BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049L16

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|WP_032209146.1|  membrane protein                                   420   4e-146   
ref|WP_032338442.1|  membrane protein                                   421   4e-146   
ref|WP_032209151.1|  membrane protein                                   420   6e-146   
ref|WP_044703184.1|  membrane protein                                   421   7e-146   
ref|WP_032107229.1|  membrane protein                                   421   1e-145   
ref|WP_044325688.1|  membrane protein                                   421   1e-145   Escherichia coli [E. coli]
gb|EIG71900.1|  transposase insN for insertion sequence element I...    420   1e-145   Escherichia sp. 4_1_40B
gb|KEM71031.1|  tetratricopeptide repeat family protein                 422   3e-145   Escherichia coli 7-233-03_S3_C1
gb|END99511.1|  tetratricopeptide repeat family protein                 420   3e-145   Escherichia coli P0301904.3
gb|KEN08411.1|  tetratricopeptide repeat family protein                 422   4e-145   Escherichia coli 7-233-03_S3_C3
gb|KDA86225.1|  tetratricopeptide repeat family protein                 422   4e-145   Escherichia coli 2-011-08_S3_C3
gb|KDT03492.1|  tetratricopeptide repeat family protein                 421   5e-145   Escherichia coli 2-011-08_S3_C1
ref|WP_000662358.1|  hypothetical protein                               422   8e-145   
gb|EHW34924.1|  bacteriophage N4 receptor outer membrane subunit ...    419   2e-144   Escherichia coli DEC8E
gb|EFW55054.1|  Bacteriophage N4 adsorption protein A precursor         419   3e-144   Shigella boydii ATCC 9905
gb|KDH01767.1|  hypothetical protein AE25_00599                         422   5e-144   Escherichia coli UCI 66
ref|WP_000662384.1|  hypothetical protein                               417   8e-144   
ref|WP_042351885.1|  membrane protein                                   416   1e-143   
ref|WP_044715529.1|  membrane protein                                   414   3e-143   
gb|KEJ81104.1|  putative bacteriophage N4 adsorption A domain pro...    415   5e-143   Escherichia coli 6-175-07_S3_C2
gb|KGM59930.1|  hypothetical protein EL76_3518                          421   9e-143   Escherichia coli G3/10
gb|KDG68172.1|  hypothetical protein AF43_00559                         421   1e-142   Escherichia coli MGH 57
gb|ESK10384.1|  hypothetical protein G759_00593                         421   1e-142   Escherichia coli HVH 98 (4-5799287)
ref|WP_032209153.1|  membrane protein                                   420   1e-142   Escherichia coli [E. coli]
ref|WP_044795241.1|  membrane protein                                   421   1e-142   Escherichia coli [E. coli]
gb|EOQ57047.1|  hypothetical protein WEW_02068                          419   1e-142   Escherichia coli KTE33
ref|WP_042108544.1|  membrane protein                                   421   2e-142   
ref|WP_044689192.1|  membrane protein                                   421   2e-142   Escherichia coli [E. coli]
gb|ESD48550.1|  hypothetical protein HMPREF1602_00681                   418   3e-142   Escherichia coli 907889
gb|ERB23876.1|  hypothetical protein G919_01076                         419   3e-142   Escherichia coli UMEA 3151-1
ref|WP_042079555.1|  membrane protein                                   417   3e-142   Escherichia coli [E. coli]
gb|ELG96417.1|  hypothetical protein A317_03115                         419   5e-142   Escherichia coli KTE154
gb|EMD14782.1|  bacteriophage N4 receptor, outer membrane subunit       421   1e-141   Escherichia coli SEPT362
ref|WP_032308300.1|  membrane protein                                   421   2e-141   Escherichia coli [E. coli]
gb|KDT96988.1|  putative tetratricopeptide repeat protein               421   2e-141   Escherichia coli 3-105-05_S4_C1
gb|KDX52633.1|  putative tetratricopeptide repeat protein               420   2e-141   Escherichia coli 2-177-06_S4_C1
gb|EMW90343.1|  TPR repeat family protein                               421   3e-141   Escherichia coli 180050
ref|WP_044707604.1|  membrane protein                                   419   3e-141   Escherichia coli [E. coli]
gb|EIN29164.1|  tetratricopeptide repeat protein                        421   3e-141   Escherichia coli FRIK1996
gb|EHV13213.1|  tetratricopeptide repeat family protein                 421   5e-141   Escherichia coli DEC4C
gb|KEL57962.1|  TPR repeat family protein                               420   6e-141   Escherichia coli 5-172-05_S1_C3
emb|CDK56087.1|  Bacteriophage N4 adsorption protein A                  421   7e-141   Escherichia coli IS9
gb|EIO44046.1|  tetratricopeptide repeat protein                        419   2e-140   Escherichia coli PA41
gb|ELC03021.1|  hypothetical protein WCC_00828                          414   2e-140   Escherichia coli KTE4
gb|ELE04700.1|  bacteriophage N4 receptor, outer membrane subunit       420   3e-140   Escherichia coli KTE51
gb|EFI87493.1|  tetratricopeptide repeat protein                        420   3e-140   Escherichia coli MS 196-1
gb|KDX84955.1|  TPR repeat family protein                               420   4e-140   Escherichia coli 2-222-05_S3_C3
gb|KDZ58587.1|  TPR repeat family protein                               420   5e-140   Escherichia coli 3-073-06_S1_C2
gb|EOV66693.1|  phage receptor, outer membrane subunit                  420   1e-139   Escherichia coli KTE68
ref|WP_042348118.1|  membrane protein                                   420   2e-139   
ref|WP_001648524.1|  TPR repeat family protein                          420   3e-139   
ref|WP_001547317.1|  TPR repeat family protein                          420   3e-139   
ref|WP_044813368.1|  membrane protein                                   418   4e-139   
ref|WP_001655197.1|  TPR repeat family protein                          420   4e-139   
ref|WP_001468157.1|  TPR repeat family protein                          420   4e-139   
ref|WP_001651689.1|  TPR repeat family protein                          420   4e-139   
ref|WP_033813084.1|  membrane protein                                   418   5e-139   Escherichia coli [E. coli]
ref|WP_000662351.1|  bacteriophage N4 adsorption protein A              420   8e-139   
ref|WP_029696385.1|  membrane protein                                   419   8e-139   
gb|EFP70139.1|  bacteriophage N4 adsorption A domain protein            408   2e-138   Shigella dysenteriae 1617
gb|KHG88872.1|  membrane protein                                        420   2e-138   Escherichia coli [E. coli]
gb|AHA63155.1|  Bacteriophage N4 adsorption protein A                   408   2e-138   Shigella dysenteriae 1617
ref|WP_001717818.1|  TPR repeat family protein                          420   2e-138   
ref|WP_001653192.1|  TPR repeat family protein                          418   3e-138   
ref|WP_001645018.1|  TPR repeat family protein                          417   3e-138   
ref|WP_015364444.1|  bacteriophage N4 receptor, outer membrane su...    419   1e-137   
ref|WP_032226075.1|  membrane protein                                   420   2e-137   Escherichia coli [E. coli]
ref|WP_001361206.1|  TPR repeat family protein                          421   2e-137   Escherichia coli [E. coli]
ref|WP_021544805.1|  bacteriophage N4 receptor, outer membrane su...    421   2e-137   Escherichia coli [E. coli]
gb|ELE63441.1|  bacteriophage N4 receptor, outer membrane subunit       417   2e-137   Escherichia coli KTE76
ref|WP_001387404.1|  TPR repeat family protein                          421   3e-137   Escherichia coli [E. coli]
ref|WP_032238930.1|  membrane protein                                   419   3e-137   
ref|WP_000662368.1|  hypothetical protein                               421   3e-137   Escherichia coli [E. coli]
ref|WP_032254571.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_016236543.1|  phage receptor, outer membrane subunit             421   3e-137   Escherichia coli [E. coli]
ref|WP_000662369.1|  hypothetical protein                               421   3e-137   Escherichia coli [E. coli]
gb|KDW72906.1|  TPR repeat family protein                               417   3e-137   Escherichia coli 1-392-07_S1_C1
ref|WP_024238181.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_001599912.1|  TPR repeat family protein                          421   3e-137   Escherichia coli [E. coli]
ref|WP_001739147.1|  TPR repeat family protein                          421   3e-137   Escherichia coli [E. coli]
ref|WP_001686184.1|  TPR repeat family protein                          421   3e-137   Escherichia coli [E. coli]
ref|WP_012304904.1|  hypothetical protein                               421   3e-137   Escherichia coli [E. coli]
ref|WP_040079352.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_032191694.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_032188448.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_032218215.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_032227208.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_033558629.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_032242497.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_032300125.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_032183125.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_000662357.1|  MULTISPECIES: bacteriophage N4 receptor, out...    421   3e-137   Proteobacteria [purple bacteria]
ref|WP_021570528.1|  bacteriophage N4 receptor, outer membrane su...    421   3e-137   Escherichia coli [E. coli]
ref|WP_016236951.1|  phage receptor, outer membrane subunit             421   3e-137   Escherichia coli [E. coli]
ref|WP_000662371.1|  hypothetical protein                               421   3e-137   Escherichia coli [E. coli]
ref|WP_001333623.1|  hypothetical protein                               421   3e-137   Enterobacteriaceae
ref|WP_044806704.1|  membrane protein                                   421   3e-137   Escherichia coli [E. coli]
ref|WP_001737887.1|  TPR repeat family protein                          421   3e-137   Escherichia coli [E. coli]
ref|WP_032348046.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_021568665.1|  bacteriophage N4 receptor, outer membrane su...    420   3e-137   Escherichia coli [E. coli]
ref|WP_001475079.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
gb|KHI48030.1|  membrane protein                                        420   3e-137   Escherichia coli [E. coli]
ref|WP_032179525.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_032239146.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_032236611.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_032189602.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_001503944.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_001412769.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
gb|EID66306.1|  tetratricopeptide repeat protein                        420   3e-137   Escherichia coli W26
ref|WP_001361269.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_032299525.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_032190679.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_001573808.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_001532357.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_001482628.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_001712610.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_001564504.1|  bacteriophage N4 receptor, outer membrane su...    420   3e-137   Escherichia coli [E. coli]
ref|WP_001447048.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_032238579.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_021530398.1|  bacteriophage N4 receptor, outer membrane su...    420   3e-137   Escherichia coli [E. coli]
ref|WP_001477981.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_001724515.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_032258812.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_032240328.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_038996409.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_033801324.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_033800880.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_032141752.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_032235953.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_000662366.1|  hypothetical protein                               420   3e-137   Enterobacteriaceae
ref|WP_021570035.1|  bacteriophage N4 receptor, outer membrane su...    420   3e-137   Escherichia coli [E. coli]
ref|WP_003909989.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_001508438.1|  TPR repeat family protein                          420   3e-137   Escherichia coli [E. coli]
ref|WP_000662372.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_000662373.1|  hypothetical protein                               420   3e-137   Enterobacteriaceae
ref|WP_032198335.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_042202318.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
gb|KHI43500.1|  membrane protein                                        420   3e-137   Escherichia coli [E. coli]
ref|WP_033557269.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_033551376.1|  membrane protein                                   420   3e-137   Enterobacteriaceae
ref|WP_044863361.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_033802250.1|  membrane protein                                   420   3e-137   Escherichia coli [E. coli]
ref|WP_001375368.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_001529787.1|  bacteriophage N4 receptor, outer membrane su...    420   3e-137   Escherichia coli [E. coli]
ref|WP_001396984.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_001443997.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_001443023.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_001325448.1|  hypothetical protein                               420   3e-137   Escherichia coli [E. coli]
ref|WP_032185920.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_001497410.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001494022.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_032350024.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_032258018.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_001624817.1|  bacteriophage N4 receptor, outer membrane su...    420   4e-137   Escherichia coli [E. coli]
ref|WP_044866052.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_033547729.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_022581703.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_000662355.1|  bacteriophage N4 adsorption protein A              420   4e-137   Escherichia coli [E. coli]
ref|WP_016241958.1|  phage receptor, outer membrane subunit             420   4e-137   Escherichia coli [E. coli]
gb|END72354.1|  TPR repeat family protein                               420   4e-137   Escherichia coli P0299483.1
ref|WP_032259438.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_032170871.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_000662362.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_000662361.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_000662360.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_040090045.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_032220419.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_000662364.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_001580085.1|  TPR repeat family protein                          420   4e-137   Enterobacteriaceae
gb|EFF06885.1|  bacteriophage N4 receptor                               420   4e-137   Escherichia coli B185
ref|WP_044782265.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_032250492.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_001300620.1|  hypothetical protein                               420   4e-137   Enterobacteriaceae
ref|WP_021823642.1|  bacteriophage N4 receptor, outer membrane su...    420   4e-137   Enterobacteriaceae
ref|WP_001667416.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_004014562.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001729568.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001716270.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001634113.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001687278.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001684682.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001355527.1|  bacteriophage N4 adsorption protein A              420   4e-137   Escherichia coli [E. coli]
ref|WP_001295316.1|  bacteriophage N4 adsorption protein A              420   4e-137   Escherichia coli [E. coli]
ref|WP_000662376.1|  bacteriophage N4 adsorption protein A              420   4e-137   Escherichia coli [E. coli]
ref|WP_001382920.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_040234601.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_033815240.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_032249421.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_020240114.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_001506991.1|  TPR repeat family protein                          420   4e-137   Enterobacteriaceae
ref|WP_000662363.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_001433906.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_000662374.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_001362628.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_000662375.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_021580570.1|  bacteriophage N4 receptor, outer membrane su...    420   4e-137   Escherichia coli [E. coli]
ref|WP_001730490.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_000662367.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_001312653.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_024238814.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_001743438.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001702888.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_032230886.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_023155702.1|  tetratricopeptide repeat protein                   420   4e-137   Escherichia coli [E. coli]
ref|WP_001709976.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001314549.1|  hypothetical protein                               420   4e-137   Escherichia coli [E. coli]
ref|WP_001310623.1|  hypothetical protein                               420   4e-137   Enterobacteriaceae
ref|WP_032164911.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_032268709.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_001492821.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001732652.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001721136.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001479105.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001566144.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001561588.1|  bacteriophage N4 receptor, outer membrane su...    420   4e-137   Escherichia coli [E. coli]
ref|WP_001484373.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001415816.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001692519.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_000662370.1|  hypothetical protein                               420   4e-137   Shigella
ref|WP_001473911.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001695487.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
gb|EKI23751.1|  tetratricopeptide                                       419   4e-137   Escherichia coli TW15901
ref|WP_032207497.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
gb|KDW26274.1|  TPR repeat family protein                               419   4e-137   Escherichia coli 2-156-04_S4_C1
ref|WP_001690661.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_032284922.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_024043860.1|  Bacteriophage N4 adsorption protein A              420   4e-137   Escherichia coli [E. coli]
ref|WP_032263955.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_003592093.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001557889.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001520033.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001481373.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001689372.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_000662356.1|  hypothetical protein                               420   4e-137   
ref|WP_032161418.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_032224992.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_029305323.1|  membrane protein                                   420   4e-137   Escherichia coli [E. coli]
ref|WP_001488506.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_001487010.1|  TPR repeat family protein                          420   4e-137   Escherichia coli [E. coli]
ref|WP_032317189.1|  membrane protein                                   420   5e-137   Escherichia coli [E. coli]
ref|WP_025210278.1|  membrane protein                                   420   5e-137   Escherichia coli [E. coli]
ref|WP_044188652.1|  membrane protein                                   420   5e-137   
ref|WP_001359069.1|  hypothetical protein                               420   5e-137   Escherichia coli [E. coli]
gb|EFF01428.1|  bacteriophage N4 receptor                               420   5e-137   Escherichia coli FVEC1412
ref|WP_044726151.1|  membrane protein                                   420   5e-137   Escherichia coli [E. coli]
ref|WP_032199122.1|  membrane protein                                   420   5e-137   Escherichia coli [E. coli]
ref|WP_001457452.1|  hypothetical protein                               420   5e-137   Escherichia coli [E. coli]
ref|WP_001598147.1|  TPR repeat family protein                          420   5e-137   Escherichia coli [E. coli]
ref|WP_001599524.1|  bacteriophage N4 receptor, outer membrane su...    420   5e-137   Escherichia coli [E. coli]
ref|WP_001589843.1|  bacteriophage N4 receptor, outer membrane su...    420   5e-137   Escherichia coli [E. coli]
gb|EIN46337.1|  bacteriophage N4 adsorption protein NfrA                419   5e-137   Escherichia coli 93-001
ref|WP_021577114.1|  bacteriophage N4 receptor, outer membrane su...    420   5e-137   Escherichia coli [E. coli]
