BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049I22

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAM91528.1|  putative casein kinase                                  250   6e-79   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001183608.1|  uncharacterized protein LOC100502202               243   3e-78   
gb|AAO41895.1|  putative casein kinase                                  248   5e-78   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14324.1|  unnamed protein product                                258   6e-78   Coffea canephora [robusta coffee]
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    258   6e-78   Sesamum indicum [beniseed]
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                   253   1e-77   Citrus sinensis [apfelsine]
gb|EPS68531.1|  hypothetical protein M569_06230                         257   2e-77   Genlisea aurea
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    256   4e-77   Nicotiana sylvestris
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    256   4e-77   Nicotiana tomentosiformis
gb|ABR25333.1|  protein kinase family protein                           239   4e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    256   5e-77   Nicotiana sylvestris
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    256   5e-77   Nicotiana tomentosiformis
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg             254   1e-76   Citrus clementina [clementine]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...    254   2e-76   Citrus sinensis [apfelsine]
ref|XP_002525432.1|  casein kinase, putative                            254   2e-76   Ricinus communis
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    254   2e-76   Sesamum indicum [beniseed]
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                254   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555    254   3e-76   Populus euphratica
ref|XP_002325416.1|  kinase family protein                              254   3e-76   
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    254   3e-76   Solanum lycopersicum
gb|KDP39706.1|  hypothetical protein JCGZ_02726                         254   3e-76   Jatropha curcas
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                   248   4e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    253   6e-76   Solanum tuberosum [potatoes]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    253   7e-76   Cucumis melo [Oriental melon]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    253   7e-76   Cucumis sativus [cucumbers]
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    253   1e-75   
ref|XP_010088042.1|  Casein kinase I isoform delta                      252   1e-75   
ref|XP_007030718.1|  Kinase family protein                              251   3e-75   Theobroma cacao [chocolate]
emb|CBI29940.3|  unnamed protein product                                249   3e-75   Vitis vinifera
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...    251   4e-75   Glycine max [soybeans]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268    251   4e-75   Eucalyptus grandis [rose gum]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             251   4e-75   Prunus persica
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210    250   6e-75   Pyrus x bretschneideri [bai li]
ref|NP_187044.1|  protein kinase family protein                         250   6e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg             250   7e-75   Capsella rubella
gb|KJB45108.1|  hypothetical protein B456_007G289500                    250   7e-75   Gossypium raimondii
ref|XP_002884421.1|  kinase family protein                              250   8e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...    250   9e-75   Cicer arietinum [garbanzo]
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    249   1e-74   Vitis vinifera
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807    249   1e-74   Fragaria vesca subsp. vesca
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...    249   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...    249   1e-74   
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499    249   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...    249   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_003624626.1|  Casein kinase I isoform alpha                      249   2e-74   Medicago truncatula
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...    249   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977    249   2e-74   Prunus mume [ume]
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg             249   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             249   3e-74   Phaseolus vulgaris [French bean]
gb|KHG27523.1|  hypothetical protein F383_15264                         248   4e-74   Gossypium arboreum [tree cotton]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg             248   4e-74   Eutrema salsugineum [saltwater cress]
gb|KJB82579.1|  hypothetical protein B456_013G203000                    248   4e-74   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                    248   5e-74   Gossypium raimondii
emb|CDY29971.1|  BnaC01g40370D                                          248   5e-74   Brassica napus [oilseed rape]
gb|KHG04306.1|  Casein kinase I-like protein                            248   5e-74   Gossypium arboreum [tree cotton]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151    248   5e-74   
gb|KHG17118.1|  Casein kinase I isoform delta                           248   6e-74   Gossypium arboreum [tree cotton]
emb|CDY42890.1|  BnaC05g47610D                                          248   6e-74   Brassica napus [oilseed rape]
ref|NP_197320.1|  protein kinase                                        247   8e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208    246   9e-74   Camelina sativa [gold-of-pleasure]
emb|CDY25451.1|  BnaC09g39660D                                          247   1e-73   Brassica napus [oilseed rape]
emb|CDY38493.1|  BnaA10g16650D                                          247   1e-73   Brassica napus [oilseed rape]
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226    247   1e-73   Brassica rapa
emb|CDY21155.1|  BnaA01g33860D                                          247   1e-73   Brassica napus [oilseed rape]
gb|ADE75678.1|  unknown                                                 235   1e-73   Picea sitchensis
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147    247   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200    246   1e-73   Brassica rapa
gb|KJB80965.1|  hypothetical protein B456_013G123300                    246   2e-73   Gossypium raimondii
gb|KJB80963.1|  hypothetical protein B456_013G123300                    246   2e-73   Gossypium raimondii
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873    246   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859    246   2e-73   Brassica rapa
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...    246   3e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100    246   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg             245   4e-73   Capsella rubella
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295    244   8e-73   Brachypodium distachyon [annual false brome]
ref|XP_002873876.1|  kinase family protein                              244   9e-73   
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016    245   9e-73   Elaeis guineensis
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881    244   1e-72   Brassica rapa
emb|CDY51243.1|  BnaA03g06950D                                          244   1e-72   Brassica napus [oilseed rape]
emb|CDX70801.1|  BnaC03g08850D                                          244   1e-72   
gb|EEC71557.1|  hypothetical protein OsI_03913                          243   2e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369    244   2e-72   Phoenix dactylifera
dbj|BAJ90552.1|  predicted protein                                      243   2e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABF99312.1|  protein kinase family protein, putative, expressed      239   2e-72   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044393.1|  Os01g0772600                                       243   3e-72   
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684    243   3e-72   Nelumbo nucifera [Indian lotus]
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...    243   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...    243   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...    243   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...    242   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869    242   7e-72   Oryza brachyantha
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174    241   9e-72   Setaria italica
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...    243   1e-71   
emb|CDY02641.1|  BnaC02g07940D                                          241   2e-71   
emb|CDY50866.1|  BnaA05g37270D                                          243   2e-71   Brassica napus [oilseed rape]
gb|ADE77861.1|  unknown                                                 227   2e-71   Picea sitchensis
gb|EAY92152.1|  hypothetical protein OsI_13865                          240   3e-71   Oryza sativa Indica Group [Indian rice]
ref|NP_001051531.1|  Os03g0793500                                       240   3e-71   
ref|NP_001058996.1|  Os07g0171300                                       240   3e-71   
dbj|BAN15568.1|  heading date 16                                        240   3e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164    239   4e-71   Brassica rapa
emb|CDY53253.1|  BnaA02g04010D                                          241   5e-71   Brassica napus [oilseed rape]
gb|KHF98002.1|  hypothetical protein F383_12939                         239   5e-71   Gossypium arboreum [tree cotton]
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500    239   1e-70   Oryza brachyantha
gb|KJB46016.1|  hypothetical protein B456_007G343500                    239   1e-70   Gossypium raimondii
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...    238   2e-70   Setaria italica
ref|NP_001152463.1|  ATP binding protein                                238   2e-70   Zea mays [maize]
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...    239   2e-70   Setaria italica
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1          238   2e-70   Zea mays [maize]
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...    238   2e-70   Tarenaya hassleriana [spider flower]
dbj|BAJ93086.1|  predicted protein                                      238   3e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940    238   3e-70   
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210    226   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235    237   4e-70   Brachypodium distachyon [annual false brome]
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...    238   4e-70   
ref|NP_001152101.1|  LOC100285738                                       237   6e-70   Zea mays [maize]
gb|ACN36158.1|  unknown                                                 237   6e-70   Zea mays [maize]
gb|AAC42254.1|  unknown protein                                         226   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146    236   1e-69   Oryza brachyantha
ref|XP_006842223.1|  hypothetical protein AMTR_s00078p00181940          236   2e-69   
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...    228   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460          234   5e-69   Sorghum bicolor [broomcorn]
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...    234   5e-69   Tarenaya hassleriana [spider flower]
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...    234   7e-69   Tarenaya hassleriana [spider flower]
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...    234   8e-69   
gb|EMS51431.1|  Casein kinase I isoform beta                            233   1e-68   Triticum urartu
emb|CDP13154.1|  unnamed protein product                                231   2e-68   Coffea canephora [robusta coffee]
ref|XP_008367866.1|  PREDICTED: casein kinase I                         229   5e-68   
gb|KHN37292.1|  Casein kinase I                                         229   7e-68   Glycine soja [wild soybean]
ref|XP_007024284.1|  Casein kinase I protein isoform 1                  232   8e-68   
emb|CDY23629.1|  BnaC05g39650D                                          228   8e-68   Brassica napus [oilseed rape]
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg                231   9e-68   Erythranthe guttata [common monkey flower]
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg             230   2e-67   Eutrema salsugineum [saltwater cress]
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg             230   2e-67   Citrus clementina [clementine]
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819    230   2e-67   Glycine max [soybeans]
ref|XP_006849555.1|  hypothetical protein AMTR_s00024p00176520          230   2e-67   Amborella trichopoda
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...    228   2e-67   
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784    231   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN27094.1|  Casein kinase I                                         229   2e-67   Glycine soja [wild soybean]
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...    228   2e-67   
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373    229   3e-67   Glycine max [soybeans]
ref|XP_001764211.1|  predicted protein                                  228   3e-67   
ref|XP_001770883.1|  predicted protein                                  228   3e-67   
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...    229   4e-67   Glycine max [soybeans]
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...    229   4e-67   Glycine max [soybeans]
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106    229   5e-67   Brassica rapa
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg             229   5e-67   Capsella rubella
emb|CDX97505.1|  BnaA05g25740D                                          228   5e-67   
ref|XP_002882838.1|  kinase family protein                              229   5e-67   Arabidopsis lyrata subsp. lyrata
gb|KHN24964.1|  Casein kinase I isoform alpha                           229   5e-67   Glycine soja [wild soybean]
gb|KHN18151.1|  Casein kinase I like 2                                  224   5e-67   Glycine soja [wild soybean]
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538    229   5e-67   Elaeis guineensis
gb|KDP33655.1|  hypothetical protein JCGZ_07226                         228   5e-67   Jatropha curcas
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                   225   5e-67   Citrus sinensis [apfelsine]
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616    229   6e-67   Camelina sativa [gold-of-pleasure]
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                    229   6e-67   Arabis alpina [alpine rockcress]
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...    229   7e-67   Camelina sativa [gold-of-pleasure]
emb|CDY55141.1|  BnaC01g44810D                                          227   8e-67   Brassica napus [oilseed rape]
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457    228   8e-67   
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488    224   8e-67   
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778    229   8e-67   
gb|KJB56821.1|  hypothetical protein B456_009G137100                    229   9e-67   Gossypium raimondii
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...    229   9e-67   
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938    219   1e-66   
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553    228   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE76410.1|  unknown                                                 223   1e-66   Picea sitchensis
emb|CDY51730.1|  BnaA01g37130D                                          228   1e-66   Brassica napus [oilseed rape]
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757              214   1e-66   
emb|CDX75726.1|  BnaC03g38090D                                          227   1e-66   
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...    228   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...    228   1e-66   Nelumbo nucifera [Indian lotus]
gb|KDP44321.1|  hypothetical protein JCGZ_19188                         228   1e-66   Jatropha curcas
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128    228   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004162011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    228   2e-66   
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194    228   2e-66   Cucumis sativus [cucumbers]
ref|NP_187977.1|  protein kinase family protein                         228   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g             227   2e-66   Phaseolus vulgaris [French bean]
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081    228   2e-66   
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586    228   2e-66   Nelumbo nucifera [Indian lotus]
emb|CBI36074.3|  unnamed protein product                                226   2e-66   Vitis vinifera
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g             228   2e-66   Phaseolus vulgaris [French bean]
ref|XP_003621013.1|  Casein kinase I isoform alpha                      226   2e-66   Medicago truncatula
gb|KHG14825.1|  hypothetical protein F383_08945                         228   2e-66   Gossypium arboreum [tree cotton]
emb|CBI16476.3|  unnamed protein product                                226   2e-66   Vitis vinifera
emb|CBI28086.3|  unnamed protein product                                226   2e-66   Vitis vinifera
ref|XP_002880706.1|  kinase family protein                              227   2e-66   
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...    227   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...    227   2e-66   
gb|KJB21848.1|  hypothetical protein B456_004G018000                    227   2e-66   Gossypium raimondii
ref|XP_006853659.1|  hypothetical protein AMTR_s00056p00104010          227   3e-66   Amborella trichopoda
ref|XP_007014775.1|  Kinase family protein isoform 2                    227   3e-66   
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                    226   3e-66   Arabis alpina [alpine rockcress]
gb|KHN39248.1|  Casein kinase I isoform delta-like                      226   3e-66   Glycine soja [wild soybean]
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                       226   3e-66   
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...    227   3e-66   Phoenix dactylifera
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...    226   3e-66   Cicer arietinum [garbanzo]
emb|CAN77676.1|  hypothetical protein VITISV_013722                     227   3e-66   Vitis vinifera
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg             226   3e-66   
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...    227   4e-66   Phoenix dactylifera
ref|NP_180147.2|  protein kinase family protein                         226   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|EEC78673.1|  hypothetical protein OsI_18806                          225   4e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221    227   4e-66   Vitis vinifera
ref|NP_973532.1|  protein kinase family protein                         226   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...    227   4e-66   Phoenix dactylifera
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...    227   4e-66   Phoenix dactylifera
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like          223   4e-66   
ref|XP_002531638.1|  casein kinase, putative                            227   4e-66   Ricinus communis
ref|XP_007024285.1|  Kinase family protein isoform 2                    222   4e-66   
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176    226   4e-66   Cucumis melo [Oriental melon]
dbj|BAG92829.1|  unnamed protein product                                225   4e-66   Oryza sativa Japonica Group [Japonica rice]
gb|AAT44311.1|  putative casein kinase                                  225   4e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673    226   4e-66   Brassica rapa
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211    226   4e-66   
gb|KJB07481.1|  hypothetical protein B456_001G026300                    222   4e-66   Gossypium raimondii
ref|XP_002516524.1|  casein kinase, putative                            226   5e-66   
emb|CAN69523.1|  hypothetical protein VITISV_040873                     226   5e-66   Vitis vinifera
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148    226   5e-66   
emb|CDX82524.1|  BnaA03g32970D                                          226   5e-66   
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                    224   5e-66   Tarenaya hassleriana [spider flower]
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531    226   5e-66   Brassica rapa
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596    226   5e-66   Tarenaya hassleriana [spider flower]
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414    226   6e-66   Vitis vinifera
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...    222   6e-66   Populus euphratica
gb|KDP34168.1|  hypothetical protein JCGZ_07739                         226   6e-66   Jatropha curcas
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792    226   6e-66   Phoenix dactylifera
gb|KHN10182.1|  Casein kinase I like 2                                  224   6e-66   Glycine soja [wild soybean]
ref|XP_004155952.1|  PREDICTED: uncharacterized protein LOC101230855    226   6e-66   
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417    226   6e-66   Populus euphratica
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869    226   7e-66   Glycine max [soybeans]
gb|KGN45587.1|  hypothetical protein Csa_7G452910                       226   7e-66   Cucumis sativus [cucumbers]
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076    226   7e-66   Pyrus x bretschneideri [bai li]
