T RT
Sbjct  349  GCGWQAYVAYVNVGCYYVVGIPLGCLLGFKYKLGAKGIWSGMIGGTMMQTLILVWSTFRT  408

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A++RL  WD K+EPLL
Sbjct  409  DWNKEVEKARERLRTWDDKKEPLL  432



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RT
Sbjct  423  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRT  482

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEVE AK+RL++W D + +PLL
Sbjct  483  DWSKEVEKAKQRLDKWEDKEDQPLL  507



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R 
Sbjct  312  GCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRA  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL++W+ K++PLL
Sbjct  372  DWNKEVEKAKGRLDKWEDKKKPLL  395



>gb|EMT20038.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=456

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVGVP+G +LGFYF+LGA GIWCGMIGGT MQT+IL+WVTIRT
Sbjct  370  GCGWQAFVAYVNVGCYYVVGVPLGCLLGFYFDLGAAGIWCGMIGGTFMQTVILVWVTIRT  429

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W  EV  A KRL++W+ K+ PLL
Sbjct  430  NWDSEVAEAMKRLHKWEDKK-PLL  452



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RT
Sbjct  443  GCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRT  502

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  503  DWNKEVDKAKNRVEKWDDKKQPLL  526



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  425  GCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRT  484

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  485  DWDKEVEKARKRLDLWDDKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  425  GCGWQTYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRT  484

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  485  DWDKEVEKARKRLDLWDDKKEPL  507



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RT
Sbjct  446  GCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRT  505

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  506  DWNKEVDKAKNRVEKWDDKKQPLL  529



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RT
Sbjct  312  GCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRT  371

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEV  AK+RL++W D + EPLL
Sbjct  372  DWSKEVGKAKQRLDKWEDXEDEPLL  396



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VA VN+GCYYV+G+P+GA+LGFY+N GAKGIW GMIGGTV+QT IL WVT RT
Sbjct  421  GCGWQTYVAKVNIGCYYVIGIPLGALLGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRT  480

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KE E A KR+++W  +++ ++P+
Sbjct  481  DWSKEAEEASKRMDKWSNQKQEVVPE  506



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RT
Sbjct  453  GCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRT  512

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  513  DWNKEVDKAKNRVEKWDDKKQPLL  536



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYYV+G+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQTFVAYVNVGCYYVIGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+  L
Sbjct  483  DWDKEVEKARKRLDMWDDKKNSL  505



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RT
Sbjct  450  GCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRT  509

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ AK R+ +WD K++PLL
Sbjct  510  DWNKEVDKAKNRVEKWDDKKQPLL  533



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP+G++LGFYF  GAKGIW G++GGT+MQTIIL+ V +RT
Sbjct  430  GCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKHGAKGIWLGLLGGTLMQTIILIVVMVRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A +RL+QW+ K+EPLL
Sbjct  490  DWNKEVEKALERLDQWEDKKEPLL  513



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R 
Sbjct  337  GCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRA  396

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL++W+ K++PLL
Sbjct  397  DWNKEVEKAKGRLDKWEDKKKPLL  420



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGC Y VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RT
Sbjct  419  GCGWQAFVAYVNVGCNYAVGIPVGCLLGFRFDLGAKGIWTGMIGGTVMQTIILLWFTYRT  478

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+ RL++W   +EPL
Sbjct  479  DWNKEVEKARTRLDKWGNVKEPL  501



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRT
Sbjct  374  GCGWQAFVAYVNIGCYYFVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRT  433

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A +RL++W+  + PLL
Sbjct  434  DWDKEVETASRRLDKWEDTQAPLL  457



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVA VNVGCYY+VGVP+GA+ GFYF   AKGIW GMI GTVMQT+IL WVT RT
Sbjct  430  GCGWQTFVAKVNVGCYYIVGVPLGALFGFYFKFDAKGIWTGMICGTVMQTVILAWVTFRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DWVKEVE A KRL++W  K+  ++P+
Sbjct  490  DWVKEVEEASKRLDKWSNKKLEVVPE  515



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 2/83 (2%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G +LGFYFNL AKGIW GM+GGT MQTIILLWVT RT
Sbjct  418  GCGWQAFVAYVNVGCYYVVGIPLGILLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRT  477