ref|WP_001346356.1|  hypothetical protein                               420   5e-137   Escherichia coli [E. coli]
ref|WP_038346862.1|  membrane protein                                   420   5e-137   Escherichia coli [E. coli]
ref|WP_032201366.1|  membrane protein                                   420   5e-137   Escherichia coli [E. coli]
ref|WP_001305535.1|  hypothetical protein                               420   5e-137   Escherichia coli [E. coli]
ref|WP_001612570.1|  bacteriophage N4 receptor, outer membrane su...    420   6e-137   Escherichia coli [E. coli]
ref|WP_001301880.1|  hypothetical protein                               420   6e-137   Escherichia coli [E. coli]
ref|WP_012311579.1|  hypothetical protein                               419   6e-137   Escherichia
ref|WP_032222850.1|  membrane protein                                   419   6e-137   Escherichia coli [E. coli]
ref|WP_032300624.1|  membrane protein                                   419   6e-137   Escherichia coli [E. coli]
ref|WP_001322695.1|  MULTISPECIES: hypothetical protein                 419   6e-137   Escherichia
ref|WP_032209313.1|  membrane protein                                   419   7e-137   Escherichia coli [E. coli]
gb|ELF26723.1|  bacteriophage N4 receptor, outer membrane subunit       418   7e-137   Escherichia coli KTE161
ref|WP_001711528.1|  TPR repeat family protein                          419   7e-137   Escherichia coli [E. coli]
ref|WP_032299360.1|  membrane protein                                   419   7e-137   Escherichia coli [E. coli]
gb|EMW37527.1|  TPR repeat family protein                               416   7e-137   Escherichia coli 2785200
ref|WP_001736955.1|  TPR repeat family protein                          419   8e-137   Escherichia coli [E. coli]
ref|WP_001748236.1|  TPR repeat family protein                          419   9e-137   Escherichia coli [E. coli]
ref|WP_032328736.1|  membrane protein                                   419   1e-136   Escherichia coli [E. coli]
ref|WP_001582413.1|  TPR repeat family protein                          419   1e-136   Escherichia coli [E. coli]
ref|WP_032187222.1|  membrane protein                                   419   1e-136   Escherichia coli [E. coli]
ref|WP_032172367.1|  membrane protein                                   419   1e-136   Escherichia coli [E. coli]
ref|WP_021562709.1|  bacteriophage N4 receptor, outer membrane su...    419   1e-136   Escherichia coli [E. coli]
ref|WP_021570711.1|  bacteriophage N4 receptor, outer membrane su...    419   1e-136   Escherichia coli [E. coli]
ref|WP_032176048.1|  membrane protein                                   418   1e-136   
ref|WP_032255579.1|  membrane protein                                   419   1e-136   Escherichia coli [E. coli]
ref|WP_032186180.1|  membrane protein                                   419   1e-136   Escherichia coli [E. coli]
ref|WP_038989167.1|  membrane protein                                   419   1e-136   Escherichia coli [E. coli]
ref|WP_001471174.1|  TPR repeat family protein                          419   1e-136   
ref|WP_032246325.1|  membrane protein                                   419   1e-136   
ref|WP_001376757.1|  hypothetical protein                               419   1e-136   
ref|WP_032084000.1|  membrane protein                                   419   2e-136   
ref|WP_032301324.1|  membrane protein                                   419   2e-136   
ref|WP_032292118.1|  membrane protein                                   419   2e-136   
ref|WP_032272038.1|  membrane protein                                   419   2e-136   
ref|WP_001345000.1|  hypothetical protein                               419   2e-136   
ref|WP_032182331.1|  membrane protein                                   419   2e-136   
ref|WP_032237596.1|  membrane protein                                   419   2e-136   
ref|WP_032173374.1|  membrane protein                                   419   2e-136   
ref|WP_001752236.1|  TPR repeat family protein                          419   2e-136   
ref|WP_000662353.1|  hypothetical protein                               419   2e-136   
ref|WP_020219245.1|  hypothetical protein                               419   2e-136   
ref|WP_024248503.1|  membrane protein                                   418   2e-136   
ref|WP_032267828.1|  membrane protein                                   418   2e-136   
ref|WP_032285639.1|  membrane protein                                   418   2e-136   
ref|WP_032220913.1|  membrane protein                                   418   2e-136   
ref|WP_044869561.1|  membrane protein                                   418   2e-136   
ref|WP_000662345.1|  bacteriophage N4 adsorption protein A              418   2e-136   
ref|WP_001391140.1|  TPR repeat family protein                          418   2e-136   
ref|WP_001366945.1|  hypothetical protein                               418   2e-136   
ref|WP_032170603.1|  membrane protein                                   418   2e-136   
ref|WP_032342521.1|  membrane protein                                   418   2e-136   
ref|WP_044864540.1|  membrane protein                                   418   2e-136   
ref|WP_000662346.1|  bacteriophage N4 adsorption protein A              418   2e-136   
ref|WP_029395120.1|  membrane protein                                   418   2e-136   
ref|WP_001657870.1|  TPR repeat family protein                          418   2e-136   
ref|WP_032288542.1|  membrane protein                                   418   2e-136   
ref|WP_001501787.1|  TPR repeat family protein                          418   2e-136   
ref|WP_001498208.1|  TPR repeat family protein                          418   2e-136   
ref|WP_024232317.1|  membrane protein                                   418   3e-136   
ref|WP_001337904.1|  hypothetical protein                               418   3e-136   
ref|WP_032252932.1|  membrane protein                                   418   3e-136   
ref|WP_001678159.1|  TPR repeat family protein                          418   3e-136   
ref|WP_001427988.1|  hypothetical protein                               418   3e-136   
ref|WP_001463206.1|  TPR repeat family protein                          418   3e-136   
ref|WP_010356366.1|  bacteriophage N4 adsorption protein A              418   3e-136   
ref|WP_038340310.1|  membrane protein                                   418   3e-136   
ref|WP_001625004.1|  TPR repeat family protein                          418   3e-136   
ref|WP_032205496.1|  membrane protein                                   417   3e-136   
ref|WP_023281044.1|  bacteriophage N4 receptor, outer membrane su...    417   3e-136   
ref|WP_024223477.1|  membrane protein                                   417   4e-136   
ref|WP_032202031.1|  membrane protein                                   417   4e-136   
ref|WP_024225773.1|  membrane protein                                   417   4e-136   
ref|WP_001489648.1|  hypothetical protein                               417   4e-136   
ref|WP_021563102.1|  bacteriophage N4 receptor, outer membrane su...    417   4e-136   
ref|WP_042091579.1|  membrane protein                                   417   4e-136   
ref|WP_042024593.1|  membrane protein                                   417   4e-136   
ref|WP_001764321.1|  bacteriophage N4 adsorption protein A              417   4e-136   
ref|WP_021515837.1|  bacteriophage N4 receptor, outer membrane su...    417   4e-136   
ref|WP_000662377.1|  hypothetical protein                               417   4e-136   
ref|WP_001589016.1|  bacteriophage N4 receptor, outer membrane su...    417   4e-136   
ref|WP_021540814.1|  bacteriophage N4 receptor, outer membrane su...    417   4e-136   
ref|WP_027662545.1|  membrane protein                                   417   4e-136   
ref|WP_012602218.1|  hypothetical protein                               417   4e-136   
ref|WP_021555125.1|  bacteriophage N4 receptor, outer membrane su...    417   4e-136   
ref|WP_042100557.1|  membrane protein                                   417   4e-136   
ref|WP_001706898.1|  TPR repeat family protein                          417   4e-136   
ref|WP_001304814.1|  hypothetical protein                               417   4e-136   
ref|WP_001538419.1|  bacteriophage N4 receptor, outer membrane su...    417   4e-136   
ref|WP_032263083.1|  membrane protein                                   417   5e-136   
ref|WP_021531106.1|  bacteriophage N4 receptor, outer membrane su...    417   5e-136   
ref|WP_001445568.1|  hypothetical protein                               417   5e-136   
ref|WP_000662378.1|  hypothetical protein                               417   5e-136   
ref|WP_022645322.1|  bacteriophage N4 receptor, outer membrane su...    417   5e-136   
ref|WP_000662380.1|  hypothetical protein                               417   5e-136   
ref|WP_024234827.1|  membrane protein                                   417   5e-136   
gb|EGI99269.1|  bacteriophage N4 adsorption protein A                   417   5e-136   
ref|WP_016235522.1|  phage receptor, outer membrane subunit             417   5e-136   
ref|WP_001571070.1|  bacteriophage N4 receptor, outer membrane su...    417   5e-136   
ref|WP_032355712.1|  membrane protein                                   417   5e-136   
ref|WP_001466236.1|  TPR repeat family protein                          417   5e-136   
ref|WP_000662344.1|  hypothetical protein                               417   5e-136   
ref|WP_024240949.1|  membrane protein                                   417   5e-136   
ref|WP_001465195.1|  TPR repeat family protein                          417   5e-136   
ref|WP_001389900.1|  hypothetical protein                               417   5e-136   
ref|WP_001550767.1|  bacteriophage N4 receptor, outer membrane su...    417   5e-136   
ref|WP_012601359.1|  hypothetical protein                               417   5e-136   
ref|WP_000662335.1|  hypothetical protein                               417   5e-136   
ref|WP_032343561.1|  membrane protein                                   417   5e-136   
ref|WP_002431177.1|  MULTISPECIES: hypothetical protein                 417   5e-136   
ref|WP_032305945.1|  membrane protein                                   417   5e-136   
ref|WP_044721053.1|  membrane protein                                   417   5e-136   
ref|WP_024226896.1|  membrane protein                                   417   5e-136   
ref|WP_000552106.1|  hypothetical protein                               417   6e-136   
ref|WP_032290358.1|  membrane protein                                   417   6e-136   
ref|WP_032292713.1|  membrane protein                                   417   6e-136   
ref|WP_032198591.1|  membrane protein                                   417   6e-136   
ref|WP_001466857.1|  TPR repeat family protein                          417   6e-136   
ref|WP_001460581.1|  TPR repeat family protein                          417   6e-136   
ref|WP_033872632.1|  membrane protein                                   417   6e-136   
ref|WP_032233104.1|  membrane protein                                   417   6e-136   
ref|WP_001469129.1|  bacteriophage N4 adsorption protein A              417   6e-136   
ref|WP_001366498.1|  hypothetical protein                               417   6e-136   
ref|WP_024230188.1|  membrane protein                                   417   6e-136   
ref|WP_042096551.1|  membrane protein                                   417   6e-136   
ref|WP_021558459.1|  bacteriophage N4 receptor, outer membrane su...    417   6e-136   
ref|WP_001375836.1|  hypothetical protein                               417   6e-136   
ref|WP_024230958.1|  membrane protein                                   417   7e-136   
ref|WP_000662342.1|  hypothetical protein                               417   7e-136   
ref|WP_001464207.1|  TPR repeat family protein                          417   7e-136   
ref|WP_021523032.1|  bacteriophage N4 receptor, outer membrane su...    417   7e-136   
ref|WP_032201151.1|  membrane protein                                   417   7e-136   
ref|WP_040062428.1|  membrane protein                                   417   7e-136   
ref|WP_001586784.1|  bacteriophage N4 receptor, outer membrane su...    417   7e-136   
ref|WP_001515007.1|  bacteriophage N4 receptor, outer membrane su...    417   7e-136   
ref|WP_042100463.1|  membrane protein                                   417   8e-136   
ref|WP_032340586.1|  membrane protein                                   417   8e-136   
ref|WP_001577930.1|  bacteriophage N4 receptor, outer membrane su...    417   8e-136   
ref|WP_033868192.1|  membrane protein                                   417   8e-136   
ref|WP_001522490.1|  bacteriophage N4 receptor, outer membrane su...    417   8e-136   
ref|WP_000662336.1|  hypothetical protein                               417   9e-136   
ref|WP_024180263.1|  membrane protein                                   417   9e-136   
ref|WP_021564057.1|  bacteriophage N4 receptor, outer membrane su...    417   9e-136   
ref|WP_000662339.1|  hypothetical protein                               417   9e-136   
gb|KHH97045.1|  membrane protein                                        416   9e-136   
ref|WP_000662338.1|  hypothetical protein                               416   9e-136   
ref|WP_000662337.1|  hypothetical protein                               416   9e-136   
ref|WP_033868454.1|  membrane protein                                   416   1e-135   
ref|WP_032183567.1|  membrane protein                                   416   1e-135   
ref|WP_040236458.1|  membrane protein                                   416   1e-135   
ref|WP_032204102.1|  membrane protein                                   416   1e-135   
gb|EFF14351.1|  bacteriophage N4 receptor                               416   1e-135   
ref|WP_025758768.1|  membrane protein                                   416   1e-135   
ref|WP_005066618.1|  hypothetical protein                               416   1e-135   
ref|WP_005100916.1|  hypothetical protein                               416   1e-135   
ref|WP_005073188.1|  hypothetical protein                               416   1e-135   
ref|WP_042003986.1|  membrane protein                                   416   2e-135   
ref|WP_005109044.1|  hypothetical protein                               416   2e-135   
ref|WP_044697813.1|  membrane protein                                   416   2e-135   
ref|WP_001490895.1|  hypothetical protein                               416   2e-135   
ref|WP_021543948.1|  bacteriophage N4 receptor, outer membrane su...    416   2e-135   
ref|WP_001601827.1|  bacteriophage N4 receptor, outer membrane su...    416   2e-135   
ref|WP_001316171.1|  hypothetical protein                               416   2e-135   
ref|WP_042028181.1|  membrane protein                                   416   2e-135   
ref|WP_014639085.1|  hypothetical protein                               416   2e-135   
ref|WP_024212362.1|  membrane protein                                   416   2e-135   
ref|WP_000662343.1|  hypothetical protein                               416   2e-135   
ref|WP_027663550.1|  membrane protein                                   415   3e-135   
ref|WP_024236821.1|  membrane protein                                   415   3e-135   
ref|WP_020245193.1|  hypothetical protein                               415   3e-135   
ref|WP_021533697.1|  bacteriophage N4 receptor, outer membrane su...    415   3e-135   
ref|WP_039021584.1|  membrane protein                                   415   3e-135   
ref|WP_024240058.1|  membrane protein                                   415   3e-135   
ref|WP_001353378.1|  hypothetical protein                               415   3e-135   
ref|WP_021540147.1|  bacteriophage N4 receptor, outer membrane su...    415   3e-135   
ref|WP_024704897.1|  membrane protein                                   415   4e-135   
ref|WP_024241822.1|  membrane protein                                   415   4e-135   
ref|WP_001295846.1|  hypothetical protein                               415   4e-135   
ref|WP_001328159.1|  hypothetical protein                               415   4e-135   
ref|WP_014640112.1|  hypothetical protein                               415   4e-135   
ref|WP_001311487.1|  hypothetical protein                               415   4e-135   
ref|WP_032190041.1|  membrane protein                                   415   4e-135   
ref|WP_024247758.1|  membrane protein                                   415   4e-135   
ref|WP_044706085.1|  membrane protein                                   415   4e-135   
ref|WP_032152303.1|  membrane protein                                   415   4e-135   
ref|WP_042018787.1|  membrane protein                                   415   4e-135   
ref|WP_001552543.1|  bacteriophage N4 receptor, outer membrane su...    415   4e-135   
ref|WP_042091163.1|  membrane protein                                   415   4e-135   
ref|WP_023351720.1|  bacteriophage N4 receptor, outer membrane su...    415   4e-135   
ref|WP_021520571.1|  bacteriophage N4 receptor, outer membrane su...    415   4e-135   
ref|WP_001334161.1|  hypothetical protein                               415   4e-135   
ref|WP_042022435.1|  membrane protein                                   415   4e-135   
ref|WP_033561315.1|  membrane protein                                   415   4e-135   
ref|WP_032221129.1|  membrane protein                                   415   4e-135   
ref|WP_021573748.1|  bacteriophage N4 receptor, outer membrane su...    415   4e-135   
ref|WP_001468436.1|  hypothetical protein                               415   4e-135   
ref|WP_016233915.1|  phage receptor, outer membrane subunit             415   4e-135   
ref|WP_001298338.1|  hypothetical protein                               415   4e-135   
ref|WP_032219507.1|  membrane protein                                   415   5e-135   
ref|WP_032260142.1|  membrane protein                                   415   5e-135   
gb|ESD58742.1|  tetratricopeptide repeat protein                        415   5e-135   
ref|WP_001526731.1|  bacteriophage N4 receptor, outer membrane su...    415   5e-135   
ref|WP_001357858.1|  hypothetical protein                               415   5e-135   
ref|WP_001375034.1|  hypothetical protein                               415   5e-135   
ref|WP_032217887.1|  membrane protein                                   414   5e-135   
ref|WP_022296470.1|  MULTISPECIES: bacteriophage N4 adsorption pr...    414   5e-135   
ref|WP_042093371.1|  membrane protein                                   414   5e-135   
emb|CDN80928.1|  bacteriophage N4 adsorption protein A                  415   5e-135   
ref|WP_033554940.1|  membrane protein                                   414   5e-135   
ref|WP_032293931.1|  membrane protein                                   414   8e-135   
ref|WP_001359968.1|  hypothetical protein                               414   8e-135   
ref|WP_020233650.1|  hypothetical protein                               414   9e-135   
ref|WP_001591651.1|  bacteriophage N4 receptor, outer membrane su...    414   1e-134   
ref|WP_033871104.1|  membrane protein                                   414   1e-134   
ref|WP_033553289.1|  membrane protein                                   414   1e-134   
ref|WP_021514946.1|  bacteriophage N4 receptor, outer membrane su...    413   2e-134   
ref|WP_001331995.1|  hypothetical protein                               413   2e-134   
ref|WP_001682686.1|  bacteriophage N4 receptor, outer membrane su...    413   2e-134   
ref|WP_001622643.1|  bacteriophage N4 receptor, outer membrane su...    413   2e-134   
ref|WP_001350612.1|  hypothetical protein                               413   2e-134   
ref|WP_019841897.1|  hypothetical protein                               413   2e-134   
ref|WP_033560200.1|  membrane protein                                   413   2e-134   
ref|WP_001545839.1|  hypothetical protein                               412   3e-134   
ref|WP_021575943.1|  bacteriophage N4 receptor, outer membrane su...    412   3e-134   
ref|WP_001409332.1|  hypothetical protein                               412   3e-134   
ref|WP_028119930.1|  membrane protein                                   412   3e-134   
ref|WP_012578844.1|  hypothetical protein                               412   3e-134   
ref|WP_001339215.1|  hypothetical protein                               412   3e-134   
ref|WP_001362895.1|  hypothetical protein                               412   3e-134   
ref|WP_044714433.1|  membrane protein                                   412   3e-134   
ref|WP_044694830.1|  membrane protein                                   412   3e-134   
ref|WP_001557232.1|  MULTISPECIES: bacteriophage N4 receptor, out...    412   3e-134   
ref|WP_033546435.1|  membrane protein                                   412   4e-134   
gb|EEH84931.1|  tetratricopeptide repeat protein                        412   4e-134   
ref|WP_001558768.1|  bacteriophage N4 receptor, outer membrane su...    412   5e-134   
ref|WP_000662354.1|  hypothetical protein                               387   8e-134   
ref|WP_042035120.1|  membrane protein                                   411   9e-134   
ref|WP_014639780.1|  hypothetical protein                               411   9e-134   
ref|WP_010350298.1|  MULTISPECIES: bacteriophage N4 adsorption pr...    411   1e-133   
ref|WP_021542389.1|  bacteriophage N4 receptor, outer membrane su...    411   1e-133   
ref|WP_033556601.1|  membrane protein                                   410   3e-133   
ref|WP_033549236.1|  membrane protein                                   410   3e-133   
ref|WP_001354835.1|  hypothetical protein                               410   4e-133   
ref|WP_001555825.1|  bacteriophage N4 receptor, outer membrane su...    409   9e-133   
gb|ABE06068.1|  bacteriophage N4 adsorption protein A precursor         409   1e-132   
gb|KHG76629.1|  membrane protein                                        407   2e-132   
ref|WP_021550389.1|  bacteriophage N4 receptor, outer membrane su...    407   3e-132   
ref|WP_016263025.1|  phage receptor, outer membrane subunit             404   5e-131   
ref|WP_001515934.1|  MULTISPECIES: bacteriophage N4 receptor, out...    404   6e-131   