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...    226   7e-66   Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg             226   7e-66   
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213589    226   7e-66   Cucumis sativus [cucumbers]
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189    224   7e-66   Brachypodium distachyon [annual false brome]
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043    226   8e-66   Camelina sativa [gold-of-pleasure]
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                   226   8e-66   Citrus sinensis [apfelsine]
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956    226   8e-66   Vitis vinifera
ref|XP_010093160.1|  Casein kinase I                                    227   8e-66   
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...    225   9e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...    225   9e-66   Camelina sativa [gold-of-pleasure]
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...    226   9e-66   Glycine max [soybeans]
gb|KGN62809.1|  hypothetical protein Csa_2G373520                       226   9e-66   Cucumis sativus [cucumbers]
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...    226   9e-66   
ref|XP_007014774.1|  Casein kinase I protein isoform 1                  228   9e-66   
ref|XP_004148393.1|  PREDICTED: uncharacterized protein LOC101218249    226   1e-65   
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...    226   1e-65   Elaeis guineensis
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334    224   1e-65   
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783    226   1e-65   Cucumis melo [Oriental melon]
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...    225   1e-65   Glycine max [soybeans]
gb|KJB21850.1|  hypothetical protein B456_004G018100                    225   1e-65   Gossypium raimondii
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630    226   1e-65   Glycine max [soybeans]
ref|NP_001054881.2|  Os05g0200500                                       224   1e-65   
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420    225   1e-65   Phoenix dactylifera
dbj|BAD73224.1|  putative serine/threonine protein kinase               216   1e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g             225   1e-65   
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...    222   1e-65   
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765             223   1e-65   
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482             223   1e-65   
emb|CDY21505.1|  BnaC03g26920D                                          224   1e-65   Brassica napus [oilseed rape]
dbj|BAJ94407.1|  predicted protein                                      223   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845    225   2e-65   Prunus mume [ume]
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244    225   2e-65   Prunus mume [ume]
emb|CBI20566.3|  unnamed protein product                                223   2e-65   Vitis vinifera
emb|CDM82151.1|  unnamed protein product                                223   2e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...    223   2e-65   Glycine max [soybeans]
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127    225   2e-65   
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg             225   2e-65   Prunus persica
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441    225   2e-65   
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg             224   2e-65   Eutrema salsugineum [saltwater cress]
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062    224   2e-65   Elaeis guineensis
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg             224   2e-65   Prunus persica
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...    224   2e-65   Elaeis guineensis
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...    224   2e-65   
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016    224   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...    224   2e-65   
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855    224   3e-65   
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343    225   3e-65   Fragaria vesca subsp. vesca
emb|CDY11509.1|  BnaA09g40750D                                          222   3e-65   Brassica napus [oilseed rape]
gb|KJB07483.1|  hypothetical protein B456_001G026300                    223   3e-65   
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456    225   3e-65   
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...    224   3e-65   
gb|KDP40868.1|  hypothetical protein JCGZ_24867                         224   3e-65   
ref|XP_002515975.1|  casein kinase, putative                            224   3e-65   
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660    225   3e-65   
emb|CDO97984.1|  unnamed protein product                                223   3e-65   
ref|XP_002309535.1|  kinase family protein                              223   3e-65   
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...    224   3e-65   
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726    223   3e-65   
emb|CDX76739.1|  BnaC08g33250D                                          222   4e-65   
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...    224   4e-65   
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757              215   4e-65   
ref|XP_009117039.1|  PREDICTED: casein kinase I                         222   4e-65   
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...    224   4e-65   
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...    224   4e-65   
ref|XP_010102418.1|  Casein kinase I-2-like protein                     224   5e-65   
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...    223   5e-65   
gb|ADI78885.1|  casein kinase I                                         224   5e-65   
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...    224   5e-65   
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like          222   5e-65   
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...    223   6e-65   
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...    223   6e-65   
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...    224   6e-65   
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg             224   6e-65   
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375    224   6e-65   
ref|XP_003592802.1|  Casein kinase-like protein                         223   6e-65   
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770    223   6e-65   
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263    222   7e-65   
gb|KJB07478.1|  hypothetical protein B456_001G026300                    223   7e-65   
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...    222   7e-65   
gb|KHG03332.1|  hypothetical protein F383_28165                         223   7e-65   
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068    223   7e-65   
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757              215   7e-65   
dbj|BAD87518.1|  putative serine/threonine protein kinase               221   7e-65   
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg             223   8e-65   
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like      221   9e-65   
gb|KJB54778.1|  hypothetical protein B456_009G048800                    221   9e-65   
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228    221   1e-64   
gb|KHG18897.1|  Casein kinase I                                         223   1e-64   
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003    223   1e-64   
ref|XP_007013209.1|  Kinase family protein isoform 5                    218   1e-64   
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125    223   1e-64   
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g             223   1e-64   
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...    223   1e-64   
gb|AES58679.2|  casein kinase I-like protein                            223   1e-64   
gb|KJB70401.1|  hypothetical protein B456_011G072100                    223   1e-64   
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...    223   1e-64   
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...    222   1e-64   
gb|KJB54779.1|  hypothetical protein B456_009G048800                    221   1e-64   
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...    222   1e-64   
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g             218   1e-64   
gb|KHG22911.1|  Casein kinase I                                         221   2e-64   
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132    223   2e-64   
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720    222   2e-64   
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149    221   2e-64   
gb|EEE55368.1|  hypothetical protein OsJ_03423                          221   2e-64   
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g             223   2e-64   
ref|XP_002304015.1|  kinase family protein                              222   2e-64   
emb|CDP08183.1|  unnamed protein product                                222   2e-64   
gb|EEC71464.1|  hypothetical protein OsI_03705                          221   2e-64   
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236    222   2e-64   
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                    220   3e-64   
gb|EMS55588.1|  Casein kinase I-like protein 2                          220   3e-64   
ref|NP_001044224.1|  Os01g0744300                                       221   3e-64   
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043    222   3e-64   
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270          220   3e-64   
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912    222   3e-64   
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359    222   3e-64   
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791              217   3e-64   
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like      221   3e-64   
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg                221   4e-64   
dbj|BAJ99119.1|  predicted protein                                      217   4e-64   
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718    219   4e-64   
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...    219   4e-64   
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...    221   4e-64   
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711    221   4e-64   
gb|KHG27580.1|  Casein kinase I                                         221   4e-64   
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864             219   4e-64   
ref|NP_001169571.1|  hypothetical protein                               219   4e-64   
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...    221   5e-64   
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332    221   5e-64   
ref|XP_007012164.1|  Casein kinase I protein                            221   5e-64   
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197    221   5e-64   
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002             219   6e-64   
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552             211   6e-64   
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378    221   7e-64   
gb|EMT25395.1|  Casein kinase I-2-like protein                          219   8e-64   
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g             220   8e-64   
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g             221   8e-64   
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751    221   8e-64   
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790          219   9e-64   
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947    220   1e-63   
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    221   1e-63   
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429    220   1e-63   
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...    216   1e-63   
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336    220   1e-63   
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...    216   1e-63   
dbj|BAK02283.1|  predicted protein                                      218   2e-63   
gb|EMT06030.1|  Casein kinase I-2-like protein                          218   2e-63   
ref|NP_001141429.1|  uncharacterized protein LOC100273539               215   2e-63   
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2              217   2e-63   
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824    219   2e-63   
gb|ACO87665.1|  protein kinase                                          218   2e-63   
emb|CDM84047.1|  unnamed protein product                                218   2e-63   
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860    219   2e-63   
ref|XP_008226475.1|  PREDICTED: protein kinase 3                        219   2e-63   
ref|XP_007013205.1|  Kinase family protein isoform 1                    218   3e-63   
gb|EMS66552.1|  Casein kinase I-like protein 2                          217   3e-63   
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090    218   3e-63   
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445    218   3e-63   
gb|EPS63371.1|  hypothetical protein M569_11412                         208   4e-63   
ref|XP_010098134.1|  Casein kinase I-2-like protein                     219   4e-63   
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like          218   4e-63   
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...    217   4e-63   
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922    218   5e-63   
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1    218   5e-63   
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237    218   5e-63   
gb|KJB82881.1|  hypothetical protein B456_013G219500                    216   6e-63   
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                   217   7e-63   
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg             217   8e-63   
gb|AAP80674.1|  casein kinase-like protein                              202   8e-63   
gb|EEC70115.1|  hypothetical protein OsI_00774                          216   9e-63   
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999    217   9e-63   
ref|NP_001042306.1|  Os01g0198200                                       216   9e-63   
dbj|BAD73223.1|  putative serine/threonine protein kinase               216   9e-63   
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435    218   1e-62   
gb|EEE54054.1|  hypothetical protein OsJ_00747                          217   1e-62   
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902    217   1e-62   
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026    217   1e-62   
gb|KEH36077.1|  casein kinase I-like protein                            217   1e-62   
gb|EMT27276.1|  Casein kinase I-2-like protein                          217   2e-62   
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg             216   2e-62   
dbj|BAJ99167.1|  predicted protein                                      216   2e-62   
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...    215   2e-62   
gb|EMS54400.1|  Casein kinase I-like protein 2                          218   2e-62   
ref|XP_002502422.1|  predicted protein                                  214   3e-62   
ref|NP_187043.1|  protein kinase-related protein                        206   3e-62   
ref|XP_003057011.1|  Serine/Threonine protein kinase                    216   3e-62   
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3         216   4e-62   
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                    214   4e-62   
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like    216   4e-62   
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...    216   4e-62   
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...    216   4e-62   
emb|CEG01140.1|  Serine/threonine-protein kinase, active site           214   4e-62   
ref|XP_002882289.1|  hypothetical protein ARALYDRAFT_340491             205   5e-62   
ref|XP_003588428.1|  Casein kinase I isoform alpha                      216   6e-62   
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546              214   6e-62   
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg                215   7e-62   
ref|XP_003075213.1|  protein kinase family protein (ISS)                214   7e-62   
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324              213   1e-61   
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase       213   1e-61   
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...    214   1e-61   
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...    214   1e-61   
gb|KJB27133.1|  hypothetical protein B456_004G279600                    213   2e-61   
ref|XP_001416335.1|  predicted protein                                  211   6e-61   
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...    211   1e-60   
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...    211   1e-60   
gb|KJB82582.1|  hypothetical protein B456_013G203000                    210   4e-60   
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase       209   5e-60   
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3         208   2e-59   
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695             203   2e-59   
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1         209   2e-59   
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2         208   2e-59   
ref|XP_002514324.1|  casein kinase, putative                            207   6e-59   
gb|AIS72786.1|  casein kinase-like protein                              191   1e-58   
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like    205   2e-58   
gb|EMS55265.1|  Casein kinase I isoform alpha                           203   1e-57   
gb|EMT06466.1|  Casein kinase I isoform alpha                           203   1e-57   
ref|XP_007514232.1|  predicted protein                                  202   2e-57   
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg             192   4e-57   
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3         202   4e-57   
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like    202   5e-57   
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like    199   1e-56   
gb|KHG22741.1|  Casein kinase I isoform delta                           199   2e-56   
gb|KJB54170.1|  hypothetical protein B456_009G024100                    199   4e-56   
ref|XP_002458472.1|  hypothetical protein SORBIDRAFT_03g034330          184   8e-56   
gb|KJB54173.1|  hypothetical protein B456_009G024100                    197   3e-55   
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein         193   1e-54   
tpg|DAA35739.1|  TPA: putative homeodomain-like transcription fac...    195   2e-54   
ref|XP_010088832.1|  Casein kinase I isoform alpha                      194   4e-54   
gb|KDD76924.1|  hypothetical protein H632_c65p1                         192   8e-54   
ref|XP_007014776.1|  Kinase family protein isoform 3                    193   9e-54   
gb|AET01488.2|  casein kinase I-like protein                            193   9e-54   
gb|KDD72198.1|  hypothetical protein H632_c3713p0                       184   9e-54   
ref|XP_003627012.1|  Casein kinase-like protein                         192   3e-53   
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600          189   1e-52   
ref|XP_010915572.1|  PREDICTED: uncharacterized protein LOC105040...    189   3e-52   
gb|EMT07061.1|  Casein kinase I-2-like protein                          190   3e-52   
ref|XP_010915562.1|  PREDICTED: uncharacterized protein LOC105040...    189   3e-52   
ref|XP_010915546.1|  PREDICTED: uncharacterized protein LOC105040...    189   4e-52   
ref|XP_010915554.1|  PREDICTED: uncharacterized protein LOC105040...    189   4e-52   
gb|EPS62497.1|  hypothetical protein M569_12290                         187   6e-52   
ref|XP_011400089.1|  Casein kinase I-like protein 2                     185   2e-51   
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                    181   2e-51   
gb|KJB07477.1|  hypothetical protein B456_001G026300                    186   3e-51   
ref|XP_004963352.1|  PREDICTED: probable casein kinase I homolog ...    185   4e-51   
gb|KJB46017.1|  hypothetical protein B456_007G343500                    184   2e-50   
emb|CAN74986.1|  hypothetical protein VITISV_008771                     187   2e-50   
gb|KIY93350.1|  hypothetical protein MNEG_14612                         169   4e-50   
gb|EMT12651.1|  Casein kinase I-2-like protein                          181   2e-49   
gb|AFW85111.1|  hypothetical protein ZEAMMB73_338907                    174   3e-49   
ref|XP_001695320.1|  serine/threonine protein kinase, transcripti...    179   7e-49   
ref|XP_002958584.1|  histone kinase                                     178   1e-48   
ref|XP_010229461.1|  PREDICTED: casein kinase I isoform alpha-like      175   1e-47   
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392    174   4e-47   
tpg|DAA56574.1|  TPA: hypothetical protein ZEAMMB73_926529              167   1e-45   
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    169   1e-45   
gb|AEW08952.1|  hypothetical protein CL2426Contig1_01                   155   6e-45   
ref|XP_008452134.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    159   8e-45   
gb|KJB54177.1|  hypothetical protein B456_009G024100                    166   2e-44   
gb|AEO89321.1|  serine/threonine protein kinase                         164   3e-43   
gb|EMT25758.1|  Casein kinase I isoform delta-like protein              155   9e-40   
ref|XP_005648473.1|  kinase-like protein                                150   4e-38   
gb|EMS61861.1|  Casein kinase I isoform delta-like protein              149   9e-38   
ref|XP_010103948.1|  hypothetical protein L484_020200                   142   1e-37   
gb|EMT21083.1|  Casein kinase I-2-like protein                          146   2e-37   
ref|XP_010090279.1|  hypothetical protein L484_001310                   141   9e-36   
ref|XP_010090282.1|  hypothetical protein L484_001313                   133   3e-34   
gb|KCW81595.1|  hypothetical protein EUGRSUZ_C02959                     135   8e-34   
ref|XP_010051239.1|  PREDICTED: casein kinase I homolog hhp1-like       135   1e-33   