Query  393  DWVKEVEVAKKRLNQW--DAKRE  331
            DW KEVE AK RLN W  ++K++
Sbjct  478  DWEKEVEQAKSRLNMWQNNSKKQ  500



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV  A  RL+QW+  REPLL
Sbjct  476  DWDKEVAKASSRLDQWEESREPLL  499



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+PVG +LG  FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  418  GCGWQAFVAYVNVGCYYIVGIPVGCILGSTFNFQAKGIWTGMIGGTLMQTLILLYVTYRT  477

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+EPL
Sbjct  478  DWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W T RT
Sbjct  414  GCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRT  473

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE AK+RL++W+  +EPL  K
Sbjct  474  DWNKEVEKAKERLDKWENVKEPLSKK  499



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY++G+P+GA+ GFYF  GAKGIW G+I G  +QT+ILLW T RT
Sbjct  427  GCGWQTFVAYVNVGCYYLIGIPLGALFGFYFKYGAKGIWIGIISGVFLQTLILLWTTFRT  486

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE+A+KRL  WD +++PLL
Sbjct  487  DWNKEVEIAQKRLATWDDQKQPLL  510



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEV  A  RL+QW+  REPLL +
Sbjct  476  DWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEV  A  RL+QW+  REPLL +
Sbjct  476  DWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RT
Sbjct  416  GCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRT  475

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEV  A  RL+QW+  REPLL +
Sbjct  476  DWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT +T
Sbjct  418  GCGWQTFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYQT  477

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+E L
Sbjct  478  DWDKEVEKARKRLDMWDDKKESL  500



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  430  GCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            +W KEVE A+KRLN+W+  + P+
Sbjct  490  NWNKEVEEAQKRLNKWEDSKAPV  512



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  430  GCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            +W KEVE A+KRLN+W+  + P+
Sbjct  490  NWNKEVEEAQKRLNKWEDSKAPV  512



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT+MQT IL+WVT RT
Sbjct  408  GCGWQAFVAYVNVGCYYFVGIPLGILLGFKFDLGAKGIWGGMLGGTLMQTFILIWVTFRT  467

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A +RL++W+  ++PLL  
Sbjct  468  DWNKEVEQAMRRLDKWEDNKQPLLSN  493



>ref|XP_010448968.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010448969.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=508

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  424  GCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRT  483

Query  393  DWVKEVEVAKKRLNQWDAKREP  328
             W KEVE AKKRL+ WD K+EP
Sbjct  484  AWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RT
Sbjct  422  GCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRT  481

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW KEV  AK+RL++W D + EPLL
Sbjct  482  DWSKEVGKAKQRLDKWEDKEDEPLL  506



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+G +LGF F+ GAKGIW GMIGGTVMQTIILLWVT  T
Sbjct  415  GCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTIILLWVTFST  474

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL++W+  + PL
Sbjct  475  DWNKEVESARKRLDKWENLKGPL  497



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  436  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRT  495

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            +W +EVE A KRLN+W+ K  PLL +
Sbjct  496  NWNREVEEAMKRLNKWEDKT-PLLSE  520



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  436  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRT  495

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            +W +EVE A KRLN+W+ K  PLL +
Sbjct  496  NWNREVEEAMKRLNKWEDKT-PLLSE  520



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGC+Y VG+P+G VLGF F+ GAKGIW GM+GGTV+QT+IL++VT RT
Sbjct  428  GCGWQAFVAYVNVGCFYFVGIPLGCVLGFKFDFGAKGIWSGMMGGTVIQTLILMYVTFRT  487

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE  + RL++W+ K+EPLL
Sbjct  488  DWTKEVEKTRNRLDRWEDKKEPLL  511



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RT
Sbjct  314  GCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRT  373

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRL++WD   +P++
Sbjct  374  DWNKEVEEAIKRLSKWDDTAKPIV  397



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT
Sbjct  455  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILVWVTFRT  514

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            +W +EVE A KRLN+W+ K  PLL +
Sbjct  515  NWNREVEEAMKRLNKWEDK-TPLLSE  539



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RT
Sbjct  312  GCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRT  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ R+++W  K E LL +
Sbjct  372  DWNKEVEKARNRMDEWGDKTEQLLKE  397



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  423  GCGWQAFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+  L
Sbjct  483  DWDKEVEKARKRLDMWDDKKNSL  505



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT +QT+IL+WVT RT
Sbjct  436  GCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFIQTLILIWVTFRT  495

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRLN+W+  ++ LL
Sbjct  496  DWNKEVDEAIKRLNKWEDNKKALL  519