>ref|WP_032209146.1| membrane protein, partial [Escherichia coli]
 gb|EZD18098.1| hypothetical protein BY95_05890, partial [Escherichia coli O157:H7 
str. K6687]
Length=271

 Score =   420 bits (1079),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032338442.1| membrane protein, partial [Escherichia sp. 4_1_40B]
Length=298

 Score =   421 bits (1082),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032209151.1| membrane protein, partial [Escherichia coli]
 gb|EZD18053.1| hypothetical protein BY95_05905, partial [Escherichia coli O157:H7 
str. K6687]
Length=298

 Score =   420 bits (1080),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044703184.1| membrane protein, partial [Escherichia coli]
Length=313

 Score =   421 bits (1082),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032107229.1| membrane protein, partial [Escherichia coli]
Length=325

 Score =   421 bits (1081),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044325688.1| membrane protein, partial [Escherichia coli]
 gb|KIZ82315.1| membrane protein, partial [Escherichia coli]
Length=333

 Score =   421 bits (1082),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EIG71900.1| transposase insN for insertion sequence element IS911A [Escherichia 
sp. 4_1_40B]
Length=319

 Score =   420 bits (1080),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KEM71031.1| tetratricopeptide repeat family protein [Escherichia coli 7-233-03_S3_C1]
Length=386

 Score =   422 bits (1085),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|END99511.1| tetratricopeptide repeat family protein [Escherichia coli P0301904.3]
Length=345

 Score =   420 bits (1080),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KEN08411.1| tetratricopeptide repeat family protein [Escherichia coli 7-233-03_S3_C3]
Length=386

 Score =   422 bits (1084),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDA86225.1| tetratricopeptide repeat family protein [Escherichia coli 2-011-08_S3_C3]
Length=386

 Score =   422 bits (1084),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDT03492.1| tetratricopeptide repeat family protein [Escherichia coli 2-011-08_S3_C1]
Length=386

 Score =   421 bits (1083),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662358.1| hypothetical protein, partial [Escherichia coli]
 gb|EIL31158.1| bacteriophage N4 receptor, outer membrane subunit, partial [Escherichia 
coli O111:H11 str. CVM9545]
Length=410

 Score =   422 bits (1084),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EHW34924.1| bacteriophage N4 receptor outer membrane subunit NfrA domain 
protein [Escherichia coli DEC8E]
Length=368

 Score =   419 bits (1078),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTS EELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSTEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRL QLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLTQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EFW55054.1| Bacteriophage N4 adsorption protein A precursor [Shigella boydii 
ATCC 9905]
Length=386

 Score =   419 bits (1078),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQW DVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWIDVLLAGQLDD  236



>gb|KDH01767.1| hypothetical protein AE25_00599 [Escherichia coli UCI 66]
Length=466

 Score =   422 bits (1084),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662384.1| hypothetical protein, partial [Escherichia sp. TW10509]
Length=341

 Score =   417 bits (1071),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLS+YRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSNYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAAS EGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASTEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_042351885.1| membrane protein, partial [Escherichia coli]
Length=340

 Score =   416 bits (1069),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGD RLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDDRLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLA QLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAAQLDD  236



>ref|WP_044715529.1| membrane protein, partial [Escherichia coli]
Length=305

 Score =   414 bits (1063),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 203/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGD RLE SLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDDRLEHSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLA QLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAAQLDD  236



>gb|KEJ81104.1| putative bacteriophage N4 adsorption A domain protein [Escherichia 
coli 6-175-07_S3_C2]
Length=355

 Score =   415 bits (1067),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGD RLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDDRLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLA QLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAAQLDD  236



>gb|KGM59930.1| hypothetical protein EL76_3518 [Escherichia coli G3/10]
Length=534

 Score =   421 bits (1082),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDG68172.1| hypothetical protein AF43_00559 [Escherichia coli MGH 57]
Length=519

 Score =   421 bits (1081),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|ESK10384.1| hypothetical protein G759_00593 [Escherichia coli HVH 98 (4-5799287)]
Length=534

 Score =   421 bits (1082),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032209153.1| membrane protein, partial [Escherichia coli]
 gb|EZD18048.1| membrane protein, partial [Escherichia coli O157:H7 str. K6687]
Length=515

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044795241.1| membrane protein, partial [Escherichia coli]
Length=553

 Score =   421 bits (1082),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EOQ57047.1| hypothetical protein WEW_02068 [Escherichia coli KTE33]
 gb|EOU83197.1| hypothetical protein WES_01163 [Escherichia sp. KTE31]
Length=482

 Score =   419 bits (1076),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDE TAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEKTAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_042108544.1| membrane protein, partial [Escherichia coli]
Length=545

 Score =   421 bits (1081),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044689192.1| membrane protein, partial [Escherichia coli]
Length=542

 Score =   421 bits (1081),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|ESD48550.1| hypothetical protein HMPREF1602_00681 [Escherichia coli 907889]
Length=482

 Score =   418 bits (1074),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQ DTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQVDTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAG LDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGHLDD  236



>gb|ERB23876.1| hypothetical protein G919_01076 [Escherichia coli UMEA 3151-1]
Length=515

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  11   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  70

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  71   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  130

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRS+VGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  131  RCRSDVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  190

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  191  ARQQNTLSAAERRQWFDVLLAGQLDD  216



>ref|WP_042079555.1| membrane protein, partial [Escherichia coli]
Length=454

 Score =   417 bits (1071),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGD RLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDDRLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLA QLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAAQLDD  236



>gb|ELG96417.1| hypothetical protein A317_03115 [Escherichia coli KTE154]
Length=535

 Score =   419 bits (1077),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRS+VGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSDVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EMD14782.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli SEPT362]
 gb|EQP78433.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 79 (4-2512823)]
 gb|EQT63658.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 188 (4-2356988)]
Length=604

 Score =   421 bits (1081),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032308300.1| membrane protein, partial [Escherichia coli]
 gb|EZE87314.1| membrane protein, partial [Escherichia coli O157:H7 str. 2009EL1913]
Length=618

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDT96988.1| putative tetratricopeptide repeat protein [Escherichia coli 3-105-05_S4_C1]
Length=626

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDX52633.1| putative tetratricopeptide repeat protein [Escherichia coli 2-177-06_S4_C1]
Length=604

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EMW90343.1| TPR repeat family protein [Escherichia coli 180050]
Length=656

 Score =   421 bits (1083),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044707604.1| membrane protein, partial [Escherichia coli]
Length=597

 Score =   419 bits (1077),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRS+VGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSDVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EIN29164.1| tetratricopeptide repeat protein [Escherichia coli FRIK1996]
Length=636

 Score =   421 bits (1081),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  11   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  70

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  71   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  130

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  131  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  190

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  191  ARQQNTLSAAERRQWFDVLLAGQLDD  216



>gb|EHV13213.1| tetratricopeptide repeat family protein [Escherichia coli DEC4C]
 gb|EHV14948.1| tetratricopeptide repeat family protein [Escherichia coli DEC4D]
 gb|EIN49083.1| tetratricopeptide repeat protein [Escherichia coli FRIK1990]
 gb|EIO31792.1| tetratricopeptide repeat protein [Escherichia coli PA40]
 gb|EIP05651.1| tetratricopeptide repeat protein [Escherichia coli TW09195]
 gb|EKH09671.1| tetratricopeptide repeat protein [Escherichia coli FRIK920]
 gb|EKH41872.1| tetratricopeptide repeat protein [Escherichia coli FRIK1999]
 gb|EKH53021.1| tetratricopeptide repeat protein [Escherichia coli NE1487]
 gb|EKH62286.1| tetratricopeptide repeat protein [Escherichia coli FRIK2001]
 gb|EKH99310.1| tetratricopeptide repeat protein [Escherichia coli MA6]
 gb|EKV86202.1| TPR repeat family protein [Escherichia coli 88.1467]
 gb|EKW01669.1| TPR repeat family protein [Escherichia coli 90.0039]
 gb|EKW35619.1| TPR repeat family protein [Escherichia coli 95.0183]
 gb|EKW56968.1| TPR repeat family protein [Escherichia coli 96.0939]
 gb|EKW97720.1| TPR repeat family protein [Escherichia coli 99.0672]
 gb|ELV74553.1| TPR repeat family protein [Escherichia coli ATCC 700728]
 gb|ERC71257.1| TPR repeat family protein [Escherichia coli 08BKT055439]
 gb|ERC73591.1| TPR repeat family protein [Escherichia coli Bd5610_99]
 gb|ERC86464.1| TPR repeat family protein [Escherichia coli T234_00]
 gb|ERC91222.1| TPR repeat family protein [Escherichia coli 14A]
 gb|ERE10724.1| TPR repeat family protein [Escherichia coli 08BKT77219]
 gb|ERE27030.1| TPR repeat family protein [Escherichia coli T1282_01]
Length=656

 Score =   421 bits (1081),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KEL57962.1| TPR repeat family protein [Escherichia coli 5-172-05_S1_C3]
Length=656

 Score =   420 bits (1080),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>emb|CDK56087.1| Bacteriophage N4 adsorption protein A [Escherichia coli IS9]
Length=681

 Score =   421 bits (1082),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EIO44046.1| tetratricopeptide repeat protein [Escherichia coli PA41]
Length=656

 Score =   419 bits (1077),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAA+RRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAKRRQWFDVLLAGQLDD  236



>gb|ELC03021.1| hypothetical protein WCC_00828 [Escherichia coli KTE4]
 gb|EOU40630.1| hypothetical protein WAU_01227 [Escherichia coli KTE3]
Length=501

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 203/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGD RLERSL AIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDDRLERSLVAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLA QLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAAQLDD  236



>gb|ELE04700.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE51]
Length=705

 Score =   420 bits (1080),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EFI87493.1| tetratricopeptide repeat protein [Escherichia coli MS 196-1]
 gb|EIG49613.1| hypothetical protein ESSG_00848 [Escherichia coli H730]
 gb|ELI45355.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE120]
 emb|CCP95596.1| Bacteriophage N4 adsorption protein A [Escherichia coli O10:K5(L):H4 
str. ATCC 23506]
 gb|EOU55160.1| phage receptor, outer membrane subunit [Escherichia coli KTE35]
 gb|EOU99536.1| phage receptor, outer membrane subunit [Escherichia coli KTE34]
 gb|EOV29293.1| phage receptor, outer membrane subunit [Escherichia coli KTE198]
 gb|EOW50153.1| phage receptor, outer membrane subunit [Escherichia coli KTE130]
 gb|EOW50627.1| phage receptor, outer membrane subunit [Escherichia coli KTE132]
 gb|EQX59749.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3174-1]
 gb|EQZ43152.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3592-1]
 gb|EQZ45939.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3609-1]
 gb|KEN92313.1| TPR repeat family protein [Escherichia coli 2-222-05_S3_C1]
Length=705

 Score =   420 bits (1080),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDX84955.1| TPR repeat family protein [Escherichia coli 2-222-05_S3_C3]
 gb|KEO01365.1| TPR repeat family protein [Escherichia coli 2-222-05_S3_C2]
Length=705

 Score =   420 bits (1079),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDZ58587.1| TPR repeat family protein [Escherichia coli 3-073-06_S1_C2]
Length=705

 Score =   420 bits (1079),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EOV66693.1| phage receptor, outer membrane subunit [Escherichia coli KTE68]
Length=740

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_042348118.1| membrane protein [Escherichia coli]
Length=779

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001648524.1| TPR repeat family protein [Escherichia coli]
 gb|ENG18122.1| TPR repeat family protein [Escherichia coli P0305260.5]
 gb|ENG29805.1| TPR repeat family protein [Escherichia coli P0305260.8]
Length=795

 Score =   420 bits (1080),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001547317.1| TPR repeat family protein [Escherichia coli]
 gb|EMZ95156.1| TPR repeat family protein [Escherichia coli P0305260.1]
 gb|ENA07625.1| TPR repeat family protein [Escherichia coli P0299438.2]
 gb|ENE12680.1| TPR repeat family protein [Escherichia coli P0305260.2]
 gb|ENF79239.1| TPR repeat family protein [Escherichia coli P0305260.10]
 gb|ENF88008.1| TPR repeat family protein [Escherichia coli P0305260.11]
 gb|ENF91193.1| TPR repeat family protein [Escherichia coli P0305260.12]
 gb|ENF94036.1| TPR repeat family protein [Escherichia coli P0305260.13]
 gb|ENF99803.1| TPR repeat family protein [Escherichia coli P0305260.15]
 gb|ENG08145.1| TPR repeat family protein [Escherichia coli P0305260.4]
Length=795