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  182  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  241

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  242  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  301

Query  249  VC  244
            VC
Sbjct  302  VC  303



>ref|NP_001183608.1| uncharacterized protein LOC100502202 [Zea mays]
 gb|ACR37739.1| unknown [Zea mays]
Length=162

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  41   SFPYKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  100

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  101  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  160

Query  249  V  247
            V
Sbjct  161  V  161



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESG
Sbjct  186  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESG  245

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRT
Sbjct  246  YRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRT  305

Query  249  VC  244
            VC
Sbjct  306  VC  307



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  588  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  647

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  648  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  707

Query  249  VC  244
            VC
Sbjct  708  VC  709


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  500  VDKGNEDGLYISCVASATNLWALIMDAGTGFSSQVYELSAVFLHKDWIMEQWEKNYYISS  559

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  560  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  607



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  584  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  643

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  644  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  703

Query  249  VC  244
            VC
Sbjct  704  VC  705



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  416  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  475

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  476  YRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  535

Query  249  VC  244
            VC
Sbjct  536  VC  537



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/122 (98%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAF+LSIPRRKMMDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRT
Sbjct  643  YRITSMAATADQAAFVLSIPRRKMMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/122 (98%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G +++ + +A + W ++M    G+S QV +L  ++  +  I  +WE  Y I+S
Sbjct  499  VDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLHKDWIMEQWEKNYYISS  558

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/122 (98%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  593  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  652

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  653  YRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  712

Query  249  VC  244
            VC
Sbjct  713  VC  714


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  505  VDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIMEQWEKNYYISS  564

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  565  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  612



>gb|ABR25333.1| protein kinase family protein [Oryza sativa Indica Group]
Length=137

 Score =   239 bits (610),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+G
Sbjct  16   SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETG  75

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRT
Sbjct  76   YRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRT  135

Query  249  VC  244
            VC
Sbjct  136  VC  137



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/122 (98%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  593  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  652

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  653  YRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  712

Query  249  VC  244
            VC
Sbjct  713  VC  714


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  505  VDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIMEQWEKNYYISS  564

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  565  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  612



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/122 (98%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITSMAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G +++ + +A + W ++M    G+S QV +L  ++  +  I  +WE  Y I+S
Sbjct  499  VDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLHKDWIMEQWEKNYYISS  558

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  643  YRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG
Sbjct  584  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESG  643

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  644  YRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  703

Query  249  VC  244
            VC
Sbjct  704  VC  705



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  584  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  643

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  644  YRITSMAATGDQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  703

Query  249  VC  244
            VC
Sbjct  704  VC  705



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+MAATADQ AFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  645  YRITAMAATADQGAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  497  VEKGNEDGLYISCVASASNLWALIMDAGTGFSSQVYELSAVFLHKDWIMEQWEKNYYISS  556

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  557  IAGAANGSSLVI---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  604



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG
Sbjct  586  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  646  FRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG
Sbjct  599  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESG  658

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  659  FRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  718

Query  249  VC  244
            VC
Sbjct  719  VC  720



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G
Sbjct  588  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGG  647

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  648  FRITSMAATADQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  707

Query  249  VC  244
            VC
Sbjct  708  VC  709


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+
Sbjct  500  VDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWIMEQWEKNYYIS  558

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  SIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  607



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  584  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  643

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  644  YRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  703

Query  249  VC  244
            VC
Sbjct  704  VC  705



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  373  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  432

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  433  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  492

Query  249  VC  244
            VC
Sbjct  493  VC  494



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   253 bits (646),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G
Sbjct  588  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGG  647

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  648  FRITSMAATADQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  707

Query  249  VC  244
            VC
Sbjct  708  VC  709


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+
Sbjct  500  VDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWIMEQWEKNYYIS  558

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  SIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  607



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITCMAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            I K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  + I+S
Sbjct  499  IEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLHKDWIMEQWEKNFYISS  558

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITCMAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 61/112 (54%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  + I+
Sbjct  499  IEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWIMEQWEKNFYIS  557

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  558  SIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  621  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  680

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  681  YRITCMAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  740

Query  249  VC  244
            VC
Sbjct  741  VC  742


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            I K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  + I+S
Sbjct  533  IEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLHKDWIMEQWEKNFYISS  592

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  593  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  640



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGY+EQVVELDFLYPSEGIH+RWE+G
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHKRWENG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRT
Sbjct  645  YRITSMAATADQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESG
Sbjct  584  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESG  643

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  644  YRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSAHVKEKWAKNLYIASICYGRT  703

Query  249  VC  244
            VC
Sbjct  704  VC  705



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GY++QVVELDFLYPSEGIHRRWE G
Sbjct  472  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECG  531

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRT
Sbjct  532  YRITSMAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRT  591

Query  249  VC  244
            VC
Sbjct  592  VC  593


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G H++ + ++ + W ++M    GYS QV EL  ++  +  I  +WE  Y I+S
Sbjct  384  VEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHKDWIMEQWEKNYYISS  443

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  444  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  491



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+G
Sbjct  588  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENG  647

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  648  YRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  707

Query  249  VC  244
            VC
Sbjct  708  VC  709


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  Y I+
Sbjct  500  VDKGIEDGLYISCVASAANLWALIMDAGTGFSSQVYELSPAFLH-KDWIMEQWEKNYYIS  558

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  SIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  607



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            +FPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESG
Sbjct  581  AFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESG  640

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  641  YRITSMAATADQAAFILSIPKRKVMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  700

Query  249  VC  244
            VC
Sbjct  701  VC  702


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G  ++ + ++ + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  493  VEKGNEDGLFISCVASSSNLWALIMDAGTGFSSQVYELSAVFLHKDWIMEQWERNYYISS  552

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  ++ ++ ++     K    TQ++ + S AFP   + +KW +  ++ S+
Sbjct  553  IAGASNGSSLVV---MSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVTSM  600



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG
Sbjct  586  SFPFKWINKKWKEGFHVTSMTTAGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRT
Sbjct  646  YRITSMAATTDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G  ++S+ +A + W ++M    G+S QV EL  ++  +  I  +WE  + I+S
Sbjct  498  VDKGNEDGLFISSVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNFYISS  557

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  558  IAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  605



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRNAG+S+QVVELDF+YPSEGIHRRWESG
Sbjct  586  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNAGFSDQVVELDFVYPSEGIHRRWESG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRT
Sbjct  646  YRITSMAATADQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  580  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  640  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  699

Query  249  VC  244
            VC
Sbjct  700  VC  701



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score =   250 bits (638),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  580  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  640  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  699

Query  249  VC  244
            VC
Sbjct  700  VC  701



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  645  YRITSMAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  581  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  640

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  641  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  700

Query  249  VC  244
            VC
Sbjct  701  VC  702


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 59/111 (53%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  493  VEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLHKDWIMEQWEKNYYISS  552

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  553  IAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSM  600



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score =   250 bits (638),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ 
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENN  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I  +WE  Y I+
Sbjct  499  VDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWIMEQWEKNYYIS  557

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  558  SIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GY++QVVELDFLYPSEGIHRRWE G
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRT
Sbjct  647  YRITSMAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G H++ + ++ + W ++M    GYS QV EL  ++  +  I  +WE  Y I+S
Sbjct  499  VEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHKDWIMEQWEKNYYISS  558

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  IAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  571  SFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  630

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT+DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRT
Sbjct  631  YRITSMAATSDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICFGRT  690