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+GA+LGF F LG KGIW GMIGGT MQT ILLWVT+RT
Sbjct  411  GCGWQQFVAYVNIGCYYIVGVPLGAILGFVFKLGVKGIWGGMIGGTCMQTAILLWVTLRT  470

Query  393  DWVKEVEVAKKRLNQWDAKR--EPLL  322
            DW KEVE A+KRL++W+ K+  EPLL
Sbjct  471  DWNKEVEEAQKRLHKWEDKKTTEPLL  496



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RT
Sbjct  347  GCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRT  406

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL  WD      L
Sbjct  407  DWNKEVEKAKSRLETWDTNNSASL  430



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RT
Sbjct  409  GCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRT  468

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW  EVE A+KRLN+W D K+EPLL
Sbjct  469  DWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY VG+P+GA+LGF F+LGAKGIW GMIGGT+MQTIILLWV  RT
Sbjct  419  GCGWQVFVAYVNVGCYYFVGIPLGALLGFKFDLGAKGIWSGMIGGTLMQTIILLWVACRT  478

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW +EVE A KRLN+W+ K +
Sbjct  479  DWKREVEEAAKRLNKWEDKHK  499



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VGVP G +LGFYF  GAKGIW GM+ GT+MQT+IL+WVT RT
Sbjct  434  GCGWQAFVAYVNVGCYYLVGVPFGVLLGFYFKYGAKGIWLGMMAGTLMQTVILIWVTYRT  493

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A KRLN+W+  +E L
Sbjct  494  DWKKEVEEAAKRLNKWEEVKEQL  516



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RT
Sbjct  409  GCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRT  468

Query  393  DWVKEVEVAKKRLNQW-DAKREPLL  322
            DW  EVE A+KRLN+W D K+EPLL
Sbjct  469  DWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVGVPVG +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RT
Sbjct  428  GCGWQAFVAYVNVGCYYVVGVPVGVLLGFKFDLGAKGIWSGMIGGTTVQTLILIWVTYRT  487

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            +W KEVE A KRL  WD K+EPLL
Sbjct  488  NWNKEVEEAMKRLETWDEKKEPLL  511



>ref|XP_009137228.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  317  GCGWQTFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRT  376

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE A+KRL+ WD K  
Sbjct  377  DWDKEVEKARKRLDMWDDKES  397



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RT
Sbjct  423  GCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRT  482

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ R+++W  K E LL +
Sbjct  483  DWNKEVEKARNRMDEWGDKTEQLLKE  508



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RT
Sbjct  429  GCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRT  488

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A KRL++WD   +P++
Sbjct  489  DWNKEVEEAIKRLSKWDDTAKPIV  512



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+GAVLGF F LG KGIW GMIGGT MQT IL+WVT+RT
Sbjct  356  GCGWQQFVAYVNIGCYYIVGVPLGAVLGFVFKLGVKGIWAGMIGGTCMQTAILVWVTLRT  415

Query  393  DWVKEVEVAKKRLNQWDAKR--EPLL  322
            DW KEVE A+ RL++W+A +  EPLL
Sbjct  416  DWNKEVEEAQNRLHKWEANKTTEPLL  441



>emb|CDX98713.1| BnaA03g44980D [Brassica napus]
Length=455

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  372  GCGWQTFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRT  431

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE A+KRL+ WD K  
Sbjct  432  DWDKEVEKARKRLDMWDDKES  452



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RT
Sbjct  420  GCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRT  479

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL  WD      L
Sbjct  480  DWNKEVEKAKSRLETWDTNNSASL  503



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -2

Query  495  LGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE A+KRLNQW+  ++PLL
Sbjct  439  LGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWDKEVEEARKRLNQWEDNKQPLL  496



>ref|XP_006413715.1| hypothetical protein EUTSA_v10024969mg [Eutrema salsugineum]
 gb|ESQ55168.1| hypothetical protein EUTSA_v10024969mg [Eutrema salsugineum]
Length=504

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  420  GCGWQTFVAYVNVGCYYIVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRT  479

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+ RL+ WD K+E L
Sbjct  480  DWDKEVEKARTRLDMWDEKKESL  502



>ref|XP_006282967.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
 gb|EOA15865.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
Length=505

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQT+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  420  GCGWQTYVAYVNVGCYYIVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRT  479