 Score =   420 bits (1080),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044813368.1| membrane protein, partial [Escherichia coli]
Length=739

 Score =   418 bits (1075),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRS+VGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSDVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001655197.1| TPR repeat family protein [Escherichia coli]
 gb|ENG37433.1| TPR repeat family protein [Escherichia coli P0305260.9]
Length=795

 Score =   420 bits (1080),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001468157.1| TPR repeat family protein [Escherichia coli]
 gb|ENC36903.1| TPR repeat family protein [Escherichia coli P0299438.9]
Length=795

 Score =   420 bits (1080),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001651689.1| TPR repeat family protein [Escherichia coli]
 gb|ENG22226.1| TPR repeat family protein [Escherichia coli P0305260.6]
Length=795

 Score =   420 bits (1079),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033813084.1| membrane protein, partial [Escherichia coli]
Length=735

 Score =   418 bits (1074),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRA+LLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRAQLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662351.1| bacteriophage N4 adsorption protein A, partial [Escherichia coli]
Length=809

 Score =   420 bits (1079),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_029696385.1| membrane protein [Escherichia coli]
Length=798

 Score =   419 bits (1078),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTS EELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSTEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EFP70139.1| bacteriophage N4 adsorption A domain protein [Shigella dysenteriae 
1617]
Length=482

 Score =   408 bits (1049),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 203/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQV DNIPL+LYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVADNIPLSLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKR+PGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRYPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSA ERRQ FDVLLAGQLDD
Sbjct  211  ARQQNTLSAVERRQRFDVLLAGQLDD  236



>gb|KHG88872.1| membrane protein [Escherichia coli]
Length=876

 Score =   420 bits (1080),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|AHA63155.1| Bacteriophage N4 adsorption protein A [Shigella dysenteriae 1617]
 gb|ESU77323.1| Bacteriophage N4 adsorption protein A [Shigella dysenteriae WRSd3]
 gb|ESU83267.1| Bacteriophage N4 adsorption protein A [Shigella dysenteriae WRSd5]
Length=489

 Score =   408 bits (1049),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 203/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQV DNIPL+LYLAEA
Sbjct  38   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVADNIPLSLYLAEA  97

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKR+PGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  98   YRHFGHDDRARLLLEDQLKRYPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  157

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  158  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  217

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSA ERRQ FDVLLAGQLDD
Sbjct  218  ARQQNTLSAVERRQRFDVLLAGQLDD  243



>ref|WP_001717818.1| TPR repeat family protein [Escherichia coli]
 gb|EMW24799.1| TPR repeat family protein [Escherichia coli 2845650]
Length=865

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001653192.1| TPR repeat family protein [Escherichia coli]
 gb|ENG17774.1| TPR repeat family protein [Escherichia coli P0305260.7]
Length=795

 Score =   418 bits (1074),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGK LRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKPLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001645018.1| TPR repeat family protein [Escherichia coli]
 gb|ENG06700.1| TPR repeat family protein [Escherichia coli P0305260.3]
Length=795

 Score =   417 bits (1073),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDA FAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDAPFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_015364444.1| bacteriophage N4 receptor, outer membrane subunit, partial [Escherichia 
coli]
 gb|AGC86009.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli APEC O78]
Length=869

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRA+LLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRAQLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032226075.1| membrane protein, partial [Escherichia coli]
 gb|KEM81530.1| TPR repeat family protein, partial [Escherichia coli 6-537-08_S3_C3]
Length=940

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001361206.1| TPR repeat family protein [Escherichia coli]
 gb|ENG88722.1| TPR repeat family protein [Escherichia coli 178200]
Length=990

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_021544805.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|EQU64689.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 209 (4-3062651)]
 gb|KDY73493.1| TPR repeat family protein [Escherichia coli 2-460-02_S4_C3]
 gb|KDZ63579.1| TPR repeat family protein [Escherichia coli 3-073-06_S3_C1]
 gb|KEJ70744.1| TPR repeat family protein [Escherichia coli 3-020-07_S3_C2]
Length=990

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|ELE63441.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE76]
 emb|CDK46089.1| Bacteriophage N4 adsorption protein A [Escherichia coli IS1]
 gb|KEM54973.1| TPR repeat family protein [Escherichia coli 6-175-07_S1_C3]
Length=861

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHD RARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDARARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001387404.1| TPR repeat family protein [Escherichia coli]
 gb|ENA69778.1| TPR repeat family protein [Escherichia coli 179550]
 gb|ENG46706.1| TPR repeat family protein [Escherichia coli p0305293.12]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032238930.1| membrane protein, partial [Escherichia coli]
Length=924

 Score =   419 bits (1077),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQL+RHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLQRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662368.1| hypothetical protein [Escherichia coli]
 gb|EGX15415.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_H.1.8]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032254571.1| membrane protein [Escherichia coli]
 gb|KDT59053.1| TPR repeat family protein [Escherichia coli 3-267-03_S3_C1]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_016236543.1| phage receptor, outer membrane subunit [Escherichia coli]
 gb|EOV15553.1| phage receptor, outer membrane subunit [Escherichia coli KTE40]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662369.1| hypothetical protein [Escherichia coli]
 gb|EII10892.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
5.0959]
 gb|ETI79299.1| hypothetical protein Q460_05690 [Escherichia coli ATCC BAA-2219]
 gb|EYU72308.1| membrane protein [Escherichia coli O121:H19 str. 2010C-4254]
 gb|EYV02390.1| membrane protein [Escherichia coli O121:H19 str. 2010C-3609]
 gb|EYV03375.1| membrane protein [Escherichia coli O121:H19 str. 2010C-3840]
 gb|EYV73280.1| membrane protein [Escherichia coli O121:H19 str. 2009EL1412]
 gb|EYV73815.1| membrane protein [Escherichia coli O121:H19 str. 2009C-4659]
 gb|EYX94413.1| membrane protein [Escherichia coli O121:H19 str. 2011C-3537]
 gb|EYX96252.1| membrane protein [Escherichia coli O121:H19 str. 2011C-3500]
 gb|EYY05103.1| membrane protein [Escherichia coli O121:H19 str. 2011C-3216]
 gb|EYY17723.1| membrane protein [Escherichia coli O121:H19 str. 2011C-3108]
 gb|EYY20448.1| membrane protein [Escherichia coli O121:H19 str. 2011C-3072]
 gb|EYY23327.1| membrane protein [Escherichia coli O121:H19 str. 2010EL1058]
 gb|EYY34756.1| membrane protein [Escherichia coli O121:H19 str. 2010C-4989]
 gb|EYY44594.1| membrane protein [Escherichia coli O121:H19 str. 2010C-4966]
 gb|EYY57301.1| membrane protein [Escherichia coli O121:H19 str. 2010C-4824]
 gb|EYY86216.1| membrane protein [Escherichia coli O121:H19 str. 2010C-4732]
 gb|EYZ45201.1| membrane protein [Escherichia coli O121:H19 str. 06-3822]
 gb|EYZ77893.1| membrane protein [Escherichia coli O121:H19 str. 06-3003]
 gb|EZA07751.1| membrane protein [Escherichia coli O121:H19 str. 03-3227]
 gb|EZA90957.1| membrane protein [Escherichia coli O121:H19 str. F6714]
 gb|EZC49549.1| membrane protein [Escherichia coli O121:H19 str. K5198]
 gb|EZC51398.1| membrane protein [Escherichia coli O121:H19 str. K5269]
 gb|EZE39498.1| membrane protein [Escherichia coli O121:H19 str. 2009C-4050]
 gb|EZE65908.1| membrane protein [Escherichia coli O121:H19 str. 2009C-4750]
 gb|EZE75034.1| membrane protein [Escherichia coli O121:H19 str. 2009EL1302]
 gb|EZE92318.1| membrane protein [Escherichia coli O121:H19 str. 2010C-3794]
 gb|KDV56519.1| membrane protein [Escherichia coli O121:H19 str. 2011C-3609]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDW72906.1| TPR repeat family protein [Escherichia coli 1-392-07_S1_C1]
 gb|KDW77474.1| TPR repeat family protein [Escherichia coli 1-392-07_S1_C2]
 gb|KEJ18432.1| TPR repeat family protein [Escherichia coli 6-175-07_S1_C2]
Length=861

 Score =   417 bits (1072),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHD RARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDARARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_024238181.1| membrane protein [Escherichia coli]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001599912.1| TPR repeat family protein [Escherichia coli]
 gb|ENF14245.1| TPR repeat family protein [Escherichia coli P0304777.8]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001739147.1| TPR repeat family protein [Escherichia coli]
 gb|EMZ84197.1| TPR repeat family protein [Escherichia coli 199900.1]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001686184.1| TPR repeat family protein [Escherichia coli]
 gb|EMU86299.1| TPR repeat family protein [Escherichia coli MP021017.6]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_012304904.1| hypothetical protein [Escherichia coli]
 gb|ACA78708.1| TPR repeat-containing protein [Escherichia coli ATCC 8739]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_040079352.1| membrane protein [Escherichia coli]
 gb|KHH13669.1| membrane protein [Escherichia coli]
 gb|KIG43052.1| membrane protein [Escherichia coli]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032191694.1| membrane protein [Escherichia coli]
 gb|KDW90554.1| TPR repeat family protein [Escherichia coli 2-210-07_S1_C2]
 gb|KDX18996.1| TPR repeat family protein [Escherichia coli 2-210-07_S3_C3]
 gb|KDY78129.1| TPR repeat family protein [Escherichia coli 2-474-04_S1_C1]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032188448.1| membrane protein [Escherichia coli]
 gb|EYE14818.1| TPR repeat family protein [Escherichia coli 1-110-08_S3_C3]
 gb|KDT40021.1| TPR repeat family protein [Escherichia coli 3-105-05_S3_C1]
 gb|KDU12638.1| TPR repeat family protein [Escherichia coli 3-373-03_S3_C2]
 gb|KDX52963.1| TPR repeat family protein [Escherichia coli 2-210-07_S3_C1]
 gb|KDY50761.1| TPR repeat family protein [Escherichia coli 2-460-02_S3_C1]
 gb|KDY58051.1| TPR repeat family protein [Escherichia coli 2-460-02_S3_C2]
 gb|KEL29869.1| TPR repeat family protein [Escherichia coli 5-172-05_S4_C2]
 gb|KEN04151.1| TPR repeat family protein [Escherichia coli 7-233-03_S1_C3]
 gb|KEN29802.1| TPR repeat family protein [Escherichia coli 7-233-03_S3_C2]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032218215.1| membrane protein [Escherichia coli]
 gb|EYE06159.1| TPR repeat family protein [Escherichia coli 1-110-08_S4_C2]
 gb|EZJ74373.1| TPR repeat family protein [Escherichia coli 1-176-05_S4_C1]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032227208.1| membrane protein [Escherichia coli]
 gb|EYE05144.1| TPR repeat family protein [Escherichia coli 1-110-08_S4_C3]
 gb|EZJ29420.1| TPR repeat family protein [Escherichia coli 1-176-05_S4_C3]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033558629.1| membrane protein [Escherichia coli]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032242497.1| membrane protein [Escherichia coli]
 gb|KEL25823.1| TPR repeat family protein [Escherichia coli 3-373-03_S4_C3]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032300125.1| membrane protein [Escherichia coli]
 gb|KEL08755.1| TPR repeat family protein [Escherichia coli 4-203-08_S4_C2]
 gb|KEL50840.1| TPR repeat family protein [Escherichia coli 5-172-05_S3_C1]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032183125.1| membrane protein [Escherichia coli]
 gb|KDY66456.1| TPR repeat family protein [Escherichia coli 2-460-02_S4_C2]
 gb|KDY96036.1| TPR repeat family protein [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ36633.1| TPR repeat family protein [Escherichia coli 3-020-07_S3_C1]
 gb|KEJ53648.1| TPR repeat family protein [Escherichia coli 2-460-02_S4_C1]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662357.1| MULTISPECIES: bacteriophage N4 receptor, outer membrane subunit 
[Enterobacteriaceae]
 ref|NP_415100.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. MG1655]
 ref|YP_001729467.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. DH10B]
 ref|YP_001729568.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. DH10B]
 ref|YP_488855.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. W3110]
 sp|P31600.1|NFRA_ECOLI RecName: Full=Bacteriophage N4 adsorption protein A; Flags: Precursor 
[Escherichia coli K-12]
 gb|AAC36849.1| nfrA [Escherichia coli]
 dbj|BAA35202.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. W3110]
 gb|AAB40766.1| hypothetical bacteriophage N4 receptor protein [Escherichia coli]
 gb|AAC73669.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. MG1655]
 gb|ACB01689.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. DH10B]
 gb|ACB01790.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. DH10B]
 gb|ACR62053.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli BW2952]
 gb|ACX40689.1| TPR repeat-containing protein [Escherichia coli DH1]
 dbj|BAJ42392.1| bacteriophage N4 receptor, outer membranesubunit [Escherichia 
coli DH1]
 gb|EGB39315.1| tetratricopeptide [Escherichia coli E482]
 gb|EGB67403.1| tetratricopeptide [Escherichia coli TA007]
 gb|AEJ55195.1| bacteriophage N4 adsorption protein A [Escherichia coli UMNF18]
 gb|EGU25266.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli XH140A]
 gb|EGV45647.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli XH001]
 gb|EGW98162.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_EH250]
 gb|EGX12701.1| bacteriophage N4 adsorption protein A [Escherichia coli G58-1]
 gb|EGX20497.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_S1191]
 dbj|BAL37737.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. MDS42]
 gb|EHV64659.1| tetratricopeptide repeat family protein [Escherichia coli DEC6B]
 gb|EHV66411.1| tetratricopeptide repeat family protein [Escherichia coli DEC6C]
 gb|EHV76777.1| tetratricopeptide repeat family protein [Escherichia coli DEC6D]
 gb|EHV79275.1| tetratricopeptide repeat family protein [Escherichia coli DEC6E]
 gb|AFG39431.1| Bacteriophage N4 adsorption protein A precursor [Escherichia 
coli P12b]
 gb|EIE36065.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli J53]
 gb|EIF86849.1| hypothetical protein ESMG_01076 [Escherichia coli M919]
 gb|EII47978.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
2.3916]
 gb|EII78968.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
3.2303]
 gb|EIJ02177.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
B41]
 gb|EKI30702.1| tetratricopeptide [Escherichia coli TW00353]
 gb|ELF22005.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE156]
 gb|ELH50118.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE197]
 gb|EMD14689.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli S17]
 gb|EMS10177.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O127:H27 str. C43/90]
 gb|EOU70197.1| phage receptor, outer membrane subunit [Escherichia coli KTE14]
 gb|EOW62104.1| phage receptor, outer membrane subunit [Escherichia coli KTE155]
 gb|EQS85073.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 164 (4-5953081)]
 gb|EQW98044.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3139-1]
 gb|EQZ04756.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3329-1]
 gb|ERA22325.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3889-1]
 gb|ERB15662.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3150-1]
 gb|AGX32705.1| bacteriophage N4 receptor, outer membrane subunit [synthetic 
Escherichia coli C321.deltaA]
 emb|CDJ71027.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli str. K-12 substr. MC4100]
 gb|EST60525.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli ECC-Z]
 gb|EST78216.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli ECA-727]
 gb|AHF25974.1| tetratricopeptide repeat protein [uncultured bacterium Contigcl_1559]
 gb|EYE29279.1| TPR repeat family protein [Escherichia coli 1-110-08_S3_C2]
 gb|EZA71198.1| membrane protein [Escherichia coli O157:H16 str. 98-3133]
 emb|CDP77274.1| Bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli D6-117.29]
 gb|KDT75445.1| TPR repeat family protein [Escherichia coli 3-373-03_S3_C3]
 gb|KEL58440.1| TPR repeat family protein [Escherichia coli 5-172-05_S4_C3]
 gb|AIF35937.1| membrane protein [Escherichia coli KLY]
 emb|CEE08265.1| tetratricopeptide repeat family protein [Escherichia coli]
 gb|AIN31057.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli BW25113]
 gb|KGA84367.1| membrane protein [Escherichia coli]
 emb|CDY55851.1| bacteriophage N4 receptor, outer membrane protein [Escherichia 
coli]
 emb|CDZ19434.1| bacteriophage N4 receptor, outer membrane protein [Escherichia 
coli]
 gb|KGL70666.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli NCTC 50110]
 gb|KGM68449.1| Bacteriophage N4 adsorption protein A [Escherichia coli]
 gb|KGM77993.1| Bacteriophage N adsorption protein A [Escherichia coli]
 gb|KGM80702.1| Bacteriophage N4 adsorption protein A precursor [Escherichia 
coli]
 gb|KHD42621.1| membrane protein [Escherichia coli]
 gb|KHD56661.1| membrane protein [Escherichia coli]
 gb|KHH71025.1| membrane protein [Escherichia coli]
 gb|AIZ31084.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli ER2796]
 gb|AIZ54409.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli K-12]
 gb|AIZ92289.1| membrane protein [Escherichia coli str. K-12 substr. MG1655]
 gb|AJB50719.1| membrane protein [Escherichia coli]
 gb|KIG44171.1| membrane protein [Escherichia coli]
 gb|KIH15956.1| membrane protein [Escherichia coli]
 gb|KJD86378.1| membrane protein [Escherichia coli]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_021570528.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|EQY83481.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3317-1]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_016236951.1| phage receptor, outer membrane subunit [Escherichia coli]
 gb|EOX00520.1| phage receptor, outer membrane subunit [Escherichia coli KTE41]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662371.1| hypothetical protein [Escherichia coli]
 gb|EII20185.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
9.0111]
 gb|KDV61379.1| membrane protein [Escherichia coli O128:H2 str. 2011C-3317]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001333623.1| hypothetical protein [Escherichia coli]
 gb|EFJ68443.1| tetratricopeptide repeat protein [Escherichia coli MS 175-1]
 gb|EFK14939.1| tetratricopeptide repeat protein [Escherichia coli MS 116-1]
 gb|ELF77482.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE42]
 gb|ESD97729.1| tetratricopeptide repeat protein [Escherichia coli 908658]
 emb|CDK83670.1| Bacteriophage N4 adsorption protein A [Escherichia coli IS25]
 gb|KHI13108.1| membrane protein [Escherichia coli]
 gb|KHI17434.1| membrane protein [Escherichia coli]
 gb|KHI52252.1| membrane protein [Escherichia coli]
 gb|KIG79381.1| membrane protein [Escherichia coli]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044806704.1| membrane protein [Escherichia coli]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001737887.1| TPR repeat family protein [Escherichia coli]
 gb|EMZ88275.1| TPR repeat family protein [Escherichia coli 2722950]
Length=990