Query  249  VC  244
            VC
Sbjct  691  VC  692


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G +++S+ +A + W ++M    G+S QV EL  ++  +  I  +W+  + I+S
Sbjct  483  VDKGNEDGLYISSVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIMEQWDKNFYISS  542

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  543  IAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  590



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE G
Sbjct  582  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  642  YRITSMAATADQAAFILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  701

Query  249  VC  244
            VC
Sbjct  702  VC  703



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE G
Sbjct  583  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  643  YRITSMAATADQAAFILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  580  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  640  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  699

Query  249  VC  244
            VC
Sbjct  700  VC  701



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  580  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  640  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  699

Query  249  VC  244
            VC
Sbjct  700  VC  701



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ 
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENN  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITSMAATNDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I  +WE  Y I+
Sbjct  499  VDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWIMEQWEKNYYIS  557

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  558  SIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  579  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  638

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  639  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  698

Query  249  VC  244
            VC
Sbjct  699  VC  700



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG
Sbjct  586  SFPFKWINKKWKEGFHVTSMTTAGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRT
Sbjct  646  YRITSMAATTDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICHGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G  ++S+ +A + W ++M    G+S QV EL  ++  +  I  +WE  + I+S
Sbjct  498  VDKGNEDGLFISSVASASNLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNFYISS  557

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  558  IAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  605



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  580  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRT
Sbjct  640  YRITSMAATADQAALILSIPKRKISDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRT  699

Query  249  VC  244
            VC
Sbjct  700  VC  701



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QVVE+DFLYPSEGIHRRWE+G
Sbjct  587  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQVVEIDFLYPSEGIHRRWENG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  647  YRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G +++ + ++ + W ++M    G+S QV EL   +  +  I  +WE  Y I+S
Sbjct  499  VDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSLAFLHKDWIMEQWEKNYYISS  558

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  559  IAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  606



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESG
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  645  YRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+SEQVVELDFLYPS+GIHRRWESG
Sbjct  574  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSEQVVELDFLYPSDGIHRRWESG  633

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  634  YRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  693

Query  249  VC  244
            VC
Sbjct  694  VC  695



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESG
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRT
Sbjct  645  YRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESG
Sbjct  586  SFPFKWINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRT
Sbjct  646  YRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  582  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  642  FRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRT  701

Query  249  VC  244
            VC
Sbjct  702  VC  703



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESG
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAF+LSIP+RKMMDETQETLRTSAFPSTHVKEKW+KNLY+AS+CYGRT
Sbjct  645  YRITSMAATADQAAFVLSIPKRKMMDETQETLRTSAFPSTHVKEKWAKNLYLASVCYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  593  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  652

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  653  YRITSTAATHDQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  712

Query  249  V  247
            V
Sbjct  713  V  713



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTA SRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTAASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  645  YRITSMAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  579  SFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  638

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH+KEKW+KNLYIASICYGRT
Sbjct  639  FRITSMAATADQAALILSIPKRKLTDETQETLRTSAFPSTHIKEKWAKNLYIASICYGRT  698

Query  249  VC  244
            VC
Sbjct  699  VC  700


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  491  VEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNYYISS  550

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  551  IAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSM  598



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESG
Sbjct  570  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESG  629

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRT
Sbjct  630  YRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRT  689

Query  249  VC  244
            VC
Sbjct  690  VC  691



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  526  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESG  585

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRT
Sbjct  586  YRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRT  645

Query  249  VC  244
            VC
Sbjct  646  VC  647



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  569  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESG  628

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  629  YRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRT  688

Query  249  VC  244
            VC
Sbjct  689  VC  690



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  569  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESG  628

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  629  YRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRT  688

Query  249  VC  244
            VC
Sbjct  689  VC  690



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  643  FRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 61/113 (54%), Gaps = 5/113 (4%)
 Frame = -2

Query  597  KWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRI  421
            K + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  + I
Sbjct  493  KHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNFYI  552

Query  420  TSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +S+A   + ++F++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  553  SSIAGANNGSSFVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSM  602



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  643  FRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704



>gb|ADE75678.1| unknown [Picea sitchensis]
Length=260

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWI+KKWKEGF+VTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+G
Sbjct  139  SFPFKWISKKWKEGFYVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENG  198

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAFILS+P+RK+ DETQETLRTSAFPSTHVKEKWSKNLYIA++CYGRT
Sbjct  199  YRITATAATCDQAAFILSVPKRKLTDETQETLRTSAFPSTHVKEKWSKNLYIAAVCYGRT  258

Query  249  V  247
            V
Sbjct  259  V  259



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESG
Sbjct  571  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESG  630

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRT
Sbjct  631  YRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRT  690

Query  249  VC  244
            VC
Sbjct  691  VC  692



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  574  SFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  633

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRT
Sbjct  634  FRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRT  693

Query  249  VC  244
            VC
Sbjct  694  VC  695


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  486  VEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNYYISS  545

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  546  IAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSM  593



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+G
Sbjct  586  SFPFKWINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  646  YRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+G
Sbjct  585  SFPFKWINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  645  YRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  571  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESG  630

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRT
Sbjct  631  YRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRT  690

Query  249  VC  244
            VC
Sbjct  691  VC  692



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FH+TSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  570  SFPFKWINKKWKEDFHLTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESG  629

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  630  YRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRT  689

Query  249  VC  244
            VC
Sbjct  690  VC  691



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTA SRWGVVMSRNAG+++QVVELDFLYPSEGIHRRWESG
Sbjct  592  SFPFKWINKKWKEGFHVTSMTTAASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESG  651

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAF+LSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  652  YRITSMAATPDQAAFVLSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  711

Query  249  VC  244
            VC
Sbjct  712  VC  713


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/112 (27%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I+K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  + I+
Sbjct  504  IDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVFLH-KDWIMEQWEKNFYIS  562

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A   + A+ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  563  SIAGATNGASLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSM  611



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG RWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWESG
Sbjct  593  SFPFKWINKKWKEGFHVTSMTTAGGRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWESG  652

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  653  YRITSTAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  712

Query  249  VC  244
            VC
Sbjct  713  VC  714


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            I K  ++G +++ + ++ + W ++M    G+  QV EL  ++  +  I  +WE  Y I++
Sbjct  505  IEKGMEDGLYISCVASSANLWALIMDAGTGFCSQVYELSPIFLHKDWIMEQWEKNYYISA  564

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A T + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  565  IAGTTNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  612



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  571  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESG  630

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRT
Sbjct  631  YRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRT  690

Query  249  VC  244
            VC
Sbjct  691  VC  692



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  577  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  636

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  637  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  696

Query  249  V  247
            V
Sbjct  697  V  697



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score =   244 bits (623),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  570  SFPYKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESG  629

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRT
Sbjct  630  YRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRT  689

Query  249  VC  244
            VC
Sbjct  690  VC  691



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVT MTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+G
Sbjct  597  SFPFKWINKKWKEGFHVTCMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENG  656

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  657  YRITSTAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  716

Query  249  VC  244
            VC
Sbjct  717  VC  718



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+G
Sbjct  555  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENG  614

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  615  YRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  674

Query  249  VC  244
            VC
Sbjct  675  VC  676



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+G
Sbjct  563  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENG  622

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  623  YRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  682

Query  249  VC  244
            VC
Sbjct  683  VC  684



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+G
Sbjct  563  SFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENG  622

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  623  YRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  682

Query  249  VC  244
            VC
Sbjct  683  VC  684



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+G
Sbjct  526  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENG  585

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  586  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  645

Query  249  V  247
            V
Sbjct  646  V  646



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVT MTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+G
Sbjct  597  SFPFKWINKKWKEGFHVTCMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENG  656

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRT
Sbjct  657  YRITSTAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRT  716

Query  249  VC  244
            VC
Sbjct  717  VC  718



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  573  SFPFKWINKKWKEGFHVTSMTTAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  632

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  633  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  692

Query  249  V  247
            V
Sbjct  693  V  693



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+G
Sbjct  401  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETG  460

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRT
Sbjct  461  YRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRT  520

Query  249  VC  244
            VC
Sbjct  521  VC  522


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 61/112 (54%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I K  ++G +++ ++++ + W ++M    G+  QV EL   FL+  + I  +WE  Y IT
Sbjct  313  IEKGNEDGLYISCVSSSANFWALIMDAGTGFCSQVYELSQVFLH-KDWIMEQWEKNYYIT  371

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            ++A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  372  AIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSM  420



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+G
Sbjct  577  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENG  636

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  637  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  696

Query  249  V  247
            V
Sbjct  697  V  697



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS+QVVELDFLYPSEGIH+RWESG
Sbjct  587  SFPFKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSDQVVELDFLYPSEGIHKRWESG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT
Sbjct  647  YRITSTAATVDQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  706

Query  249  V  247
            V
Sbjct  707  V  707



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESG
Sbjct  595  SFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESG  654

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRT
Sbjct  655  YRITSTAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRT  714

Query  249  VC  244
            VC
Sbjct  715  VC  716



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESG
Sbjct  630  SFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESG  689

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRT
Sbjct  690  YRITSTAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRT  749

Query  249  VC  244
            VC
Sbjct  750  VC  751



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 119/122 (98%), Gaps = 1/122 (1%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  580  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRT
Sbjct  640  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRT  698

Query  249  VC  244
            VC
Sbjct  699  VC  700



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 119/122 (98%), Gaps = 1/122 (1%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  579  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  638

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRT
Sbjct  639  YRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRT  697

Query  249  VC  244
            VC
Sbjct  698  VC  699



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+G
Sbjct  580  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRT
Sbjct  640  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRT  699

Query  249  V  247
            V
Sbjct  700  V  700



>ref|XP_004970128.1| PREDICTED: uncharacterized protein LOC101772174 [Setaria italica]
Length=697

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  576  SFPYKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  635

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC+GRT
Sbjct  636  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICFGRT  695

Query  249  V  247
            V
Sbjct  696  V  696



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  691  SFPYKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENG  750

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  751  YRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  810

Query  249  V  247
            V
Sbjct  811  V  811



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  565  SFPYKWINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESG  624

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  625  YRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  684

Query  249  VC  244
            VC
Sbjct  685  VC  686



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG
Sbjct  578  SFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESG  637

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRT
Sbjct  638  FRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRT  697

Query  249  V  247
            V
Sbjct  698  V  698


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y I+S
Sbjct  490  VEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNYYISS  549

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  550  IAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSM  597



>gb|ADE77861.1| unknown [Picea sitchensis]
Length=186

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM +AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ G
Sbjct  65   SFPFKWINKKWREGFYVTSMASAGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDHG  124

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  125  YRITATAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  184

Query  249  V  247
            V
Sbjct  185  V  185



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+G
Sbjct  586  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRT
Sbjct  646  YRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+G
Sbjct  586  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRT
Sbjct  646  YRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  578  SFPFKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETG  637

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAFILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRT
Sbjct  638  YRITSIAATNDQAAFILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRT  697

Query  249  VC  244
            VC
Sbjct  698  VC  699



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+G
Sbjct  586  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRT
Sbjct  646  YRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWE+G
Sbjct  563  SFPYKWINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWENG  622

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  623  YRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  682

Query  249  VC  244
            VC
Sbjct  683  VC  684



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESG
Sbjct  641  SFPYKWINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESG  700

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRT
Sbjct  701  YRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRT  760

Query  249  VC  244
            VC
Sbjct  761  VC  762



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  547  SFPFKWINKKWKEGFYVTSMTTAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  606

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRT
Sbjct  607  YRITSMAATVDQAAFILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRT  666

Query  249  V  247
            V
Sbjct  667  V  667



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+G
Sbjct  581  SFPFKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETG  640

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRT
Sbjct  641  YRITSTAATNDQAAFILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRT  700

Query  249  VC  244
            VC
Sbjct  701  VC  702



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESG
Sbjct  590  SFPFKWINKKWKEGFYVTSMTTAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESG  649

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAFILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRT
Sbjct  650  YRITSMAATVDQAAFILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRT  709

Query  249  V  247
            V
Sbjct  710  V  710


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IHRRWESGYRITS  415
            ++K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I  +WE  Y ITS
Sbjct  502  VSKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNYYITS  561

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     K    TQ++ + S +FP   + +KW +  Y+ S+
Sbjct  562  VAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSM  609



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QVVELDFLYPSEGIHRRWE+G
Sbjct  586  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  646  YRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRT
Sbjct  643  YRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QVVELDFLYPSEGIHRRWE+G
Sbjct  611  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETG  670