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEVE AKKRL+ WD  +E
Sbjct  480  DWDKEVETAKKRLDMWDDVKE  500



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 10/94 (11%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT MQT+IL+WVT RT
Sbjct  427  GCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTFMQTLILVWVTYRT  486

Query  393  DWVKEVEV----------AKKRLNQWDAKREPLL  322
            +W KEV++          A+KRLN+W+  + PLL
Sbjct  487  NWTKEVQIAITYSNLVEEAQKRLNKWNDSKAPLL  520



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYV+G+P+G +LGF F+LGA+GIW GMIGGT MQTIILLWVT RT
Sbjct  426  GCGWQAFVAYVNVGCYYVLGIPIGCLLGFKFDLGAEGIWSGMIGGTFMQTIILLWVTFRT  485

Query  393  DWVKEVEVAKKRLNQWDAKREP  328
            DW KEVE A  RL +W+ K+ P
Sbjct  486  DWNKEVETAGNRLKKWEDKKLP  507



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY +G+P+G V+GF  + G KGIW GMIGGT++QTIILLWVT RT
Sbjct  401  GCGWQAFVAYVNVGCYYFIGIPLGCVMGFKLDFGVKGIWSGMIGGTLIQTIILLWVTFRT  460

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A  RLN WD  ++PLL
Sbjct  461  DWNKEVEKATNRLNTWDNIKQPLL  484



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RT
Sbjct  429  GCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTVILVWVTWRT  488

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A KRL++WD   +P++
Sbjct  489  DWNKEVDEAIKRLSKWDDTAKPVV  512



>gb|EMT14886.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+N+GCYY +GVP+GA+LGF F+ G KG+W GMIGGT++QTIILLW+T RT
Sbjct  312  GCGWQALVAYINIGCYYFIGVPLGALLGFKFDYGIKGLWGGMIGGTLIQTIILLWITFRT  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A++RL++WD  ++PLL
Sbjct  372  DWNKEVEEARRRLDKWDDAKQPLL  395



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RT
Sbjct  422  GCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRT  481

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ R+++W  K E LL +
Sbjct  482  DWNKEVEKARNRMDEWGDKTELLLKE  507



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT++QT+ILLW+T+RT
Sbjct  420  GCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRT  479

Query  393  DWVKEVEVAKKRLNQWDAKREP  328
            DW KEV  AKKRLN+W  K+EP
Sbjct  480  DWNKEVNTAKKRLNKWGYKKEP  501



>ref|XP_006413716.1| hypothetical protein EUTSA_v10027142mg [Eutrema salsugineum]
 gb|ESQ55169.1| hypothetical protein EUTSA_v10027142mg [Eutrema salsugineum]
Length=508

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VG+PVG +LGF F+  AKGIW GMIGGT++QT+ILL+VT RT
Sbjct  424  GCGWQTFVAYVNVGCYYIVGIPVGCILGFTFDFQAKGIWTGMIGGTLLQTLILLYVTYRT  483

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEV+ A+KRL+ W+ K+EP+L
Sbjct  484  DWDKEVKKARKRLDIWEDKKEPVL  507



>ref|XP_004957863.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=501

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+N+GCYY +G+P+G +LGF F+ G KG+W GMIGGT++QT+IL+W+T+RT
Sbjct  414  GCGWQAMVAYINIGCYYFIGLPLGVLLGFKFDFGIKGLWGGMIGGTLIQTLILIWITLRT  473

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL++WD  R+PLL
Sbjct  474  DWNKEVEEARKRLDKWDDTRQPLL  497



>emb|CDY64933.1| BnaCnng45550D [Brassica napus]
Length=505

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMI GT+MQTIILL VT RT
Sbjct  420  GCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIAGTLMQTIILLIVTFRT  479

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A +RL+QW+  + PLL
Sbjct  480  DWDKEVEKASRRLDQWEDTQAPLL  503



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT++QT+ILLW+T+RT
Sbjct  419  GCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRT  478

Query  393  DWVKEVEVAKKRLNQWDAKREP  328
            DW KEV  AKKRLN+W  K+EP
Sbjct  479  DWNKEVNTAKKRLNKWGYKKEP  500



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RT
Sbjct  430  GCGWQASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRT  489

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE AK RL++W+ KR+P L
Sbjct  490  DWRKEVEKAKSRLHKWEDKRKPSL  513



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RT
Sbjct  135  GCGWQAYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRT  194