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032348046.1| membrane protein [Escherichia coli]
 gb|EZG56202.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4819]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_021568665.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ERB39399.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3292-1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001475079.1| TPR repeat family protein [Escherichia coli]
 gb|ENC49097.1| TPR repeat family protein [Escherichia coli P0299917.2]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KHI48030.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032179525.1| membrane protein [Escherichia coli]
 gb|KDY92699.1| TPR repeat family protein [Escherichia coli 2-474-04_S3_C1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032239146.1| membrane protein [Escherichia coli]
 gb|KDU31438.1| TPR repeat family protein [Escherichia coli 3-373-03_S4_C2]
 gb|KDU53517.1| TPR repeat family protein [Escherichia coli 3-373-03_S4_C1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032236611.1| membrane protein [Escherichia coli]
 gb|KDT47749.1| TPR repeat family protein [Escherichia coli 3-105-05_S3_C2]
 gb|KDT83212.1| TPR repeat family protein [Escherichia coli 3-475-03_S4_C1]
 gb|KDU41278.1| TPR repeat family protein [Escherichia coli 3-073-06_S4_C1]
 gb|KDZ81275.1| TPR repeat family protein [Escherichia coli 3-073-06_S4_C3]
 gb|KEL36808.1| TPR repeat family protein [Escherichia coli 5-172-05_S4_C1]
 gb|KEM66788.1| TPR repeat family protein [Escherichia coli 7-233-03_S1_C2]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032189602.1| membrane protein [Escherichia coli]
 gb|EYE27981.1| TPR repeat family protein [Escherichia coli 1-110-08_S3_C1]
 gb|KDY58857.1| TPR repeat family protein [Escherichia coli 2-460-02_S3_C3]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001503944.1| TPR repeat family protein [Escherichia coli]
 gb|END35250.1| TPR repeat family protein [Escherichia coli 179100]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001412769.1| TPR repeat family protein [Escherichia coli]
 gb|ENB24982.1| TPR repeat family protein [Escherichia coli BCE011_MS-01]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EID66306.1| tetratricopeptide repeat protein [Escherichia coli W26]
 gb|EIE53799.1| tetratricopeptide repeat protein [Escherichia coli AI27]
Length=970

 Score =   420 bits (1079),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  11   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  70

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  71   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  130

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  131  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  190

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  191  ARQQNTLSAAERRQWFDVLLAGQLDD  216



>ref|WP_001361269.1| hypothetical protein [Escherichia coli]
 gb|EHN90396.1| bacteriophage N4 adsorption protein A [Escherichia coli B093]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032299525.1| membrane protein [Escherichia coli]
 gb|KDU65411.1| TPR repeat family protein [Escherichia coli 4-203-08_S4_C3]
 gb|KEL13278.1| TPR repeat family protein [Escherichia coli 4-203-08_S3_C1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032190679.1| membrane protein [Escherichia coli]
 gb|KDA81126.1| TPR repeat family protein [Escherichia coli 2-011-08_S3_C2]
 gb|KDW74944.1| TPR repeat family protein [Escherichia coli 2-005-03_S4_C1]
 gb|KDZ17111.1| TPR repeat family protein [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ64618.1| TPR repeat family protein [Escherichia coli 3-073-06_S3_C2]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001573808.1| TPR repeat family protein [Escherichia coli]
 gb|ENE54681.1| TPR repeat family protein [Escherichia coli P0302293.9]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001532357.1| TPR repeat family protein [Escherichia coli]
 gb|ENE02557.1| TPR repeat family protein [Escherichia coli P0302293.7]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001482628.1| TPR repeat family protein [Escherichia coli]
 gb|ENC76260.1| TPR repeat family protein [Escherichia coli P0299917.8]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001712610.1| TPR repeat family protein [Escherichia coli]
 gb|EMW08293.1| TPR repeat family protein [Escherichia coli 2853500]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001564504.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ELE65612.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE77]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001447048.1| hypothetical protein [Escherichia coli]
 gb|EIL61660.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli 75]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032238579.1| membrane protein [Escherichia coli]
 gb|KDT78966.1| TPR repeat family protein [Escherichia coli 3-475-03_S1_C1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_021530398.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|EQR44898.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 121 (4-6877826)]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001477981.1| TPR repeat family protein [Escherichia coli]
 gb|ENC59747.1| TPR repeat family protein [Escherichia coli P0299917.4]
 gb|EZJ24464.1| TPR repeat family protein [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ46498.1| TPR repeat family protein [Escherichia coli 1-182-04_S4_C2]
 gb|KDT93117.1| TPR repeat family protein [Escherichia coli 3-267-03_S3_C2]
 gb|KDY27464.1| TPR repeat family protein [Escherichia coli 2-427-07_S1_C2]
 gb|KEK78943.1| TPR repeat family protein [Escherichia coli 3-475-03_S1_C2]
 gb|KEM35548.1| TPR repeat family protein [Escherichia coli 6-319-05_S1_C3]
 gb|KEM69620.1| TPR repeat family protein [Escherichia coli 6-537-08_S3_C1]
 gb|KEM80286.1| TPR repeat family protein [Escherichia coli 6-537-08_S3_C1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001724515.1| TPR repeat family protein [Escherichia coli]
 gb|EMW52557.1| TPR repeat family protein [Escherichia coli 2780750]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032258812.1| membrane protein [Escherichia coli]
 gb|KDU33851.1| TPR repeat family protein [Escherichia coli 3-373-03_S1_C3]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032240328.1| membrane protein [Escherichia coli]
 gb|KEK84343.1| TPR repeat family protein [Escherichia coli 3-475-03_S3_C2]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_038996409.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033801324.1| membrane protein [Escherichia coli]
 gb|KIG70805.1| membrane protein [Escherichia coli]
Length=987