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  671  YRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRT  730

Query  249  VC  244
            VC
Sbjct  731  VC  732



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRT
Sbjct  643  YRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704



>ref|XP_010552201.1| PREDICTED: serine/threonine-protein kinase ste20-like [Tarenaya 
hassleriana]
Length=702

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRW SG
Sbjct  581  SFPFKWINKKWKEGFHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWNSG  640

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AATADQ A +LSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+ASICYGRT
Sbjct  641  YRITSTAATADQTALVLSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASICYGRT  700

Query  249  V  247
            V
Sbjct  701  V  701



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HRRWESG
Sbjct  586  SFPYKWINKKWKEGFHVTSMGTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWESG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS A T DQAAFILSIP+RK +DETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  646  YRITSSAGTPDQAAFILSIPKRKPLDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  705

Query  249  VC  244
             C
Sbjct  706  AC  707



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HRRWE+G
Sbjct  588  SFPYKWINKKWKEGFHVTSMGTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWETG  647

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS A T DQAAFILSIP+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT
Sbjct  648  YRITSSAGTPDQAAFILSIPKRKPMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRT  707

Query  249  VC  244
             C
Sbjct  708  AC  709



>ref|XP_010472589.1| PREDICTED: uncharacterized protein LOC104752210 [Camelina sativa]
Length=257

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+G
Sbjct  136  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGACFSDQVVELDFLYPSEGIHRRWENG  195

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  196  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  255

Query  249  V  247
            V
Sbjct  256  V  256



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE G
Sbjct  581  SFPFKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWEQG  640

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRT
Sbjct  641  YRITSSAATIDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRT  700

Query  249  VC  244
            VC
Sbjct  701  VC  702



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 2/122 (2%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSMTTA SRWGVVMSRNAG+++QVVELDFLYPSEGIHRRWESG
Sbjct  592  SFPFKWINKKWKEGFHVTSMTTAASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESG  651

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAAF+LSIP+RK MDETQETLRTSAFPSTH  EKW+KNLYIASICYGRT
Sbjct  652  YRITSMAATPDQAAFVLSIPKRKTMDETQETLRTSAFPSTH--EKWAKNLYIASICYGRT  709

Query  249  VC  244
            VC
Sbjct  710  VC  711


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/112 (27%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I+K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I  +WE  + I+
Sbjct  504  IDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVFLH-KDWIMEQWEKNFYIS  562

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            S+A   + A+ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  563  SIAGATNGASLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSM  611



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRT
Sbjct  643  YRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 62/113 (55%), Gaps = 7/113 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I K   +G +++S+ ++ + W ++M    G+  QV EL   FL+  + I  +WE  Y IT
Sbjct  495  IEKGNDDGLYISSVASSANLWALIMDAGTGFCSQVYELSPVFLH-KDWIMEQWEKSYYIT  553

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASIC  262
            ++A +++ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+ 
Sbjct  554  AIAGSSNGSSLVV---MSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMA  603



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESG
Sbjct  583  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRT
Sbjct  643  YRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRT  702

Query  249  VC  244
            VC
Sbjct  703  VC  704


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 62/113 (55%), Gaps = 7/113 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I K   +G +++S+ ++ + W ++M    G+  QV EL   FL+  + I  +WE  Y IT
Sbjct  495  IEKGNDDGLYISSVASSANLWALIMDAGTGFCSQVYELSPVFLH-KDWIMEQWEKSYYIT  553

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASIC  262
            ++A +++ ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+ 
Sbjct  554  AIAGSSNGSSLVV---MSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMA  603



>gb|AAC42254.1| unknown protein [Arabidopsis thaliana]
Length=282

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV+ELDFLYPSEGIHRRWE+G
Sbjct  161  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGASFSDQVIELDFLYPSEGIHRRWENG  220

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  221  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  280

Query  249  V  247
            V
Sbjct  281  V  281



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN GYS QVVELDFLYPSEGIHRRWE+G
Sbjct  605  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNTGYSHQVVELDFLYPSEGIHRRWETG  664

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFIL++P+RK +DETQETLRTS+FPSTHVKEKWSKNLYIASICYGRT
Sbjct  665  YRITSTAATPDQAAFILTMPKRKPVDETQETLRTSSFPSTHVKEKWSKNLYIASICYGRT  724

Query  249  VC  244
            VC
Sbjct  725  VC  726



>ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
 gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSMTT+G+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+G
Sbjct  584  SFPFKWINKKWREGFYVTSMTTSGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENG  643

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAAFILS+P+RKM DETQETLRTSAFPSTHVKEKWSKNLYIAS+CYGRT
Sbjct  644  FRITSTAATVDQAAFILSVPKRKMSDETQETLRTSAFPSTHVKEKWSKNLYIASVCYGRT  703

Query  249  V  247
            V
Sbjct  704  V  704



>ref|XP_010500967.1| PREDICTED: uncharacterized protein LOC104778257 isoform X2 [Camelina 
sativa]
Length=390

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  269  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  328

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  329  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  388

Query  249  V  247
            V
Sbjct  389  V  389



>ref|XP_002466312.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
 gb|EER93310.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
Length=707

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGV++SRNAGYS QVVELDFLYPSEGIHRRWE+G
Sbjct  586  SFPYKWINKKWKEGFHVTSMATAGNRWGVIVSRNAGYSTQVVELDFLYPSEGIHRRWETG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAFILSIP+RK MDETQE LRTSAFPS+HVKEKW KNLYI+S+CYGRT
Sbjct  646  YRITSIAATPDQAAFILSIPKRKPMDETQEILRTSAFPSSHVKEKWVKNLYISSVCYGRT  705

Query  249  VC  244
            VC
Sbjct  706  VC  707



>ref|XP_010542444.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIH+RW+SG
Sbjct  582  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHKRWDSG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRT
Sbjct  642  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRT  701

Query  249  V  247
            V
Sbjct  702  V  702



>ref|XP_010534909.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  582  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWDGG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRT
Sbjct  642  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRT  701

Query  249  V  247
            V
Sbjct  702  V  702



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score =   234 bits (597),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GY+ QVVELDFLYPSEGIH RWE+G
Sbjct  585  SFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYATQVVELDFLYPSEGIHHRWETG  644

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILSIP+RK MDETQETLRTSAFPS HVKEKW KNLYI+SICYGRT
Sbjct  645  YRITSTAATPDQAAFILSIPKRKPMDETQETLRTSAFPSNHVKEKWVKNLYISSICYGRT  704

Query  249  VC  244
            VC
Sbjct  705  VC  706


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 61/112 (54%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I K  ++G +++S+ ++ + W ++M    G+  QV EL   FL+  E I  +WE  Y IT
Sbjct  497  IEKGNQDGLYISSVASSANFWALIMDAGTGFCSQVYELSQMFLH-KEWITEQWEKNYYIT  555

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            ++A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  556  AIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSM  604



>gb|EMS51431.1| Casein kinase I isoform beta [Triticum urartu]
Length=695

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQ+VELDFLYPSEGIHRRWE G
Sbjct  574  SFPFKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQIVELDFLYPSEGIHRRWEHG  633

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRT
Sbjct  634  YRITSSAATGDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRT  693

Query  249  V  247
            V
Sbjct  694  V  694



>emb|CDP13154.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RW VVMSRN+G+S+QVVELDFLYPSEGIH+RW+SG
Sbjct  480  SFPFKWINKKWKEGFHVTSMATAGTRWAVVMSRNSGFSDQVVELDFLYPSEGIHKRWDSG  539

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAA ILS+PRRK++DETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRT
Sbjct  540  YRITATAATWDQAALILSVPRRKLLDETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRT  599

Query  249  VC  244
            VC
Sbjct  600  VC  601



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  419  SFPFKWINKKWREGFHVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNG  478

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRT
Sbjct  479  YRITSTAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRT  538

Query  249  V  247
            V
Sbjct  539  V  539



>gb|KHN37292.1| Casein kinase I [Glycine soja]
Length=590

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ G
Sbjct  469  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKG  528

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRT
Sbjct  529  YRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRT  588

Query  249  VC  244
            VC
Sbjct  589  VC  590



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  606  SFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCG  665

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  666  YRITATAATWDQAAFVLSVPRRKPMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  725

Query  249  V  247
            V
Sbjct  726  V  726



>emb|CDY23629.1| BnaC05g39650D [Brassica napus]
Length=525

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G
Sbjct  404  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGG  463

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  464  YRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  523

Query  249  V  247
            V
Sbjct  524  V  524



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score =   231 bits (588),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 118/123 (96%), Gaps = 1/123 (1%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWI+KKWKEGFHVTSMT+AGSRWGVVMSRN+GYSEQVVE+DF+YPSEGIHRRWESG
Sbjct  565  SFPFKWISKKWKEGFHVTSMTSAGSRWGVVMSRNSGYSEQVVEVDFVYPSEGIHRRWESG  624

Query  429  YRITSMAATADQAAFILSIPRRK-MMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGR  253
            YRITSMAAT DQ+AF+LSIPRRK MMDE QETLRTSAFPS+HVK KWS+NLYIAS+C+G 
Sbjct  625  YRITSMAATTDQSAFVLSIPRRKLMMDEAQETLRTSAFPSSHVKAKWSRNLYIASMCHGP  684

Query  252  TVC  244
            TVC
Sbjct  685  TVC  687



>ref|XP_006407187.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
 gb|ESQ48640.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
Length=703

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  582  SFPFKWINKKWKEGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  642  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  701

Query  249  V  247
            V
Sbjct  702  V  702



>ref|XP_006445886.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 ref|XP_006492686.1| PREDICTED: uncharacterized protein LOC102618306 [Citrus sinensis]
 gb|ESR59126.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 gb|KDO62936.1| hypothetical protein CISIN_1g048600mg [Citrus sinensis]
Length=707

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+SEQVVELDFLYPSEGIHRRW+ G
Sbjct  586  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSEQVVELDFLYPSEGIHRRWDGG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  646  YRITSTAATCDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  705

Query  249  V  247
            V
Sbjct  706  V  706



>ref|XP_003536792.1| PREDICTED: uncharacterized protein LOC100783819 [Glycine max]
Length=672

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ G
Sbjct  551  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKG  610

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRT
Sbjct  611  YRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRT  670

Query  249  VC  244
            VC
Sbjct  671  VC  672



>ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            +FPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  586  TFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  645

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAA ILS+P+RK  DETQETLRTSAFPS+HVKEKWSKNLY+ASICYGRT
Sbjct  646  YRITATAATFDQAALILSVPKRKPGDETQETLRTSAFPSSHVKEKWSKNLYLASICYGRT  705

Query  249  V  247
            V
Sbjct  706  V  706



>ref|XP_010936996.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  479  SFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  538

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRT
Sbjct  539  YRITSMAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRT  598

Query  249  V  247
            V
Sbjct  599  V  599



>ref|XP_009382978.1| PREDICTED: uncharacterized protein LOC103970784 [Musa acuminata 
subsp. malaccensis]
Length=721

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  600  SFPFKWINKKWKEGFHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  659

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSM AT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRT
Sbjct  660  YRITSMGATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRT  719

Query  249  V  247
            V
Sbjct  720  V  720


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 58/111 (52%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIHRRWESGYRITS  415
            I +  ++G  ++ + +  + W ++M    G++ QV EL  F    E I  +WE  Y ITS
Sbjct  512  IERGNEDGLLISCVASCSNLWAIIMDAGTGFTSQVYELSPFFLHKEWIMEQWEKNYYITS  571

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  572  LAGSNNGSSLVV---MSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSM  619



>gb|KHN27094.1| Casein kinase I [Glycine soja]
Length=657

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ G
Sbjct  536  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKG  595

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRT
Sbjct  596  YRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRT  655

Query  249  VC  244
            VC
Sbjct  656  VC  657



>ref|XP_010936995.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X1 [Elaeis 
guineensis]
Length=601

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  480  SFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  539

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRT
Sbjct  540  YRITSMAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRT  599

Query  249  V  247
            V
Sbjct  600  V  600



>ref|XP_003556554.1| PREDICTED: uncharacterized protein LOC100807373 [Glycine max]
Length=669

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ G
Sbjct  548  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKG  607

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRT
Sbjct  608  YRITATAATLDQSALILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRT  667

Query  249  VC  244
            VC
Sbjct  668  VC  669



>ref|XP_001764211.1| predicted protein [Physcomitrella patens]
 gb|EDQ71052.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  482  SFPFKWINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  541