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DWVKEVE A +RL+QW+    PLL +
Sbjct  195  DWVKEVEKASRRLDQWE-DTSPLLKQ  219



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 4/88 (5%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGA+GIW GMIGGT MQTIILLWVT RT
Sbjct  423  GCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAQGIWSGMIGGTFMQTIILLWVTFRT  482

Query  393  DWVKEVEVAKKRLNQWD----AKREPLL  322
            DW+KEV  ++ RL +WD     +++PLL
Sbjct  483  DWIKEVGTSRDRLEKWDDSNKQQQQPLL  510



>ref|XP_009135444.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=497

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  418  GCGWQTFVAYVNVGCYYIVGIPVGCLLGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRT  477

Query  393  DWVKEVEVAKKRLNQWDAKR  334
            DW KEVE A KRL+ WD K+
Sbjct  478  DWDKEVEKANKRLDMWDDKK  497



>emb|CDX79109.1| BnaA01g11760D [Brassica napus]
Length=497

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQTFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT
Sbjct  418  GCGWQTFVAYVNVGCYYIVGIPVGCLLGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRT  477

Query  393  DWVKEVEVAKKRLNQWDAKR  334
            DW KEVE A KRL+ WD K+
Sbjct  478  DWDKEVEKANKRLDMWDDKK  497



>ref|XP_009110708.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=504

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMI GT+MQTIILL VT RT
Sbjct  419  GCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIAGTLMQTIILLIVTFRT  478

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A +RL+QW+  + PLL +
Sbjct  479  DWDKEVEKASRRLDQWEDTQAPLLKQ  504



>ref|XP_009137221.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=508

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT +T
Sbjct  424  GCGWQAFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYQT  483

Query  393  DWVKEVEVAKKRLNQWDAKREPL  325
            DW KEVE A+KRL+ WD K+  L
Sbjct  484  DWDKEVEKARKRLDMWDDKKNSL  506



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT+MQTI+LLW T RT
Sbjct  428  GCGWQAFVAYVNIACYYIIGIPLGCVLGFTCDMGAKGIWSGMLGGTIMQTIVLLWATFRT  487

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            +W KEVE A  RL+ W+  +EPLL +
Sbjct  488  NWKKEVEKAHSRLDSWNDNKEPLLKE  513



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GA GIW GMIGGT+MQTIILL VT RT
Sbjct  422  GCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAMGIWTGMIGGTLMQTIILLIVTFRT  481

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A +RL+QW+  + PLL +
Sbjct  482  DWDKEVEKASRRLDQWEDTQAPLLKQ  507



>ref|XP_010237714.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=496

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+N+GCYY +GVP+G +LGF F+ G KG+W GMIGGT++QTIILLW+T RT
Sbjct  409  GCGWQALVAYINIGCYYFIGVPLGVLLGFKFDYGIKGLWGGMIGGTLIQTIILLWITFRT  468

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A++RL++WD  ++PLL  
Sbjct  469  DWNKEVEEARRRLDKWDEAKQPLLAN  494



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ  VAY+N+GCYY +G+P+G +LGF F+ G KG+W GMIGGT++QT+IL+W+T+RT
Sbjct  409  GCGWQATVAYINIGCYYFIGIPLGVLLGFKFDFGIKGLWGGMIGGTLIQTLILIWITLRT  468

Query  393  DWVKEVEVAKKRLNQWDAKREPLL  322
            DW KEVE A+KRL++WD  R+PLL
Sbjct  469  DWNKEVEEARKRLDKWDDTRQPLL  492



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RT
Sbjct  426  GCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFDLGAKGIWTGMIGGTLMQTIILLWVTFRT  485

Query  393  DWVKEVEVAKKRLNQWDAKRE  331
            DW KEV  A  RL +WD ++E
Sbjct  486  DWNKEVGTAINRLEKWDDRQE  506



>gb|KDO78209.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=397

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  573  GCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRT  394
            GCGWQ FVAYVNVGCYY++G+P+G +LGF FNLG KGIW GMIGGT++QTIIL++VT+RT
Sbjct  312  GCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGTKGIWSGMIGGTLIQTIILVYVTLRT  371

Query  393  DWVKEVEVAKKRLNQWDAKREPLLPK  316
            DW KEVE A+ R+++W  K E LL +
Sbjct  372  DWNKEVEKARNRMDEWGDKTELLLKE  397



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750