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033800880.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032141752.1| membrane protein [Escherichia coli]
 gb|KDF71019.1| hypothetical protein AE34_01091 [Escherichia coli BIDMC 59]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032235953.1| membrane protein [Escherichia coli]
 gb|KDA91377.1| TPR repeat family protein [Escherichia coli 1-176-05_S4_C2]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662366.1| hypothetical protein [Escherichia coli]
 ref|YP_002386016.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli IAI1]
 ref|YP_002401669.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli 55989]
 ref|YP_006780433.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 2011C-3493]
 dbj|BAG76148.1| phage N4 adsorption protein A [Escherichia coli SE11]
 emb|CAU96426.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli 55989]
 emb|CAQ97413.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli IAI1]
 dbj|BAI29434.1| bacteriophage N4 receptor outer membrane subunit NfrA [Escherichia 
coli O103:H2 str. 12009]
 gb|EFJ89377.1| tetratricopeptide repeat protein [Escherichia coli MS 84-1]
 gb|EFK48070.1| tetratricopeptide repeat protein [Escherichia coli MS 119-7]
 gb|EFO56432.1| tetratricopeptide repeat protein [Escherichia coli MS 145-7]
 gb|EFU32770.1| tetratricopeptide repeat protein [Escherichia coli MS 85-1]
 gb|EFW72918.1| Bacteriophage N4 adsorption protein A precursor [Escherichia 
coli EC4100B]
 gb|EGB88776.1| tetratricopeptide repeat protein [Escherichia coli MS 117-3]
 gb|EGC10747.1| tetratricopeptide [Escherichia coli E1167]
 gb|EGI38002.1| bacteriophage N4 adsorption protein A [Escherichia coli TA271]
 gb|EGI47548.1| bacteriophage N4 adsorption protein A [Escherichia coli H591]
 gb|EGJ07390.1| tetratricopeptide repeat protein [Escherichia coli D9]
 gb|EGR64853.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 01-09591]
 gb|EGR75749.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. LB226692]
 gb|EGT66691.1| hypothetical protein C22711_0719 [Escherichia coli O104:H4 str. 
C227-11]
 gb|EGW86462.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_94C]
 gb|EGX25157.1| bacteriophage N4 adsorption protein A [Escherichia coli TX1999]
 gb|EHF18815.1| hypothetical protein EUDG_03864 [Escherichia coli O104:H4 str. 
04-8351]
 gb|EHF20684.1| hypothetical protein EUAG_00844 [Escherichia coli O104:H4 str. 
C227-11]
 gb|EHF27356.1| hypothetical protein EUBG_00841 [Escherichia coli O104:H4 str. 
C236-11]
 gb|EHF37629.1| hypothetical protein EUEG_00829 [Escherichia coli O104:H4 str. 
09-7901]
 gb|EHF39914.1| hypothetical protein EUHG_00845 [Escherichia coli O104:H4 str. 
11-4404]
 gb|EHF43976.1| hypothetical protein EUFG_00843 [Escherichia coli O104:H4 str. 
11-3677]
 gb|EHF46256.1| hypothetical protein EUIG_00850 [Escherichia coli O104:H4 str. 
11-4522]
 gb|EHF49285.1| hypothetical protein EUJG_02742 [Escherichia coli O104:H4 str. 
11-4623]
 gb|EHF61759.1| hypothetical protein EUKG_00826 [Escherichia coli O104:H4 str. 
11-4632 C1]
 gb|EHF65946.1| hypothetical protein EULG_00844 [Escherichia coli O104:H4 str. 
11-4632 C2]
 gb|EHF68426.1| hypothetical protein EUMG_00843 [Escherichia coli O104:H4 str. 
11-4632 C3]
 gb|EHF78798.1| hypothetical protein EUOG_00844 [Escherichia coli O104:H4 str. 
11-4632 C5]
 gb|EHF82445.1| hypothetical protein EUNG_00345 [Escherichia coli O104:H4 str. 
11-4632 C4]
 gb|EHV81784.1| tetratricopeptide repeat family protein [Escherichia coli DEC7A]
 gb|EHV90610.1| tetratricopeptide repeat family protein [Escherichia coli DEC7C]
 gb|EHV95087.1| tetratricopeptide repeat family protein [Escherichia coli DEC7D]
 gb|EHW04885.1| tetratricopeptide repeat family protein [Escherichia coli DEC7E]
 gb|EHW97289.1| tetratricopeptide repeat family protein [Escherichia coli DEC11A]
 gb|EHX07410.1| tetratricopeptide repeat family protein [Escherichia coli DEC11B]
 gb|EHX17406.1| tetratricopeptide repeat family protein [Escherichia coli DEC11C]
 gb|EHX82272.1| tetratricopeptide repeat family protein [Escherichia coli DEC14A]
 gb|EIG44976.1| hypothetical protein ESTG_02967 [Escherichia coli B799]
 gb|EIH01114.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
5.0588]
 gb|EIH56855.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
3.2608]
 gb|EIH69234.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
93.0624]
 gb|EII33201.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
4.0967]
 gb|EII56996.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
3.3884]
 gb|EIL01486.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O103:H2 str. CVM9450]
 gb|EIL65066.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli 541-1]
 gb|EIL80283.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli CUMT8]
 gb|EIQ67356.1| tetratricopeptide repeat family protein [Escherichia coli EPECa12]
 gb|AFS58422.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 2009EL-2050]
 gb|AFS75632.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 2011C-3493]
 gb|AFS85067.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 2009EL-2071]
 gb|EKJ61836.1| bacteriophage N4 adsorption protein A [Escherichia coli 0.1288]
 gb|EKY88364.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-02030]
 gb|EKY89063.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-02033-1]
 gb|EKY89814.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-02092]
 gb|EKZ03619.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-02093]
 gb|EKZ04521.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-02281]
 gb|EKZ06990.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-02318]
 gb|EKZ19275.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-02913]
 gb|EKZ21498.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-03943]
 gb|EKZ22020.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-03439]
 gb|EKZ33607.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. 11-04080]
 gb|EKZ35204.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-9450]
 gb|EKZ35391.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-9990]
 gb|EKZ46772.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-4984]
 gb|EKZ48647.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-4986]
 gb|EKZ55573.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-4987]
 gb|EKZ64074.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-5603]
 gb|EKZ70862.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-4988]
 gb|EKZ71680.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-5604]
 gb|EKZ76182.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec12-0465]
 gb|EKZ80748.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-6006]
 gb|EKZ87000.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec12-0466]
 gb|EKZ92445.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. Ec11-9941]
 gb|ELC23033.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE12]
 gb|ELD24410.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE210]
 gb|ELF15854.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE142]
 gb|ELG01517.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE48]
 gb|ELG44231.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE101]
 gb|ELG44649.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE91]
 gb|ELG65184.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE135]
 gb|ELG72471.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE136]
 gb|ELH37282.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE184]
 gb|ELH54313.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE203]
 gb|ELJ18679.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE163]
 gb|ELJ29274.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE166]
 gb|ELJ85044.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE90]
 gb|EMS05530.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. E92/11]
 gb|EMS08362.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O104:H4 str. E112/10]
 gb|EMV35936.1| TPR repeat family protein [Escherichia coli BCE002_MS12]
 gb|EMV48960.1| TPR repeat family protein [Escherichia coli 2872800]
 gb|EMW11515.1| TPR repeat family protein [Escherichia coli 2850750]
 gb|EMW24220.1| TPR repeat family protein [Escherichia coli 2850400]
 gb|EMW57141.1| TPR repeat family protein [Escherichia coli 2770900]
 gb|EMX17478.1| TPR repeat family protein [Escherichia coli P0302293.2]
 gb|EMX55147.1| TPR repeat family protein [Escherichia coli MP020980.2]
 gb|EMX56231.1| TPR repeat family protein [Escherichia coli Jurua 20/10]
 gb|EMX59967.1| TPR repeat family protein [Escherichia coli MP020940.1]
 gb|EMX72113.1| TPR repeat family protein [Escherichia coli Envira 10/1]
 gb|EMX77667.1| TPR repeat family protein [Escherichia coli Envira 8/11]
 gb|EMX94574.1| TPR repeat family protein [Escherichia coli BCE001_MS16]
 gb|EMZ69158.1| TPR repeat family protein [Escherichia coli 174900]
 gb|EMZ72213.1| TPR repeat family protein [Escherichia coli 2735000]
 gb|EMZ87818.1| TPR repeat family protein [Escherichia coli p0305293.1]
 gb|EMZ99577.1| TPR repeat family protein [Escherichia coli P0304816.1]
 gb|ENA55984.1| TPR repeat family protein [Escherichia coli 2729250]
 gb|ENA71555.1| TPR repeat family protein [Escherichia coli 180200]
 gb|ENA99463.1| TPR repeat family protein [Escherichia coli 2864350]
 gb|ENB00509.1| TPR repeat family protein [Escherichia coli 2860650]
 gb|ENB10622.1| TPR repeat family protein [Escherichia coli 2866350]
 gb|ENB43039.1| TPR repeat family protein [Escherichia coli MP021561.3]
 gb|ENC64468.1| TPR repeat family protein [Escherichia coli P0299917.3]
 gb|ENC76565.1| TPR repeat family protein [Escherichia coli P0299917.6]
 gb|ENC86467.1| TPR repeat family protein [Escherichia coli P0299917.9]
 gb|END55907.1| TPR repeat family protein [Escherichia coli MP020980.1]
 gb|END83034.1| TPR repeat family protein [Escherichia coli P0299483.2]
 gb|END85732.1| TPR repeat family protein [Escherichia coli P0299483.3]
 gb|ENE15121.1| TPR repeat family protein [Escherichia coli p0305293.14]
 gb|ENE25310.1| TPR repeat family protein [Escherichia coli P0302293.3]
 gb|ENE39086.1| TPR repeat family protein [Escherichia coli P0302293.6]
 gb|ENE45657.1| TPR repeat family protein [Escherichia coli P0302293.8]
 gb|ENF23037.1| TPR repeat family protein [Escherichia coli P0304816.11]
 gb|ENF26474.1| TPR repeat family protein [Escherichia coli P0304816.10]
 gb|ENF35068.1| TPR repeat family protein [Escherichia coli P0304816.12]
 gb|ENF38251.1| TPR repeat family protein [Escherichia coli P0304816.14]
 gb|ENF42652.1| TPR repeat family protein [Escherichia coli P0304816.13]
 gb|ENF56346.1| TPR repeat family protein [Escherichia coli P0304816.6]
 gb|ENF73892.1| TPR repeat family protein [Escherichia coli P0304816.8]
 gb|ENG47565.1| TPR repeat family protein [Escherichia coli p0305293.11]
 gb|ENG55658.1| TPR repeat family protein [Escherichia coli p0305293.15]
 gb|ENG69292.1| TPR repeat family protein [Escherichia coli p0305293.4]
 gb|ENG73863.1| TPR repeat family protein [Escherichia coli p0305293.8]
 gb|ENG79718.1| TPR repeat family protein [Escherichia coli p0305293.9]
 gb|ENH37398.1| TPR repeat family protein [Escherichia coli P0304816.4]
 gb|ENH42905.1| TPR repeat family protein [Escherichia coli P0304816.5]
 gb|ENH47672.1| TPR repeat family protein [Escherichia coli p0305293.5]
 gb|ENH54408.1| TPR repeat family protein [Escherichia coli p0305293.7]
 gb|ENH58396.1| TPR repeat family protein [Escherichia coli p0305293.6]
 gb|ENO09375.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O157:H43 str. T22]
 gb|EOU36468.1| phage receptor, outer membrane subunit [Escherichia coli KTE13]
 gb|EOV38637.1| phage receptor, outer membrane subunit [Escherichia coli KTE222]
 gb|EOV44065.1| phage receptor, outer membrane subunit [Escherichia coli KTE221]
 gb|EPH50414.1| Bacteriophage N4 adsorption protein A [Escherichia coli E2265]
 gb|EQN71377.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 18 (4-8589585)]
 gb|EQO35213.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 33 (4-2174936)]
 gb|EQP85686.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 82 (4-2209276)]
 gb|EQS35760.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 147 (4-5893887)]
 gb|EQS58304.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 150 (4-3258106)]
 gb|EQU31117.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 200 (4-4449924)]
 gb|EQV49535.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KOEGE 33 (68a)]
 gb|EQW15407.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KOEGE 131 (358a)]
 gb|EQW47650.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3065-1]
 gb|EQX60312.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3176-1]
 gb|EQZ20038.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3355-1]
 gb|ESA84111.1| tetratricopeptide repeat protein [Escherichia coli 907357]
 gb|ESC96763.1| tetratricopeptide repeat protein [Escherichia coli 113302]
 gb|ESD18528.1| tetratricopeptide repeat protein [Escherichia coli 907710]
 gb|ESD73097.1| tetratricopeptide repeat protein [Escherichia coli 908541]
 gb|ESK09708.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3336-1]
 gb|ESP09950.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 36 (4-5675286)]
 gb|EST00717.1| Bacteriophage N4 adsorption protein A [Escherichia coli CE418]
 gb|EST76324.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli ECC-1470]
 gb|ESV02170.1| Bacteriophage N4 adsorption protein A [Escherichia coli E1777]
 gb|ETD44990.1| hypothetical protein Q459_23255 [Escherichia coli ATCC BAA-2215]
 gb|EYB43754.1| membrane protein [Escherichia coli]
 gb|EYU93758.1| membrane protein [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYX63773.1| membrane protein [Escherichia coli O104:H4 str. 2011EL-1675A]
 gb|EYX89123.1| membrane protein [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYZ15060.1| membrane protein [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EYZ58405.1| membrane protein [Escherichia coli O79:H7 str. 06-3501]
 gb|EZA23468.1| membrane protein [Escherichia coli O45:H2 str. 01-3147]
 gb|EZE00325.1| membrane protein [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE18281.1| membrane protein [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE69340.1| membrane protein [Escherichia coli O45:H2 str. 2009C-4780]
 gb|KDG15444.1| hypothetical protein AE49_04124 [Escherichia coli BIDMC 74]
 gb|KDM86809.1| membrane protein [Escherichia coli]
 gb|KDV39135.1| membrane protein [Escherichia coli O146:H21 str. 2010C-3325]
 gb|KDV55330.1| membrane protein [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDW97694.1| TPR repeat family protein [Escherichia coli 2-210-07_S3_C2]
 gb|KDX10453.1| TPR repeat family protein [Escherichia coli 2-177-06_S4_C3]
 gb|KDX77155.1| TPR repeat family protein [Escherichia coli 2-222-05_S1_C3]
 gb|KDY03643.1| TPR repeat family protein [Escherichia coli 2-316-03_S3_C2]
 gb|KDY06970.1| TPR repeat family protein [Escherichia coli 2-316-03_S3_C3]
 gb|KDY94123.1| TPR repeat family protein [Escherichia coli 2-427-07_S1_C3]
 gb|KEM17017.1| TPR repeat family protein [Escherichia coli 6-319-05_S1_C2]
 gb|KEN10165.1| TPR repeat family protein [Escherichia coli 6-319-05_S1_C1]
 gb|KEN21502.1| TPR repeat family protein [Escherichia coli 6-537-08_S3_C2]
 gb|KEO94635.1| membrane protein [Escherichia coli]
 gb|AIF61603.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli B7A]
 gb|KFV27245.1| membrane protein [Escherichia coli]
 gb|KHG71522.1| membrane protein [Escherichia coli]
 gb|KHG91579.1| membrane protein [Escherichia coli]
 gb|KHH16752.1| membrane protein [Escherichia coli]
 gb|KHH21392.1| membrane protein [Escherichia coli]
 gb|KHH26017.1| membrane protein [Escherichia coli]
 gb|KHH27198.1| membrane protein [Escherichia coli]
 gb|KHI06236.1| membrane protein [Escherichia coli]
 gb|KHI33549.1| membrane protein [Escherichia coli]
 gb|KHI37062.1| membrane protein [Escherichia coli]
 gb|KHI59827.1| membrane protein [Escherichia coli]
 gb|KHI76730.1| membrane protein [Escherichia coli]
 gb|KHI86913.1| membrane protein [Escherichia coli]
 gb|KHI96464.1| membrane protein [Escherichia coli]
 gb|KHI99907.1| membrane protein [Escherichia coli]
 gb|KHJ07731.1| membrane protein [Escherichia coli]
 gb|KHJ13310.1| membrane protein [Escherichia coli]
 gb|KHJ21767.1| membrane protein [Escherichia coli]
 gb|KHJ27532.1| membrane protein [Escherichia coli]
 emb|CCQ27456.2| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|KIG55088.1| membrane protein [Escherichia coli]
 gb|KIG65092.1| membrane protein [Escherichia coli]
 gb|KIG82486.1| membrane protein [Escherichia coli]
 gb|KIG91690.1| membrane protein [Escherichia coli]
 gb|KIH07961.1| membrane protein [Escherichia coli]
 gb|KIH22678.1| membrane protein [Escherichia coli]
 gb|AJE54883.1| bacteriophage N4 outer membrane receptor [Escherichia coli]
 gb|KII10482.1| membrane protein [Escherichia coli]
 gb|AJG07588.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli ECC-1470]
 gb|KIO40055.1| membrane protein [Escherichia coli O139:H28 str. E24377A]
 gb|KIO88224.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
97.0264]
 gb|KIQ42580.1| membrane protein [Escherichia coli]
 gb|KIQ47441.1| membrane protein [Escherichia coli]
 gb|KIZ69374.1| membrane protein [Escherichia coli]
 gb|KJD60179.1| membrane protein [Escherichia coli]
 gb|KJD67639.1| membrane protein [Escherichia coli]
 gb|KJD78777.1| membrane protein [Escherichia coli]
 gb|KJD79881.1| membrane protein [Escherichia coli]
 gb|KJD83152.1| membrane protein [Escherichia coli]
 gb|KJD88709.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_021570035.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|EQY92525.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3314-1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_003909989.1| TPR repeat family protein [Escherichia coli]
 gb|ENF56509.1| TPR repeat family protein [Escherichia coli P0304816.2]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001508438.1| TPR repeat family protein [Escherichia coli]
 gb|END60261.1| TPR repeat family protein [Escherichia coli BCE006_MS-23]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662372.1| hypothetical protein [Escherichia coli]
 gb|EHX50341.1| tetratricopeptide repeat family protein [Escherichia coli DEC13A]
 gb|EHX64698.1| tetratricopeptide repeat family protein [Escherichia coli DEC13B]
 gb|EHX68815.1| tetratricopeptide repeat family protein [Escherichia coli DEC13D]
 gb|EHX69065.1| tetratricopeptide repeat family protein [Escherichia coli DEC13C]
 gb|EHX80129.1| tetratricopeptide repeat family protein [Escherichia coli DEC13E]
 gb|KEK75581.1| TPR repeat family protein [Escherichia coli 3-475-03_S3_C1]
 gb|KHI58620.1| membrane protein [Escherichia coli]
 gb|KIH20469.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662373.1| hypothetical protein [Escherichia coli]
 gb|EFZ70204.1| bacteriophage N4 adsorption protein A [Escherichia coli OK1357]
 gb|EGB41263.1| tetratricopeptide [Escherichia coli H120]
 gb|EGW76055.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_B2F1]
 gb|EIH36083.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
96.0497]
 gb|EIH44177.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
99.0741]
 gb|ELF90282.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE29]
 gb|EMX10230.1| TPR repeat family protein [Escherichia coli P0302308.1]
 gb|END24532.1| TPR repeat family protein [Escherichia coli P0302308.5]
 gb|END28425.1| TPR repeat family protein [Escherichia coli P0302308.4]
 gb|ENH24773.1| TPR repeat family protein [Escherichia coli P0302308.12]
 gb|ENH26112.1| TPR repeat family protein [Escherichia coli P0302308.13]
 gb|EQU01457.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 195 (3-7155360)]
 gb|EQY01625.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3201-1]
 gb|ERA10500.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3805-1]
 gb|EST66406.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli P4-96]
 gb|EST70551.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli P4-NR]
 emb|CDL28288.1| Bacteriophage N4 adsorption protein A [Escherichia coli ISC7]
 gb|EYY34060.1| membrane protein [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYZ40011.1| membrane protein [Escherichia coli O91:H14 str. 06-3691]
 gb|EZD91070.1| membrane protein [Escherichia coli O91:H14 str. 2009C-3227]
 gb|EZE29603.1| membrane protein [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE66099.1| membrane protein [Escherichia coli O91:H21 str. 2009C-4646]
 gb|KDG60053.1| hypothetical protein AF33_00542 [Escherichia coli CHS 77]
 gb|KDV46821.1| membrane protein [Escherichia coli O91:H21 str. 2009C-3740]
 gb|KDV88434.1| TPR repeat family protein [Escherichia coli 2-052-05_S4_C2]
 gb|KDZ08510.1| TPR repeat family protein [Escherichia coli 2-474-04_S4_C2]
 gb|KEN88000.1| TPR repeat family protein [Escherichia coli 2-474-04_S4_C1]
 gb|KFV24854.1| membrane protein [Escherichia coli]
 gb|KHG80241.1| membrane protein [Escherichia coli]
 gb|KHH33693.1| membrane protein [Escherichia coli]
 gb|KHH41020.1| membrane protein [Escherichia coli]
 gb|KHH55782.1| membrane protein [Escherichia coli]
 gb|AIZ81600.1| membrane protein [Escherichia coli]
 gb|KIH32706.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032198335.1| membrane protein, partial [Escherichia coli]
 gb|KEJ40785.1| TPR repeat family protein, partial [Escherichia coli 2-427-07_S4_C3]
Length=979

 Score =   420 bits (1079),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_042202318.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KHI43500.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033557269.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033551376.1| membrane protein [Escherichia coli]
 gb|KIH14237.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044863361.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033802250.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001375368.1| hypothetical protein [Escherichia coli]
 gb|ABV21105.1| bacteriophage N4 adsorption protein A precursor [Escherichia 
coli O139:H28 str. E24377A]
 dbj|BAI23965.1| bacteriophage N4 receptor outer membrane subunit NfrA [Escherichia 
coli O26:H11 str. 11368]
 gb|EHW24305.1| tetratricopeptide repeat family protein [Escherichia coli DEC8C]
 gb|EHW42818.1| tetratricopeptide repeat family protein [Escherichia coli DEC9A]
 gb|EHW44152.1| tetratricopeptide repeat family protein [Escherichia coli DEC9B]
 gb|EHW51506.1| tetratricopeptide repeat family protein [Escherichia coli DEC9C]
 gb|EHW56082.1| tetratricopeptide repeat family protein [Escherichia coli DEC9D]
 gb|EHW63043.1| tetratricopeptide repeat family protein [Escherichia coli DEC9E]
 gb|EHW68699.1| tetratricopeptide repeat family protein [Escherichia coli DEC10A]
 gb|EHW77894.1| tetratricopeptide repeat family protein [Escherichia coli DEC10B]
 gb|EHW79923.1| tetratricopeptide repeat family protein [Escherichia coli DEC10C]
 gb|EHW82709.1| tetratricopeptide repeat family protein [Escherichia coli DEC10D]
 gb|EIJ17480.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
900105 (10e)]
 gb|EIL29669.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11 str. CVM9942]
 gb|EIL36684.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11 str. CVM10026]
 gb|EJE60336.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11 str. CVM10224]
 gb|EJE70293.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O111:H11 str. CVM9455]
 gb|EJE74808.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O111:H11 str. CVM9553]
 gb|EJE77790.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11 str. CVM10021]
 gb|EJE91173.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11 str. CVM10030]
 gb|EJE91959.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11 str. CVM9952]
 gb|EKJ26855.1| bacteriophage N4 receptor outer membrane subunit NfrA [Escherichia 
coli EC1865]
 gb|EKT98444.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11 str. CFSAN001629]
 gb|EKU06323.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O111:H11 str. CFSAN001630]
 gb|EQY68886.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3240-1]
 gb|ETI78646.1| hypothetical protein Q457_07865 [Escherichia coli ATCC BAA-2196]
 gb|ETJ59580.1| hypothetical protein Q456_0207420 [Escherichia coli ATCC BAA-2193]
 gb|EYU73260.1| membrane protein [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYV57794.1| membrane protein [Escherichia coli O103:H11 str. 2010C-3214]
 gb|EYX04687.1| membrane protein [Escherichia coli O118:H16 str. 08-3651]
 gb|EYX11605.1| membrane protein [Escherichia coli O69:H11 str. 07-4281]
 gb|EYY72145.1| membrane protein [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYZ64457.1| membrane protein [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ75224.1| membrane protein [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ78262.1| membrane protein [Escherichia coli O118:H16 str. 06-3256]
 gb|EZA32147.1| membrane protein [Escherichia coli O26:H11 str. 05-3646]
 gb|EZD95195.1| membrane protein [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE17050.1| membrane protein [Escherichia coli O123:H11 str. 2009C-3307]
 gb|EZE31279.1| membrane protein [Escherichia coli O69:H11 str. 2009C-3601]
 gb|EZE56934.1| membrane protein [Escherichia coli O118:H16 str. 2009C-4446]
 gb|EZG45640.1| membrane protein [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG47619.1| membrane protein [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG59772.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4430]
 gb|EZG66859.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4834]
 gb|EZG67122.1| membrane protein [Escherichia coli O26:H11 str. 2010C-5028]
 gb|EZG80702.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3270]
 gb|EZG84528.1| membrane protein [Escherichia coli O26:H11 str. 2010EL-1699]
 gb|EZG91706.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3282]
 gb|EZG93172.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3506]
 gb|EZG95254.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3387]
 gb|EZH09027.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3655]
 gb|EZH11905.1| membrane protein [Escherichia coli O26:H11 str. 2009C-3689]
 gb|EZH13928.1| membrane protein [Escherichia coli O26:H11 str. 2009C-3612]
 gb|EZH22997.1| membrane protein [Escherichia coli O26:H11 str. 2009C-4760]
 gb|EZH34964.1| membrane protein [Escherichia coli O26:H11 str. 2009C-4826]
 gb|EZH36117.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3472]
 gb|EZH41494.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3051]
 gb|EZH42259.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3871]
 gb|EZH50332.1| membrane protein [Escherichia coli O26:H11 str. 2010C-3902]
 gb|EZH50999.1| membrane protein [Escherichia coli O26:H11 str. 2010C-4244]
 gb|EZQ21749.1| membrane protein [Escherichia coli O26:H1 str. 2009C-4747]
 gb|KDM71234.1| membrane protein [Escherichia coli]
 gb|KDU14256.1| TPR repeat family protein [Escherichia coli 3-267-03_S1_C1]
 gb|KDV31778.1| membrane protein [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV70816.1| membrane protein [Escherichia coli O26:H11 str. 2011C-3274]
 gb|KDV72463.1| membrane protein [Escherichia coli O118:H16 str. 07-4255]
 emb|CEK03612.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O26:H11]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001529787.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ELC63972.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE44]
 gb|ERB32322.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3271-1]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001396984.1| hypothetical protein [Escherichia coli]
 gb|EIL00341.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O103:H25 str. CVM9340]
 gb|EYX82595.1| membrane protein [Escherichia coli O156:H25 str. 2011C-3602]
 gb|EYZ23126.1| membrane protein [Escherichia coli O103:H25 str. 2010C-4529]
 gb|KHH99290.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001443997.1| hypothetical protein [Escherichia coli]
 gb|EIK98992.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O111:H11 str. CVM9534]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001443023.1| hypothetical protein [Escherichia coli]
 gb|EIF16419.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O32:H37 str. P4]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001325448.1| hypothetical protein [Escherichia coli]
 gb|EFJ95686.1| tetratricopeptide repeat protein [Escherichia coli MS 115-1]
 gb|ELD73125.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE234]
 gb|EOV64908.1| phage receptor, outer membrane subunit [Escherichia coli KTE64]
 gb|EOW09970.1| phage receptor, outer membrane subunit [Escherichia coli KTE100]
Length=990