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRT
Sbjct  542  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRT  601

Query  249  V  247
            V
Sbjct  602  V  602



>ref|XP_001770883.1| predicted protein [Physcomitrella patens]
 gb|EDQ64213.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  482  SFPFKWINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  541

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRT
Sbjct  542  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRT  601

Query  249  V  247
            V
Sbjct  602  V  602



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  551  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  610

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRT
Sbjct  611  YRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRT  670

Query  249  VC  244
            VC
Sbjct  671  VC  672



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  551  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  610

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRT
Sbjct  611  YRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRT  670

Query  249  VC  244
            VC
Sbjct  671  VC  672



>ref|XP_009146466.1| PREDICTED: uncharacterized protein LOC103870106 [Brassica rapa]
Length=689

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G
Sbjct  568  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGG  627

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  628  YRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  687

Query  249  V  247
            V
Sbjct  688  V  688



>ref|XP_006297084.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
 gb|EOA29982.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
Length=704

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  583  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  643  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  702

Query  249  V  247
            V
Sbjct  703  V  703



>emb|CDX97505.1| BnaA05g25740D [Brassica napus]
Length=653

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G
Sbjct  532  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGG  591

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  592  YRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  651

Query  249  V  247
            V
Sbjct  652  V  652



>ref|XP_002882838.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59097.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  582  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  642  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  701

Query  249  V  247
            V
Sbjct  702  V  702



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  587  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  646

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRT
Sbjct  647  YRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRT  706

Query  249  VC  244
            VC
Sbjct  707  VC  708



>gb|KHN18151.1| Casein kinase I like 2 [Glycine soja]
Length=486

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  365  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNG  424

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  425  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  484

Query  249  V  247
            V
Sbjct  485  V  485


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/110 (22%), Positives = 58/110 (53%), Gaps = 3/110 (3%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIHRRWESGYRITS  415
            I+K  ++G  ++S+ +  + W ++M    G++ QV EL  F    E I  +WE  Y I++
Sbjct  277  IDKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSPFFLHKEWIMEQWEKNYYISA  336

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASI  265
            +A   + ++ ++     + + ++ +   + +FP   + +KW +  Y+ ++
Sbjct  337  IAGANNGSSLVVMSKGTQYLQQSYKV--SDSFPFKWINKKWREGFYVTAM  384



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VT+M TAGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  562  SFPFKWINKKWKEGFYVTAMATAGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  621

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLYIASICYGRT
Sbjct  622  YRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSQHVKEKWSKNLYIASICYGRT  681

Query  249  V  247
            V
Sbjct  682  V  682



>gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  606  FPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGY  427
            FPFKWINKKWKEGF VTSMTTAGS+WG+VMSRNAGY  QVVELDFLYPSEGIHRRWESGY
Sbjct  544  FPFKWINKKWKEGFSVTSMTTAGSKWGIVMSRNAGYPNQVVELDFLYPSEGIHRRWESGY  603

Query  426  RITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RITS AATADQAAFILS P+RK  D  QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  604  RITSTAATADQAAFILSAPKRKSSDVAQETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  663



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  391  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  450

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  451  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  510

Query  249  V  247
            V
Sbjct  511  V  511



>ref|XP_010465212.1| PREDICTED: uncharacterized protein LOC104745616 [Camelina sativa]
Length=714

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  593  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  652

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  653  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  712

Query  249  V  247
            V
Sbjct  713  V  713



>gb|KFK38714.1| hypothetical protein AALP_AA3G150500 [Arabis alpina]
Length=700

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  579  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  638

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  639  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  698

Query  249  V  247
            V
Sbjct  699  V  699



>ref|XP_010500960.1| PREDICTED: uncharacterized protein LOC104778257 isoform X1 [Camelina 
sativa]
Length=711

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  590  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  649

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  650  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  709

Query  249  V  247
            V
Sbjct  710  V  710



>emb|CDY55141.1| BnaC01g44810D [Brassica napus]
Length=632

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G
Sbjct  511  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGG  570

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  571  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  630

Query  249  V  247
            V
Sbjct  631  V  631



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score =   228 bits (581),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVT+M TAGSRW +VMSR AG+SEQVVELDFLYPSEGIHRRW++G
Sbjct  556  SFPFKWINKKWREGFHVTAMATAGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDNG  615

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRT
Sbjct  616  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRT  675

Query  249  V  247
            V
Sbjct  676  V  676



>ref|XP_008351086.1| PREDICTED: uncharacterized protein LOC103414488 [Malus domestica]
Length=486

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  365  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  424

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  425  FRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  484

Query  249  V  247
            V
Sbjct  485  V  485



>ref|XP_009413490.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413491.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  596  SFPFKWINKKWKEGFHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  655

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT M AT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRT
Sbjct  656  YRITCMGATWDQAALILSVPKRKPCDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRT  715

Query  249  V  247
            V
Sbjct  716  V  716


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIHRRWESGYRITS  415
            I+K  ++G  ++ + ++ + W ++M    G++ Q+ EL  F    E +  +WE  Y ITS
Sbjct  508  IDKGNEDGLLISCVASSSNLWALIMDAGTGFTSQIYELSPFFLHKEWVMDQWEKNYYITS  567

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            +A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ S+
Sbjct  568  LAGSNNGSSLVV---MSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSM  615



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  598  SFPFKWINKKWREGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  657

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  658  YRITATAATWDQAAFVLSVPRRRPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  717

Query  249  V  247
            V
Sbjct  718  V  718



>ref|XP_010487127.1| PREDICTED: serine/threonine-protein kinase STE20-like [Camelina 
sativa]
Length=717

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  596  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  655

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  656  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  715

Query  249  V  247
            V
Sbjct  716  V  716



>ref|XP_008655737.1| PREDICTED: uncharacterized protein LOC103634938 [Zea mays]
 gb|AFW80326.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
 gb|AFW80327.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
Length=332

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            +FPFKWINKKWKEGF+VT+M TAGSRW VVMSRNAG++ QVVELDFLYPSEGIH RW++G
Sbjct  211  TFPFKWINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTSQVVELDFLYPSEGIHMRWDNG  270

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVK+KWSKNLY+ASICYGR+
Sbjct  271  YRITATAATWDQAAFILSIPRRKPSDETQETLRTSAFPSQHVKDKWSKNLYLASICYGRS  330

Query  249  V  247
            V
Sbjct  331  V  331


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 55/111 (50%), Gaps = 3/111 (3%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVEL-DFLYPSEGIHRRWESGYRITS  415
            I K  ++G  ++S+ ++ + W ++M    G++ QV EL ++    E I  +WE  + IT+
Sbjct  123  IQKGNEDGLFISSVASSSNLWALIMDAGTGFTSQVYELSNYFLHKEWIMEQWERNFYITA  182

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASIC  262
            +A   + ++ +  I  R      Q    +  FP   + +KW +  Y+ ++ 
Sbjct  183  LAGANNGSSLV--IMSRGTQYAQQSYKVSDTFPFKWINKKWKEGFYVTAMA  231



>ref|XP_009404157.1| PREDICTED: uncharacterized protein LOC103987553 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  604  SFPFKWINKKWKEGFHVTSMATAGTRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDGG  663

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAA ILS+P+RK  DETQETLRTS+FPS HVK+KW+KNLY+ASICYGRT
Sbjct  664  YRITSMAATWDQAALILSVPKRKPGDETQETLRTSSFPSAHVKDKWAKNLYLASICYGRT  723

Query  249  V  247
            V
Sbjct  724  V  724



>gb|ADE76410.1| unknown [Picea sitchensis]
Length=444

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  606  FPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGY  427
            FPFKWINKKWKEGF+VTSM+TA SRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+
Sbjct  324  FPFKWINKKWKEGFYVTSMSTAASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGF  383

Query  426  RITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RIT+ AAT DQAAFILS+P+RK  DETQETLRTSAFPSTHVKEKW+KNLY+A++CYGRTV
Sbjct  384  RITATAATWDQAAFILSVPKRKPGDETQETLRTSAFPSTHVKEKWAKNLYLAAVCYGRTV  443



>emb|CDY51730.1| BnaA01g37130D [Brassica napus]
Length=684

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G
Sbjct  563  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGG  622

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  623  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  682

Query  249  V  247
            V
Sbjct  683  V  683



>tpg|DAA54811.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=186

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVT+M T+G+RW +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G
Sbjct  65   SFPFKWINKKWKEGFHVTAMATSGNRWAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNG  124

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RIT+MAAT DQ+A ILS PRR+  DETQETLRT+ FPS HVK+KW+KNLY+A ICYGRT
Sbjct  125  FRITAMAATMDQSALILSKPRRRPRDETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRT  184

Query  249  VC  244
            V 
Sbjct  185  VA  186



>emb|CDX75726.1| BnaC03g38090D [Brassica napus]
Length=652

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  531  SFPFKWINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  590

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  591  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  650

Query  249  V  247
            V
Sbjct  651  V  651



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  576  SFPFKWINKKWREGFYVTSMATAGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSG  635

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRT
Sbjct  636  YRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRT  695

Query  249  V  247
            V
Sbjct  696  V  696



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  572  SFPFKWINKKWREGFYVTSMATAGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSG  631

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRT
Sbjct  632  YRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRT  691

Query  249  V  247
            V
Sbjct  692  V  692



>gb|KDP44321.1| hypothetical protein JCGZ_19188 [Jatropha curcas]
Length=710

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  589  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  648

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  649  FRITSTAATLDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  708

Query  249  V  247
            V
Sbjct  709  V  709



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  564  SFPFKWINKKWREGFYVTAMATAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGG  623

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRT
Sbjct  624  YRITATAATMDQAAFVLSVPRRKPTDETQETLRTSAFPSQHVKEKWAKNLYIASVCYGRT  683

Query  249  V  247
            V
Sbjct  684  V  684



>ref|XP_004162011.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213194 
[Cucumis sativus]
Length=694

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  573  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  632

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  633  YRITSTAATWDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  692

Query  249  V  247
            V
Sbjct  693  V  693



>ref|XP_004142151.1| PREDICTED: uncharacterized protein LOC101213194 [Cucumis sativus]
 ref|XP_008449783.1| PREDICTED: uncharacterized protein LOC103491568 [Cucumis melo]
 gb|KGN54092.1| hypothetical protein Csa_4G285680 [Cucumis sativus]
Length=694

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  573  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  632

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  633  YRITSTAATWDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  692

Query  249  V  247
            V
Sbjct  693  V  693



>ref|NP_187977.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01914.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AAL85021.1| putative casein kinase [Arabidopsis thaliana]
 gb|AAM51279.1| putative casein kinase [Arabidopsis thaliana]
 gb|AEE75390.1| protein kinase family protein [Arabidopsis thaliana]
Length=703

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  582  SFPFKWINKKWREGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  642  FRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  701

Query  249  V  247
            V
Sbjct  702  V  702



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GY++QV+ELDFLYPSEGIHRRW++G
Sbjct  554  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYTDQVIELDFLYPSEGIHRRWDNG  613

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRT
Sbjct  614  YRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRT  673

Query  249  VC  244
            VC
Sbjct  674  VC  675



>ref|XP_010033842.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 ref|XP_010033843.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 gb|KCW53681.1| hypothetical protein EUGRSUZ_J02945 [Eucalyptus grandis]
Length=709

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VTSM TAGSRW +VMSR AG+SEQVVELDFLYPSEGIHRRW+SG
Sbjct  588  SFPFKWINKKWKEGFYVTSMGTAGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDSG  647

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LSIPRRK  DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  648  YRITATAATWDQAAFVLSIPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYLASICYGRT  707

Query  249  V  247
            V
Sbjct  708  V  708



>ref|XP_010257513.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257516.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257517.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
Length=726

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  605  SFPFKWINKKWREGFHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  664

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRT
Sbjct  665  YRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRT  724

Query  249  V  247
            V
Sbjct  725  V  725



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G
Sbjct  485  SFPFKWINKKWREGFYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNG  544

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  545  FRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  604

Query  249  V  247
            V
Sbjct  605  V  605



>ref|XP_007135639.1| hypothetical protein PHAVU_010G145900g [Phaseolus vulgaris]
 gb|ESW07633.1| hypothetical protein PHAVU_010G145900g [Phaseolus vulgaris]
Length=711

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM T+G RWGVVMSR AGYS+QV+ELDFLYPSEGIH+RW+SG
Sbjct  590  SFPFKWINKKWREGFYVTSMATSGPRWGVVMSRGAGYSDQVIELDFLYPSEGIHKRWDSG  649