 Score =   420 bits (1080),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032185920.1| membrane protein [Escherichia coli]
 gb|KDZ11300.1| TPR repeat family protein [Escherichia coli 2-474-04_S4_C3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001497410.1| TPR repeat family protein [Escherichia coli]
 gb|ENH24131.1| TPR repeat family protein [Escherichia coli P0302308.14]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001494022.1| TPR repeat family protein [Escherichia coli]
 gb|END05740.1| TPR repeat family protein [Escherichia coli P0302308.11]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032350024.1| membrane protein [Escherichia coli]
 gb|KEL21811.1| TPR repeat family protein [Escherichia coli 5-366-08_S4_C2]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032258018.1| membrane protein [Escherichia coli]
 gb|KDX54080.1| TPR repeat family protein [Escherichia coli 2-210-07_S4_C2]
 gb|KDZ20086.1| TPR repeat family protein [Escherichia coli 3-020-07_S1_C2]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001624817.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ELC91585.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE193]
 gb|ELI32885.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE112]
 gb|EQW91639.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3124-1]
 gb|EQZ69709.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3671-1]
 gb|ESM40692.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli BWH 32]
 gb|KHI32816.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044866052.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033547729.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_022581703.1| hypothetical protein [Escherichia coli]
 gb|ETJ66533.1| hypothetical protein O199_0224935 [Escherichia coli ATCC 35150]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662355.1| bacteriophage N4 adsorption protein A [Escherichia coli]
 gb|AHG13216.1| Bacteriophage N4 adsorption protein A precursor [Escherichia 
coli O145:H28 str. RM13516]
 gb|AHG07285.1| Bacteriophage N4 adsorption protein A precursor [Escherichia 
coli O145:H28 str. RM13514]
 gb|EYV14606.1| membrane protein [Escherichia coli O145:NM str. 2010C-3526]
 gb|EYV20434.1| membrane protein [Escherichia coli O145:NM str. 2010C-3521]
 gb|EYV26515.1| membrane protein [Escherichia coli O145:NM str. 2010C-3517]
 gb|EYV29988.1| membrane protein [Escherichia coli O145:NM str. 2010C-3518]
 gb|EYV32988.1| membrane protein [Escherichia coli O145:NM str. 2010C-3516]
 gb|EYV40939.1| membrane protein [Escherichia coli O145:NM str. 2010C-3511]
 gb|EYV42784.1| membrane protein [Escherichia coli O145:NM str. 2010C-3510]
 gb|EYV48061.1| membrane protein [Escherichia coli O145:NM str. 2010C-3509]
 gb|EYV48946.1| membrane protein [Escherichia coli O145:NM str. 2010C-3507]
 gb|EYW91709.1| membrane protein [Escherichia coli O145:NM str. 08-4270]
 gb|EYZ16284.1| membrane protein [Escherichia coli O145:NM str. 2010C-4557C2]
 gb|EYZ72083.1| membrane protein [Escherichia coli O145:NM str. 06-3484]
 gb|EZE93672.1| membrane protein [Escherichia coli O145:NM str. 2010C-3508]
 gb|AHY63557.1| Bacteriophage N4 adsorption protein A precursor [Escherichia 
coli O145:H28 str. RM12761]
 gb|AHY69112.1| Bacteriophage N4 adsorption protein A precursor [Escherichia 
coli O145:H28 str. RM12581]
 gb|KDM73628.1| membrane protein [Escherichia coli O145:H28 str. 4865/96]
 gb|KDM81349.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_016241958.1| phage receptor, outer membrane subunit [Escherichia coli]
 gb|EOV82292.1| phage receptor, outer membrane subunit [Escherichia coli KTE73]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|END72354.1| TPR repeat family protein [Escherichia coli P0299483.1]
Length=970

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  11   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  70

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  71   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  130

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  131  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  190

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  191  ARQQNTLSAAERRQWFDVLLAGQLDD  216



>ref|WP_032259438.1| membrane protein [Escherichia coli]
 gb|KDW22817.1| TPR repeat family protein [Escherichia coli 2-177-06_S3_C1]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032170871.1| membrane protein [Escherichia coli]
 gb|KDG88278.1| hypothetical protein AE16_00369 [Escherichia coli UCI 57]
 gb|KDG91817.1| hypothetical protein AE17_00356 [Escherichia coli UCI 58]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662362.1| hypothetical protein [Escherichia coli]
 gb|EDV88091.1| bacteriophage N4 adsorption protein A precursor [Escherichia 
coli E110019]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662361.1| hypothetical protein [Escherichia coli]
 gb|EHY11241.1| tetratricopeptide repeat family protein [Escherichia coli DEC15B]
 gb|EHY12203.1| tetratricopeptide repeat family protein [Escherichia coli DEC15C]
 gb|EHY17219.1| tetratricopeptide repeat family protein [Escherichia coli DEC15D]
 gb|EHY21128.1| tetratricopeptide repeat family protein [Escherichia coli DEC15E]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662360.1| hypothetical protein [Escherichia coli]
 gb|EHY04700.1| tetratricopeptide repeat family protein [Escherichia coli DEC15A]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_040090045.1| membrane protein [Escherichia coli]
 gb|KHH09848.1| membrane protein [Escherichia coli]
 gb|KHI75825.1| membrane protein [Escherichia coli]
 gb|KIH37318.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032220419.1| membrane protein [Escherichia coli]
 gb|KEN59877.1| TPR repeat family protein [Escherichia coli 6-537-08_S1_C3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662364.1| hypothetical protein [Escherichia coli]
 gb|EFE64607.1| bacteriophage N4 receptor [Escherichia coli B088]
 gb|EIH26381.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
1.2264]
 gb|EJK97586.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_O31]
 gb|EQS02104.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 139 (4-3192644)]
 gb|EYZ97489.1| membrane protein [Escherichia coli O174:H21 str. 03-3269]
 gb|KDW64200.1| TPR repeat family protein [Escherichia coli 2-005-03_S3_C3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001580085.1| TPR repeat family protein [Escherichia coli]
 gb|EMW84748.1| TPR repeat family protein [Escherichia coli 180600]
 gb|EMX04217.1| TPR repeat family protein [Escherichia coli P0304777.1]
 gb|EMX65611.1| TPR repeat family protein [Escherichia coli Jurua 18/11]
 gb|ENE59183.1| TPR repeat family protein [Escherichia coli P0304777.11]
 gb|ENE71829.1| TPR repeat family protein [Escherichia coli P0304777.13]
 gb|ENE76356.1| TPR repeat family protein [Escherichia coli P0304777.14]
 gb|ENE81657.1| TPR repeat family protein [Escherichia coli P0304777.15]
 gb|ENE81931.1| TPR repeat family protein [Escherichia coli P0304777.2]
 gb|ENE89215.1| TPR repeat family protein [Escherichia coli P0304777.3]
 gb|ENF03263.1| TPR repeat family protein [Escherichia coli P0304777.7]
 gb|ENF06907.1| TPR repeat family protein [Escherichia coli P0304777.5]
 gb|ENF15521.1| TPR repeat family protein [Escherichia coli P0304777.9]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EFF06885.1| bacteriophage N4 receptor [Escherichia coli B185]
Length=997

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  38   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  97

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  98   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  157

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  158  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  217

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  218  ARQQNTLSAAERRQWFDVLLAGQLDD  243



>ref|WP_044782265.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032250492.1| membrane protein [Escherichia coli]
 gb|KDZ77951.1| TPR repeat family protein [Escherichia coli 3-105-05_S1_C2]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001300620.1| hypothetical protein [Escherichia coli]
 gb|EDU64162.1| bacteriophage N4 adsorption protein A precursor [Escherichia 
coli 53638]
 gb|ACT38210.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli B str. REL606]
 emb|CBJ00097.1| bacteriophage N4 adsorption protein A [Escherichia coli ETEC 
H10407]
 gb|ELD32091.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE212]
 gb|ELF11709.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE119]
 gb|ELJ61532.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE232]
 gb|EMU99184.1| TPR repeat family protein [Escherichia coli MP021017.4]
 gb|EMV10043.1| TPR repeat family protein [Escherichia coli MP021017.10]
 gb|EMV29389.1| TPR repeat family protein [Escherichia coli MP021017.12]
 gb|EMV90630.1| TPR repeat family protein [Escherichia coli 2861200]
 gb|EMW86962.1| TPR repeat family protein [Escherichia coli 2731150]
 gb|EMX41728.1| TPR repeat family protein [Escherichia coli MP021017.1]
 gb|ENA18918.1| TPR repeat family protein [Escherichia coli BCE008_MS-13]
 gb|ENB20982.1| TPR repeat family protein [Escherichia coli BCE008_MS-01]
 gb|EQY31817.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3212-1]
 gb|EQZ70265.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 3682-1]
 gb|ERB09492.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KOEGE 7 (16a)]
 gb|ESA98217.1| tetratricopeptide repeat protein [Escherichia coli 909945-2]
 gb|AHM28611.1| membrane protein [Escherichia coli]
 gb|AHM35538.1| membrane protein [Escherichia coli]
 gb|AHM40135.1| membrane protein [Escherichia coli]
 gb|EZA32199.1| membrane protein [Escherichia coli O103:H11 str. 04-3023]
 gb|EZA76526.1| membrane protein [Escherichia coli O25:NM str. E2539C1]
 gb|KDX44882.1| TPR repeat family protein [Escherichia coli 2-156-04_S4_C3]
 gb|KDZ18160.1| TPR repeat family protein [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ28680.1| TPR repeat family protein [Escherichia coli 3-020-07_S1_C3]
 gb|KEM94015.1| TPR repeat family protein [Escherichia coli 2-222-05_S4_C1]
 gb|KHH71519.1| membrane protein [Escherichia coli]
 gb|KHH87597.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_021823642.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|EQQ29595.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 91 (4-4638751)]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001667416.1| TPR repeat family protein [Escherichia coli]
 gb|ENG66438.1| TPR repeat family protein [Escherichia coli p0305293.3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_004014562.1| TPR repeat family protein [Escherichia coli]
 gb|EMX11721.1| TPR repeat family protein [Escherichia coli 174750]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001729568.1| TPR repeat family protein [Escherichia coli]
 gb|EMW64528.1| TPR repeat family protein [Escherichia coli 2756500]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001716270.1| TPR repeat family protein [Escherichia coli]
 gb|EMW28578.1| TPR repeat family protein [Escherichia coli 2848050]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001634113.1| TPR repeat family protein [Escherichia coli]
 gb|EMV78316.1| TPR repeat family protein [Escherichia coli 2866550]
 gb|ENF76633.1| TPR repeat family protein [Escherichia coli P0304816.9]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001687278.1| TPR repeat family protein [Escherichia coli]
 gb|EMU88166.1| TPR repeat family protein [Escherichia coli MP021017.5]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001684682.1| TPR repeat family protein [Escherichia coli]
 gb|EMU84696.1| TPR repeat family protein [Escherichia coli MP021017.9]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001355527.1| bacteriophage N4 adsorption protein A [Escherichia coli]
 gb|EMV47606.1| TPR repeat family protein [Escherichia coli BCE019_MS-13]
 gb|ENA35687.1| TPR repeat family protein [Escherichia coli BCE007_MS-11]
 gb|ENA83838.1| TPR repeat family protein [Escherichia coli 2730450]
 gb|ENA85617.1| TPR repeat family protein [Escherichia coli 2741950]
 gb|ENB40684.1| TPR repeat family protein [Escherichia coli BCE032_MS-12]
 gb|ESS93554.1| Bacteriophage N4 adsorption protein A [Escherichia coli CE549]
 gb|ETS26437.1| hypothetical protein N444_14315 [Escherichia coli O6:H16:CFA/II 
str. B2C]
 gb|EYV85021.1| membrane protein [Escherichia coli O6:H16 str. 99-3165]
 gb|EZA67818.1| membrane protein [Escherichia coli O6:H16 str. F5656C1]
 gb|KGP09632.1| membrane protein [Escherichia coli]
 gb|KGP10219.1| membrane protein [Escherichia coli]
 gb|KGP17245.1| membrane protein [Escherichia coli]
 gb|KGT14115.1| membrane protein [Escherichia coli]
 gb|KGT14243.1| membrane protein [Escherichia coli]
 gb|KGT17803.1| membrane protein [Escherichia coli]
 gb|KGT21905.1| membrane protein [Escherichia coli]
 gb|KGT30735.1| membrane protein [Escherichia coli]
 gb|KIZ56965.1| membrane protein [Escherichia coli]
 gb|KIZ60902.1| membrane protein [Escherichia coli]
 gb|KIZ75467.1| membrane protein [Escherichia coli]
 gb|KIZ78475.1| membrane protein [Escherichia coli]
 gb|KIZ88081.1| membrane protein [Escherichia coli]
 gb|KIZ92693.1| membrane protein [Escherichia coli]
 gb|KIZ99999.1| membrane protein [Escherichia coli]
 gb|KJA03081.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001295316.1| bacteriophage N4 adsorption protein A [Escherichia coli]
 gb|EMX21833.1| TPR repeat family protein [Escherichia coli P0301867.1]
 gb|EMX90626.1| TPR repeat family protein [Escherichia coli 2719100]
 gb|ENA47722.1| TPR repeat family protein [Escherichia coli P0301867.2]
 gb|ENA66665.1| TPR repeat family protein [Escherichia coli 178900]
 gb|END10443.1| TPR repeat family protein [Escherichia coli P0301867.8]
 gb|ENH00152.1| TPR repeat family protein [Escherichia coli P0301867.3]
 gb|ENH11046.1| TPR repeat family protein [Escherichia coli P0301867.7]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662376.1| bacteriophage N4 adsorption protein A [Escherichia coli]
 gb|EZA20275.1| membrane protein [Escherichia coli O113:H21 str. 07-4224]
 gb|EZE09516.1| membrane protein [Escherichia coli O121:H7 str. 2009C-3299]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001382920.1| hypothetical protein [Escherichia coli]
 gb|EGX09727.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_MHI813]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_040234601.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_033815240.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032249421.1| membrane protein [Escherichia coli]
 gb|KDW48875.1| TPR repeat family protein [Escherichia coli 2-210-07_S1_C3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_020240114.1| hypothetical protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001506991.1| TPR repeat family protein [Escherichia coli]
 gb|EMX80887.1| TPR repeat family protein [Escherichia coli 2726800]
 gb|END44718.1| TPR repeat family protein [Escherichia coli 2854350]
 gb|ERC62974.1| TPR repeat family protein [Escherichia coli TW07509]
 gb|ESS95002.1| Bacteriophage N4 adsorption protein A [Escherichia coli CE516]
 gb|EZG30954.1| membrane protein [Escherichia coli E1728]
 gb|KEP83738.1| membrane protein [Escherichia coli E1140]
 gb|KHH76328.1| membrane protein [Escherichia coli]
 gb|KHH77564.1| membrane protein [Escherichia coli]
 gb|KHI03305.1| membrane protein [Escherichia coli]
 gb|KIN83644.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662363.1| hypothetical protein [Escherichia coli]
 gb|EHX96950.1| tetratricopeptide repeat family protein [Escherichia coli DEC14D]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001433906.1| hypothetical protein [Escherichia coli]
 gb|EHX00078.1| tetratricopeptide repeat family protein [Escherichia coli DEC10F]
 gb|KDT58089.1| TPR repeat family protein [Escherichia coli 3-267-03_S1_C3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662374.1| hypothetical protein [Escherichia coli]
 gb|EHW95062.1| tetratricopeptide repeat family protein [Escherichia coli DEC10E]
 gb|EHX86375.1| tetratricopeptide repeat family protein [Escherichia coli DEC14B]
 gb|EHX93822.1| tetratricopeptide repeat family protein [Escherichia coli DEC14C]
 gb|KIG26965.1| membrane protein [Escherichia coli C691-71 (14b)]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001362628.1| hypothetical protein [Escherichia coli]
 gb|EHN96089.1| bacteriophage N4 adsorption protein A [Escherichia coli E101]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662375.1| hypothetical protein [Escherichia coli]
 gb|EFK75440.1| tetratricopeptide repeat protein [Escherichia coli MS 78-1]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_021580570.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ERA51523.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli UMEA 4076-1]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001730490.1| TPR repeat family protein [Escherichia coli]
 gb|EMW71274.1| TPR repeat family protein [Escherichia coli 2749250]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662367.1| hypothetical protein [Escherichia coli]
 gb|EGW96964.1| bacteriophage N4 adsorption protein A [Escherichia coli STEC_DG131-3]
 gb|EZA38002.1| membrane protein [Escherichia coli O174:H8 str. 04-3038]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001312653.1| hypothetical protein [Escherichia coli]
 gb|EGI22894.1| bacteriophage N4 adsorption protein A [Escherichia coli M718]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_024238814.1| membrane protein [Escherichia coli]
 gb|KDT76892.1| TPR repeat family protein [Escherichia coli 3-373-03_S1_C2]
 gb|KDU42319.1| TPR repeat family protein [Escherichia coli 3-373-03_S1_C1]
 gb|KIG37545.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001743438.1| TPR repeat family protein [Escherichia coli]
 gb|EMX01395.1| TPR repeat family protein [Escherichia coli ThroopD]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001702888.1| TPR repeat family protein [Escherichia coli]
 gb|EMV42808.1| TPR repeat family protein [Escherichia coli 2875000]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032230886.1| membrane protein [Escherichia coli]
 gb|EYE28298.1| TPR repeat family protein [Escherichia coli 1-110-08_S1_C3]
 gb|EYE39812.1| TPR repeat family protein [Escherichia coli 1-110-08_S1_C1]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_023155702.1| tetratricopeptide repeat protein [Escherichia coli]
 gb|ESA63617.1| tetratricopeptide repeat protein [Escherichia coli 113303]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001709976.1| TPR repeat family protein [Escherichia coli]
 gb|EMV95029.1| TPR repeat family protein [Escherichia coli 2865200]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNA+RLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNAMRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001314549.1| hypothetical protein [Escherichia coli]
 gb|EGI32313.1| bacteriophage N4 adsorption protein A [Escherichia coli TA143]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001310623.1| hypothetical protein [Escherichia coli]
 gb|EFK92608.1| tetratricopeptide repeat protein [Escherichia coli MS 146-1]
 gb|EFU97138.1| bacteriophage N4 adsorption protein A [Escherichia coli 3431]
 gb|EGI10079.1| bacteriophage N4 adsorption protein A [Escherichia coli H736]
 gb|EII69074.1| putative bacteriophage N4 adsorption protein A [Escherichia coli 
2.4168]
 gb|EKK48719.1| tetratricopeptide [Escherichia coli 8.0566]
 gb|EKK49281.1| TPR repeat family protein [Escherichia coli 8.0569]
 gb|ELE74192.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE81]
 gb|ELF01841.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE111]
 gb|ELF41480.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE171]
 gb|EMR96090.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli ONT:H33 str. C48/93]
 gb|EOV54929.1| phage receptor, outer membrane subunit [Escherichia coli KTE61]
 gb|EOV83277.1| phage receptor, outer membrane subunit [Escherichia coli KTE71]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032164911.1| membrane protein [Escherichia coli]
 gb|EYB46573.1| membrane protein [Escherichia coli]
 gb|KEP11577.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032268709.1| membrane protein [Escherichia coli]
 gb|KDW55266.1| TPR repeat family protein [Escherichia coli 2-005-03_S3_C1]
 gb|KDZ44513.1| TPR repeat family protein [Escherichia coli 3-020-07_S4_C3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001492821.1| TPR repeat family protein [Escherichia coli]
 gb|END02875.1| TPR repeat family protein [Escherichia coli P0302308.10]
 gb|END14976.1| TPR repeat family protein [Escherichia coli P0302308.3]
 gb|KDW45603.1| TPR repeat family protein [Escherichia coli 2-177-06_S4_C2]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001732652.1| TPR repeat family protein [Escherichia coli]
 gb|EMW80445.1| TPR repeat family protein [Escherichia coli 2747800]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001721136.1| TPR repeat family protein [Escherichia coli]
 gb|EMW43957.1| TPR repeat family protein [Escherichia coli 2788150]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001479105.1| TPR repeat family protein [Escherichia coli]
 gb|EMV80496.1| TPR repeat family protein [Escherichia coli 2866750]
 gb|EMW08644.1| TPR repeat family protein [Escherichia coli 2851500]
 gb|ENC64338.1| TPR repeat family protein [Escherichia coli P0299917.5]
 gb|ENE16199.1| TPR repeat family protein [Escherichia coli P0304799.3]
 gb|EZJ63109.1| TPR repeat family protein [Escherichia coli 1-182-04_S4_C1]
 gb|KDX64776.1| TPR repeat family protein [Escherichia coli 2-222-05_S1_C1]
 gb|KDX73075.1| TPR repeat family protein [Escherichia coli 2-222-05_S1_C2]
 gb|KDZ95944.1| TPR repeat family protein [Escherichia coli 2-427-07_S1_C1]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001566144.1| TPR repeat family protein [Escherichia coli]
 gb|EMV78721.1| TPR repeat family protein [Escherichia coli 2866450]
 gb|ENE32677.1| TPR repeat family protein [Escherichia coli P0302293.4]
 gb|ENF53717.1| TPR repeat family protein [Escherichia coli P0304816.15]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001561588.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ELE57889.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE75]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001484373.1| TPR repeat family protein [Escherichia coli]
 gb|ENC93559.1| TPR repeat family protein [Escherichia coli P0301867.11]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001415816.1| TPR repeat family protein [Escherichia coli]
 gb|ENB30807.1| TPR repeat family protein [Escherichia coli BCE030_MS-09]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001692519.1| TPR repeat family protein [Escherichia coli]
 gb|EMV14328.1| TPR repeat family protein [Escherichia coli MP021017.11]
 gb|KDX60198.1| TPR repeat family protein [Escherichia coli 2-210-07_S4_C3]
Length=990

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662370.1| hypothetical protein [Shigella sonnei]
 gb|AAZ87284.1| bacteriophage N4 receptor, outer membrane protein [Shigella sonnei 
Ss046]
 gb|EFZ49800.1| bacteriophage N4 adsorption protein A [Shigella sonnei 53G]
 gb|EIQ47399.1| tetratricopeptide repeat family protein [Shigella sonnei 3226-85]
 gb|EIQ47877.1| tetratricopeptide repeat family protein [Shigella sonnei 3233-85]
 gb|EIQ54628.1| tetratricopeptide repeat family protein [Shigella sonnei 4822-66]
 gb|EJL19423.1| tetratricopeptide repeat family protein [Shigella sonnei str. 
Moseley]
 gb|KGY96076.1| membrane protein [Shigella sonnei]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001473911.1| TPR repeat family protein [Escherichia coli]
 gb|ENC42494.1| TPR repeat family protein [Escherichia coli P0299917.10]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001695487.1| TPR repeat family protein [Escherichia coli]
 gb|EMV26413.1| TPR repeat family protein [Escherichia coli BCE034_MS-14]
 gb|EMX96231.1| TPR repeat family protein [Escherichia coli 2720900]
 gb|KDV12976.1| membrane protein [Escherichia coli O78:H12 str. 00-3279]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EKI23751.1| tetratricopeptide [Escherichia coli TW15901]
Length=970

 Score =   419 bits (1078),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  11   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  70

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  71   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  130

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  131  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  190

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  191  ARQQNTLSAAERRQWFDVLLAGQLDD  216



>ref|WP_032207497.1| membrane protein [Escherichia coli]
 gb|EYY50853.1| membrane protein [Escherichia coli O165:H25 str. 2010C-4874]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|KDW26274.1| TPR repeat family protein [Escherichia coli 2-156-04_S4_C1]
Length=970

 Score =   419 bits (1078),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  11   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  70

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  71   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  130

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  131  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  190

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  191  ARQQNTLSAAERRQWFDVLLAGQLDD  216



>ref|WP_001690661.1| TPR repeat family protein [Escherichia coli]
 gb|EMV02407.1| TPR repeat family protein [Escherichia coli MP021017.2]
 gb|EMW63860.1| TPR repeat family protein [Escherichia coli 2762100]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032284922.1| membrane protein [Escherichia coli]
 gb|EYZ97219.1| membrane protein [Escherichia coli O119:H4 str. 03-3458]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_024043860.1| Bacteriophage N4 adsorption protein A [Escherichia coli]
 gb|ETJ24409.1| Bacteriophage N4 adsorption protein A [Escherichia coli DORA_A_5_14_21]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032263955.1| membrane protein [Escherichia coli]
 gb|KDZ46058.1| TPR repeat family protein [Escherichia coli 3-020-07_S4_C2]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_003592093.1| TPR repeat family protein [Escherichia coli]
 gb|ENE50514.1| TPR repeat family protein [Escherichia coli P0304777.10]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001557889.1| TPR repeat family protein [Escherichia coli]
 gb|ENE29074.1| TPR repeat family protein [Escherichia coli P0302293.10]
 gb|ENF64136.1| TPR repeat family protein [Escherichia coli P0304816.7]
 gb|EYE39947.1| TPR repeat family protein [Escherichia coli 1-110-08_S1_C2]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001520033.1| TPR repeat family protein [Escherichia coli]
 gb|END95922.1| TPR repeat family protein [Escherichia coli P0301867.13]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001481373.1| TPR repeat family protein [Escherichia coli]
 gb|ENC82816.1| TPR repeat family protein [Escherichia coli P0299917.7]
 gb|ENG60424.1| TPR repeat family protein [Escherichia coli p0305293.2]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001689372.1| TPR repeat family protein [Escherichia coli]
 gb|EMV00558.1| TPR repeat family protein [Escherichia coli MP021017.3]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_000662356.1| hypothetical protein [Escherichia coli]
 gb|EFZ56327.1| bacteriophage N4 adsorption protein A [Escherichia coli LT-68]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032161418.1| membrane protein [Escherichia coli]
 gb|KFF40084.1| membrane protein [Escherichia coli]
 gb|KFF51975.1| membrane protein [Escherichia coli]
Length=992

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032224992.1| membrane protein [Escherichia coli]
 gb|KEM43710.1| TPR repeat family protein [Escherichia coli 6-537-08_S1_C1]
 gb|KEN52418.1| TPR repeat family protein [Escherichia coli 6-537-08_S1_C2]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_029305323.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001488506.1| TPR repeat family protein [Escherichia coli]
 gb|ENH04891.1| TPR repeat family protein [Escherichia coli P0301867.5]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001487010.1| TPR repeat family protein [Escherichia coli]
 gb|ENA41791.1| TPR repeat family protein [Escherichia coli P0301867.4]
Length=990

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032317189.1| membrane protein [Escherichia coli]
 gb|EZA63876.1| membrane protein [Escherichia coli O104:H21 str. 94-3025]
 gb|AIZ86113.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_025210278.1| membrane protein [Escherichia coli]
 gb|AHM42756.1| membrane protein [Escherichia coli]
 gb|AHM47387.1| membrane protein [Escherichia coli]
 gb|AHM51931.1| membrane protein [Escherichia coli]
 gb|KDU03391.1| TPR repeat family protein [Escherichia coli 3-267-03_S1_C2]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_044188652.1| membrane protein [Escherichia coli]
 gb|KFD76799.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001359069.1| hypothetical protein [Escherichia coli]
 gb|ACI87191.1| bacteriophage N4 adsorption protein NfrA [Escherichia coli]
 gb|EFX12584.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O157:H- str. 493-89]
 gb|EFX17377.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli O157:H- str. H 2687]
 gb|EHU95523.1| tetratricopeptide repeat family protein [Escherichia coli DEC3F]
 gb|EIO53268.1| bacteriophage N4 adsorption protein NfrA [Escherichia coli TW06591]
 gb|EKI17568.1| bacteriophage N4 adsorption protein NfrA [Escherichia coli 5412]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>gb|EFF01428.1| bacteriophage N4 receptor [Escherichia coli FVEC1412]
 gb|EFI20801.1| bacteriophage N4 receptor [Escherichia coli FVEC1302]
Length=997

 Score =   420 bits (1080),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  38   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  97

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  98   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  157

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  158  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  217

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  218  ARQQNTLSAAERRQWFDVLLAGQLDD  243



>ref|WP_044726151.1| membrane protein [Escherichia coli]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_032199122.1| membrane protein [Escherichia coli]
 gb|KEJ65224.1| TPR repeat family protein [Escherichia coli 3-267-03_S4_C1]
 gb|KEN74156.1| TPR repeat family protein [Escherichia coli 1-392-07_S4_C3]
 gb|KEO03696.1| TPR repeat family protein [Escherichia coli 1-392-07_S4_C1]
 gb|KEO34411.1| TPR repeat family protein [Escherichia coli 2-460-02_S1_C1]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001457452.1| hypothetical protein [Escherichia coli]
 gb|EIO85525.1| bacteriophage N4 adsorption protein NfrA [Escherichia coli TW10119]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKS+TTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001598147.1| TPR repeat family protein [Escherichia coli]
 gb|ENE96412.1| TPR repeat family protein [Escherichia coli P0304777.4]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001599524.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ELG85379.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE144]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



>ref|WP_001589843.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli]
 gb|ELG29562.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE78]
 gb|ELG32888.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli KTE79]
 gb|EQN33723.1| bacteriophage N4 receptor, outer membrane subunit [Escherichia 
coli HVH 6 (3-8296502)]
Length=990

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = -2

Query  619  GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  440
            GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA
Sbjct  31   GTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEA  90

Query  439  YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  260
            YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL
Sbjct  91   YRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTL  150

Query  259  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  80
            RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE
Sbjct  151  RCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNE  210

Query  79   ARQQNTLSAAERRQWFDVLLAGQLDD  2
            ARQQNTLSAAERRQWFDVLLAGQLDD
Sbjct  211  ARQQNTLSAAERRQWFDVLLAGQLDD  236



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520