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  650  YRITSTAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  709

Query  249  V  247
            V
Sbjct  710  V  710


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIHRRWESGYRITS  415
            I K  ++G +++S+ ++ + W ++M    G++ QV EL  F    E I  +WE GY I++
Sbjct  502  IEKGNEDGLYISSVASSQNVWALIMDAGTGFAGQVYELSPFFLHKEWIVEQWELGYYISA  561

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASI  265
            +A  A+ ++ ++     + + ++ +   + +FP   + +KW +  Y+ S+
Sbjct  562  IAGAANGSSLVVMSKGTQFVQQSYKV--SDSFPFKWINKKWREGFYVTSM  609



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  478  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  537

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRT
Sbjct  538  YRITATAATWDQSALILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRT  597

Query  249  VC  244
            VC
Sbjct  598  VC  599



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  598  SFPFKWINKKWREGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDNG  657

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  658  YRITATAATWDQAAFVLSVPRRRPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  717

Query  249  V  247
            V
Sbjct  718  V  718



>emb|CBI16476.3| unnamed protein product [Vitis vinifera]
Length=603

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  482  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  541

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  542  YRITSTAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRT  601

Query  249  V  247
            V
Sbjct  602  V  602



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  606  FPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGY  427
            FPFKWINKKWKEGF VTSMTTAGSRWG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGY
Sbjct  509  FPFKWINKKWKEGFFVTSMTTAGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGY  568

Query  426  RITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RITS AATADQAAFILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  569  RITSTAATADQAAFILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  628



>ref|XP_002880706.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56965.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=674

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+G
Sbjct  553  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGANFSDQVVELDFLYPSEGIHRRWENG  612

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  613  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  672

Query  249  V  247
            V
Sbjct  673  V  673



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRW VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  572  SFPFKWINKKWREGFYVTSMATAGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSG  631

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  632  YRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  691

Query  249  V  247
            V
Sbjct  692  V  692


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 57/112 (51%), Gaps = 5/112 (4%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIHRRWESGYRITS  415
            I+K  ++G  ++S+ +  + W ++M    G+  QV EL  F    E I  +WE  Y I++
Sbjct  484  IDKGNQDGLFISSVASCSNLWALIMDAGTGFVSQVYELSSFFLHKEWIMEQWEKNYYISA  543

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASIC  262
            +A   + ++ ++     K     Q++ + S +FP   + +KW +  Y+ S+ 
Sbjct  544  IAGANNGSSLVV---MSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMA  592



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRW VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  576  SFPFKWINKKWREGFYVTSMATAGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSG  635

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  636  YRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  695

Query  249  V  247
            V
Sbjct  696  V  696


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 57/112 (51%), Gaps = 5/112 (4%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIHRRWESGYRITS  415
            I+K  ++G  ++S+ +  + W ++M    G+  QV EL  F    E I  +WE  Y I++
Sbjct  488  IDKGNQDGLFISSVASCSNLWALIMDAGTGFVSQVYELSSFFLHKEWIMEQWEKNYYISA  547

Query  414  MAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASIC  262
            +A   + ++ ++     K     Q++ + S +FP   + +KW +  Y+ S+ 
Sbjct  548  IAGANNGSSLVV---MSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMA  596



>gb|KJB21848.1| hypothetical protein B456_004G018000 [Gossypium raimondii]
Length=704

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  583  SFPFKWINKKWREGFYVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAA ILSIP+RK  DETQETLRTS FPS HVKEKW+KNLY+A +CYGRT
Sbjct  643  YRITSTAATLDQAALILSIPKRKPGDETQETLRTSQFPSIHVKEKWAKNLYLACLCYGRT  702

Query  249  V  247
            V
Sbjct  703  V  703



>ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            +FPFKWINKKW+EGF VTSM TAGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+SG
Sbjct  582  TFPFKWINKKWREGFFVTSMATAGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDSG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PR+K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  642  YRITATAATWDQAAFVLSVPRKKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  701

Query  249  V  247
            V
Sbjct  702  V  702



>ref|XP_007014775.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY32394.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=701

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  580  SFPFKWINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  640  YRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  699

Query  249  V  247
            V
Sbjct  700  V  700



>gb|KFK32550.1| hypothetical protein AALP_AA6G257400 [Arabis alpina]
Length=673

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VTSM TAGS+WG+VMSR AG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  552  SFPFKWINKKWKEGFYVTSMATAGSKWGIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNG  611

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAA +LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYI+S+CYGRT
Sbjct  612  YRITSVAATCDQAALVLSVPRRKPSDETQETLRTSAFPSTHVKEKWAKNLYISSMCYGRT  671

Query  249  V  247
            V
Sbjct  672  V  672



>gb|KHN39248.1| Casein kinase I isoform delta-like, partial [Glycine soja]
Length=661

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIH+RW+ G
Sbjct  540  SFPFKWINKKWREGFYVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCG  599

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  600  YRITATAATWDQAAFVLSVPRRKPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  659

Query  249  V  247
            V
Sbjct  660  V  660



>gb|EMT21659.1| Casein kinase I-RAG8-like protein [Aegilops tauschii]
Length=640

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS Q+VELDFLYPSEGIH RWE G
Sbjct  519  SFPFKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSGQIVELDFLYPSEGIHWRWEHG  578

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRT
Sbjct  579  YRITSSAATGDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRT  638

Query  249  V  247
            V
Sbjct  639  V  639



>ref|XP_008797930.1| PREDICTED: uncharacterized protein LOC103712966 isoform X3 [Phoenix 
dactylifera]
Length=728

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  607  SFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  666

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRT
Sbjct  667  YRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRT  726

Query  249  V  247
            V
Sbjct  727  V  727



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  546  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  605

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRT
Sbjct  606  YRITATAATWDQSALILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRT  665

Query  249  VC  244
            VC
Sbjct  666  VC  667



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G
Sbjct  589  SFPFKWINKKWREGFYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNG  648

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  649  FRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  708

Query  249  V  247
            V
Sbjct  709  V  709



>ref|XP_006293796.1| hypothetical protein CARUB_v10022778mg [Capsella rubella]
 gb|EOA26694.1| hypothetical protein CARUB_v10022778mg [Capsella rubella]
Length=675

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+G
Sbjct  554  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGASFSDQVVELDFLYPSEGIHRRWENG  613

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS+HVKEKW+KNLYIASICYGRT
Sbjct  614  YRITSVAATWDQAAFVLSMPRRKLTDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRT  673

Query  249  V  247
            V
Sbjct  674  V  674



>ref|XP_008797939.1| PREDICTED: uncharacterized protein LOC103712966 isoform X4 [Phoenix 
dactylifera]
Length=727

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  606  SFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  665

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRT
Sbjct  666  YRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRT  725

Query  249  V  247
            V
Sbjct  726  V  726



>ref|NP_180147.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC07748.1| protein kinase family protein [Arabidopsis thaliana]
Length=673

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV+ELDFLYPSEGIHRRWE+G
Sbjct  552  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGASFSDQVIELDFLYPSEGIHRRWENG  611

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  612  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  671

Query  249  V  247
            V
Sbjct  672  V  672



>gb|EEC78673.1| hypothetical protein OsI_18806 [Oryza sativa Indica Group]
Length=607

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VT+M TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHRRW++G
Sbjct  486  SFPFKWINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNG  545

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRT
Sbjct  546  FRITATAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRT  605

Query  249  V  247
            V
Sbjct  606  V  606



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G
Sbjct  583  SFPFKWINKKWREGFYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNG  642

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  643  FRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  702

Query  249  V  247
            V
Sbjct  703  V  703



>ref|NP_973532.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC07749.1| protein kinase family protein [Arabidopsis thaliana]
Length=676

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV+ELDFLYPSEGIHRRWE+G
Sbjct  555  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGASFSDQVIELDFLYPSEGIHRRWENG  614

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  615  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  674

Query  249  V  247
            V
Sbjct  675  V  675



>ref|XP_008797915.1| PREDICTED: uncharacterized protein LOC103712966 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  611  SFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  670

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRT
Sbjct  671  YRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRT  730

Query  249  V  247
            V
Sbjct  731  V  731



>ref|XP_008797922.1| PREDICTED: uncharacterized protein LOC103712966 isoform X2 [Phoenix 
dactylifera]
Length=731

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  610  SFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  669

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITSMAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRT
Sbjct  670  YRITSMAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRT  729

Query  249  V  247
            V
Sbjct  730  V  730



>ref|XP_008338530.1| PREDICTED: casein kinase I homolog 2-like [Malus domestica]
Length=538

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  417  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGG  476

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  477  FRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  536

Query  249  V  247
            V
Sbjct  537  V  537



>ref|XP_002531638.1| casein kinase, putative [Ricinus communis]
 gb|EEF30734.1| casein kinase, putative [Ricinus communis]
Length=703

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  582  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  641

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  642  FRITSTAATFDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  701

Query  249  V  247
            V
Sbjct  702  V  702



>ref|XP_007024285.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY26907.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=483

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  364  SFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCG  423

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK MDETQETLRTSAFPSTHV  KW+KNLYIAS+CYGRT
Sbjct  424  YRITATAATWDQAAFVLSVPRRKPMDETQETLRTSAFPSTHV--KWAKNLYIASVCYGRT  481

Query  249  V  247
            V
Sbjct  482  V  482


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (50%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I K  ++G  ++S+ +  + W ++M    G+S QV EL   FL+  E I  +WE  Y I+
Sbjct  276  IEKGNEDGLFISSVASCQNLWALIMDAGTGFSSQVYELSPHFLH-KEWIMEQWEKNYYIS  334

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASI  265
            ++A   +   F L +  R      Q    + +FP   + +KW +  ++ S+
Sbjct  335  AIAGATN--GFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVTSM  383



>ref|XP_008445007.1| PREDICTED: uncharacterized protein LOC103488176 [Cucumis melo]
Length=699

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAG RW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  578  SFPFKWINKKWREGFYVTAMATAGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  637

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  638  YRITSTAATLDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  697

Query  249  V  247
            V
Sbjct  698  V  698



>dbj|BAG92829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62667.1| hypothetical protein OsJ_17470 [Oryza sativa Japonica Group]
Length=607

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VT+M TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHRRW++G
Sbjct  486  SFPFKWINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNG  545

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRT
Sbjct  546  FRITATAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRT  605

Query  249  V  247
            V
Sbjct  606  V  606



>gb|AAT44311.1| putative casein kinase [Oryza sativa Japonica Group]
 gb|AAV59374.1| putative casein kinase [Oryza sativa Japonica Group]
Length=608

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VT+M TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHRRW++G
Sbjct  487  SFPFKWINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNG  546

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRT
Sbjct  547  FRITATAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRT  606

Query  249  V  247
            V
Sbjct  607  V  607



>ref|XP_009117581.1| PREDICTED: uncharacterized protein LOC103842673 [Brassica rapa]
Length=683

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G
Sbjct  562  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGG  621

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQAA ILSIPRR+++D+TQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  622  FRITSTAATTDQAALILSIPRRRLVDKTQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  681

Query  249  V  247
            V
Sbjct  682  V  682



>ref|XP_010472590.1| PREDICTED: uncharacterized protein LOC104752211 [Camelina sativa]
Length=676

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+G
Sbjct  555  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGACFSDQVVELDFLYPSEGIHRRWENG  614

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  615  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  674

Query  249  V  247
            V
Sbjct  675  V  675



>gb|KJB07481.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=485

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR A +S+QVVELDFLYPSEGIHRRW+SG
Sbjct  364  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAPFSDQVVELDFLYPSEGIHRRWDSG  423

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  424  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  483

Query  249  V  247
            V
Sbjct  484  V  484



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  550  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  609

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  610  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  669

Query  249  V  247
            V
Sbjct  670  V  670



>emb|CAN69523.1| hypothetical protein VITISV_040873 [Vitis vinifera]
Length=670

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  549  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  608

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  609  YRITSTAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRT  668

Query  249  V  247
            V
Sbjct  669  V  669



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVT+M TAGSRW +VMSR AG+S QVVELDFLYPSEGIHRRW++G
Sbjct  562  SFPFKWINKKWREGFHVTAMATAGSRWAIVMSRGAGFSXQVVELDFLYPSEGIHRRWDNG  621

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRT
Sbjct  622  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRT  681

Query  249  V  247
            V
Sbjct  682  V  682



>emb|CDX82524.1| BnaA03g32970D [Brassica napus]
Length=654

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  533  SFPFKWINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  592

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQ A ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  593  FRITSTAATTDQTALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  652

Query  249  V  247
            V
Sbjct  653  V  653



>ref|XP_010526089.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526090.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526091.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526092.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526093.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526094.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526095.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
Length=601

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRW +VMSR AG+S+QVVELDFLYPSEG+HRRW++G
Sbjct  480  SFPFKWINKKWREGFYVTSMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGVHRRWDNG  539

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT+DQAA +LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIA ICYGRT
Sbjct  540  YRITSIAATSDQAALVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIACICYGRT  599

Query  249  V  247
            V
Sbjct  600  V  600


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 59/111 (53%), Gaps = 5/111 (5%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I+K  ++G  ++S+ +  + W ++M    GY+ QV +L   FL+  E I   WE  Y IT
Sbjct  392  IDKGNEDGLFISSVASCSNLWALIMDAGTGYTAQVYQLSPCFLH-KEWIMENWEKNYYIT  450

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASI  265
            ++A   + ++ ++     + + ++ +   + +FP   + +KW +  Y+ S+
Sbjct  451  AIAGANNGSSLVVMSKGTQYLQQSYKV--SESFPFKWINKKWREGFYVTSM  499



>ref|XP_009135319.1| PREDICTED: uncharacterized protein LOC103859531 [Brassica rapa]
Length=676

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G
Sbjct  555  SFPFKWINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGG  614

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            +RITS AAT DQ A ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRT
Sbjct  615  FRITSTAATTDQTALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRT  674

Query  249  V  247
            V
Sbjct  675  V  675



>ref|XP_010546534.1| PREDICTED: uncharacterized protein LOC104818596 [Tarenaya hassleriana]
Length=701

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  580  SFPFKWINKKWREGFYVTSMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  639

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAA ILS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIA ICYGRT
Sbjct  640  YRITSLAATLDQAALILSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIAYICYGRT  699

Query  249  V  247
            V
Sbjct  700  V  700


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = -2

Query  591  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGIHRRWESGYRIT  418
            I+K  ++G  ++S+ +  + W ++M    GY+ QV +L   FL+  E I  +WE+ Y IT
Sbjct  492  IDKGNEDGLFISSVASCSNLWALIMDAGTGYTAQVYQLSPCFLH-KEWIMEQWENNYYIT  550

Query  417  SMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIASI  265
            ++A T + ++ ++     K     Q++ + S +FP   + +KW +  Y+ S+
Sbjct  551  AIAGTNNGSSLVVM---SKGTQYLQQSYKVSESFPFKWINKKWREGFYVTSM  599



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  606  FPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGY  427
            FPFKWINKKWKEGF VTSMTTAGSRWG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGY
Sbjct  580  FPFKWINKKWKEGFFVTSMTTAGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGY  639

Query  426  RITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RITS AATADQAAFILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  640  RITSTAATADQAAFILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  699



>ref|XP_011019588.1| PREDICTED: uncharacterized protein LOC105122267 isoform X2 [Populus 
euphratica]
Length=483

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR  G+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  362  SFPFKWINKKWREGFYVTTMATAGSRWAIVMSRGTGFSDQVVELDFLYPSEGIHRRWDSG  421

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+ NLYIAS+CYGRT
Sbjct  422  YRITSTAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWATNLYIASVCYGRT  481

Query  249  V  247
            V
Sbjct  482  V  482



>gb|KDP34168.1| hypothetical protein JCGZ_07739 [Jatropha curcas]
Length=681

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  560  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  619

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  620  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  679

Query  249  V  247
            V
Sbjct  680  V  680



>ref|XP_008787870.1| PREDICTED: uncharacterized protein LOC103705792 [Phoenix dactylifera]
Length=730

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  609  SFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  668

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRT
Sbjct  669  YRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRT  728

Query  249  V  247
            V
Sbjct  729  V  729



>gb|KHN10182.1| Casein kinase I like 2 [Glycine soja]
Length=606

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  485  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  544

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASICYGRT
Sbjct  545  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRT  604

Query  249  V  247
            V
Sbjct  605  V  605



>ref|XP_004155952.1| PREDICTED: uncharacterized protein LOC101230855 [Cucumis sativus]
Length=716

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M T+GSRWGVVMSR +G+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  595  SFPFKWINKKWREGFYVTAMATSGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCG  654

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT+DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  655  YRITATAATSDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  714

Query  249  V  247
            V
Sbjct  715  V  715



>ref|XP_011006418.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006419.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006420.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006421.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
Length=691

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  570  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDGG  629

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  630  YRITSTAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  689

Query  249  V  247
            V
Sbjct  690  V  690



>ref|XP_006583050.1| PREDICTED: uncharacterized protein LOC100800869 [Glycine max]
Length=723

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIH+RW+ G
Sbjct  602  SFPFKWINKKWREGFYVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCG  661

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  662  YRITATAATWDQAAFVLSVPRRKPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  721

Query  249  V  247
            V
Sbjct  722  V  722



>gb|KGN45587.1| hypothetical protein Csa_7G452910 [Cucumis sativus]
Length=720

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M T+GSRWGVVMSR +G+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  599  SFPFKWINKKWREGFYVTAMATSGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCG  658

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT+DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  659  YRITATAATSDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  718

Query  249  V  247
            V
Sbjct  719  V  719



>ref|XP_009367436.1| PREDICTED: uncharacterized protein LOC103957076 [Pyrus x bretschneideri]
Length=677

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVT+M TA SRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  556  SFPFKWINKKWREGFHVTAMATARSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNG  615

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRT
Sbjct  616  YRITSTAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRT  675

Query  249  V  247
            V
Sbjct  676  V  676



>ref|XP_006476018.1| PREDICTED: uncharacterized protein LOC102627154 isoform X1 [Citrus 
sinensis]
Length=697

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  576  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  635

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  636  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  695

Query  249  V  247
            V
Sbjct  696  V  696



>ref|XP_006450715.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 ref|XP_006450716.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63955.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63956.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
Length=697

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  576  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  635

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  636  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  695

Query  249  V  247
            V
Sbjct  696  V  696



>ref|XP_004141661.1| PREDICTED: uncharacterized protein LOC101213589 [Cucumis sativus]
Length=716

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M T+GSRWGVVMSR +G+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  595  SFPFKWINKKWREGFYVTAMATSGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCG  654

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT+DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  655  YRITATAATSDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  714

Query  249  V  247
            V
Sbjct  715  V  715



>ref|XP_003565003.1| PREDICTED: uncharacterized protein LOC100839189 [Brachypodium 
distachyon]
Length=608

 Score =   224 bits (571),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGF+VT+M TAGSRW +VMSRNAG+S+QVVELDFLYPSEGIH RW++G
Sbjct  487  SFPFKWINKKWKEGFYVTAMATAGSRWAIVMSRNAGFSDQVVELDFLYPSEGIHHRWDNG  546

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGR 
Sbjct  547  YRITATAATLDQAAFILSIPRRKPNDETQETLRTSAFPSQHVKEKWSKNLYLASICYGRA  606

Query  249  V  247
            V
Sbjct  607  V  607



>ref|XP_010429582.1| PREDICTED: uncharacterized protein LOC104714043 [Camelina sativa]
Length=677

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+G
Sbjct  556  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGAYFSDQVVELDFLYPSEGIHRRWENG  615

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  616  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  675

Query  249  V  247
            V
Sbjct  676  V  676



>gb|KDO79859.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79860.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79861.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79862.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79863.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=697

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  576  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  635

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRT
Sbjct  636  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRT  695

Query  249  V  247
            V
Sbjct  696  V  696



>ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera]
Length=714

 Score =   226 bits (576),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  593  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  652

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  653  YRITSTAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRT  712

Query  249  V  247
            V
Sbjct  713  V  713



>ref|XP_010093160.1| Casein kinase I [Morus notabilis]
 gb|EXB53619.1| Casein kinase I [Morus notabilis]
Length=801

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  680  SFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSG  739

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT DQ+A ILSIPRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  740  YRITATAATWDQSALILSIPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  799

Query  249  V  247
            V
Sbjct  800  V  800



>ref|XP_010417347.1| PREDICTED: uncharacterized protein LOC104703104 isoform X1 [Camelina 
sativa]
Length=678

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+G
Sbjct  557  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGAYFSDQVVELDFLYPSEGIHRRWENG  616

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  617  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  676

Query  249  V  247
            V
Sbjct  677  V  677



>ref|XP_010417348.1| PREDICTED: uncharacterized protein LOC104703104 isoform X2 [Camelina 
sativa]
 ref|XP_010417349.1| PREDICTED: uncharacterized protein LOC104703104 isoform X3 [Camelina 
sativa]
Length=678

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+G
Sbjct  557  SFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGAYFSDQVVELDFLYPSEGIHRRWENG  616

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRT
Sbjct  617  YRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRT  676

Query  249  V  247
            V
Sbjct  677  V  677



>ref|XP_003523751.1| PREDICTED: uncharacterized protein LOC100779382 isoform X1 [Glycine 
max]
 ref|XP_006578236.1| PREDICTED: uncharacterized protein LOC100779382 isoform X2 [Glycine 
max]
 ref|XP_006578237.1| PREDICTED: uncharacterized protein LOC100779382 isoform X3 [Glycine 
max]
 ref|XP_006578238.1| PREDICTED: uncharacterized protein LOC100779382 isoform X4 [Glycine 
max]
Length=710

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  589  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  648

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASICYGRT
Sbjct  649  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRT  708

Query  249  V  247
            V
Sbjct  709  V  709



>gb|KGN62809.1| hypothetical protein Csa_2G373520 [Cucumis sativus]
Length=699

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAG RW +VMSR AG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  578  SFPFKWINKKWREGFYVTAMATAGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNG  637

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  638  YRITSTAATLDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  697

Query  249  V  247
            V
Sbjct  698  V  698



>ref|XP_010939945.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939946.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
Length=729

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  608  SFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  667

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRT
Sbjct  668  YRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRT  727

Query  249  V  247
            V
Sbjct  728  V  728



>ref|XP_007014774.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY32393.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=891

 Score =   228 bits (580),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  770  SFPFKWINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  829

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRT
Sbjct  830  YRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRT  889

Query  249  V  247
            V
Sbjct  890  V  890



>ref|XP_004148393.1| PREDICTED: uncharacterized protein LOC101218249 [Cucumis sativus]
 ref|XP_004162975.1| PREDICTED: uncharacterized LOC101218249 [Cucumis sativus]
Length=695

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAG RW +VMSR AG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  574  SFPFKWINKKWREGFYVTAMATAGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNG  633

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRT
Sbjct  634  YRITSTAATLDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRT  693

Query  249  V  247
            V
Sbjct  694  V  694



>ref|XP_010939947.1| PREDICTED: uncharacterized protein LOC105058653 isoform X2 [Elaeis 
guineensis]
Length=725

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G
Sbjct  604  SFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNG  663

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRT
Sbjct  664  YRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRT  723

Query  249  V  247
            V
Sbjct  724  V  724



>ref|XP_004517304.1| PREDICTED: uncharacterized protein LOC101495334 [Cicer arietinum]
Length=599

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAG+RW +VMSR AGYS+QVVELDFLYPSEGIHRRW++ 
Sbjct  478  SFPFKWINKKWREGFYVTAMATAGTRWAIVMSRGAGYSDQVVELDFLYPSEGIHRRWDNN  537

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAFILS+PRRK  DETQETLRTS FPSTHVKEKWSKNLYIASICYGRT
Sbjct  538  YRITSTAATCDQAAFILSVPRRKPPDETQETLRTSDFPSTHVKEKWSKNLYIASICYGRT  597

Query  249  V  247
            V
Sbjct  598  V  598



>ref|XP_008462429.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462430.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462431.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462432.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
Length=720

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M T+GSRWGVVMSR +G+S+QVVELDFLYPSEGIHRRW+ G
Sbjct  599  SFPFKWINKKWREGFYVTAMATSGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCG  658

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRIT+ AAT+DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIAS+CYGRT
Sbjct  659  YRITATAATSDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASVCYGRT  718

Query  249  V  247
            V
Sbjct  719  V  719



>ref|XP_003523750.1| PREDICTED: uncharacterized protein LOC100778855 isoform X1 [Glycine 
max]
Length=663

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  609  SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESG  430
            SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SG
Sbjct  542  SFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSG  601

Query  429  YRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            YRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASICYGRT
Sbjct  602  YRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRT  661

Query  249  V  247
            V
Sbjct  662  V  662



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230