BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049F20

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769426.1|  PREDICTED: homeobox protein 2-like               62.8    6e-09   Nicotiana sylvestris
ref|XP_011086042.1|  PREDICTED: LOW QUALITY PROTEIN: protein E6-like  62.0    1e-08   Sesamum indicum [beniseed]
ref|XP_009618543.1|  PREDICTED: probable serine/threonine-protein...  60.1    1e-07   Nicotiana tomentosiformis
dbj|BAM28759.1|  ROX1 homologue                                       58.5    3e-07   Nicotiana tabacum [American tobacco]
dbj|BAM28758.1|  ROX1 homologue                                       58.5    4e-07   Nicotiana benthamiana
ref|XP_009757117.1|  PREDICTED: protein E6                            57.8    6e-07   Nicotiana sylvestris
ref|XP_002279294.1|  PREDICTED: protein E6                            55.8    2e-06   Vitis vinifera
ref|XP_009613470.1|  PREDICTED: homeobox protein 2                    55.8    3e-06   Nicotiana tomentosiformis
gb|ABH01084.1|  putative ROX1                                         55.8    3e-06   Nicotiana tabacum [American tobacco]
ref|XP_004232917.1|  PREDICTED: homeobox protein 2-like               53.1    2e-05   Solanum lycopersicum
ref|XP_006364298.1|  PREDICTED: protein E6-like                       53.1    2e-05   Solanum tuberosum [potatoes]
ref|XP_011096354.1|  PREDICTED: protein E6-like                       52.4    4e-05   Sesamum indicum [beniseed]
gb|EYU43374.1|  hypothetical protein MIMGU_mgv1a012195mg              51.6    6e-05   Erythranthe guttata [common monkey flower]
ref|XP_008225146.1|  PREDICTED: protein E6                            50.8    1e-04   Prunus mume [ume]
gb|EPS61380.1|  hypothetical protein M569_13417                       50.1    2e-04   Genlisea aurea



>ref|XP_009769426.1| PREDICTED: homeobox protein 2-like [Nicotiana sylvestris]
Length=267

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  528  NGGAANRFEQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +G   +R +QQ MSDTRF+ENG+Y YDVNTEKY R PYENSR
Sbjct  191  DGDNGHRVQQQRMSDTRFLENGKYSYDVNTEKYVRDPYENSR  232



>ref|XP_011086042.1| PREDICTED: LOW QUALITY PROTEIN: protein E6-like [Sesamum indicum]
Length=282

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  531  NNGGAANR-FEQQGMSDTRFMENGRYYYDVNTEKYAR-HPYE  412
            NNGG AN  F+ QGMSDTRF+ENG+YYYDVNT+KY+  HPYE
Sbjct  191  NNGGEANYGFQPQGMSDTRFLENGKYYYDVNTDKYSSNHPYE  232



>ref|XP_009618543.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=497

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            EQQG+S TRF ENG+Y+YDVNTEKYA  PYENSR
Sbjct  434  EQQGISGTRFFENGKYFYDVNTEKYANDPYENSR  467



>dbj|BAM28759.1| ROX1 homologue [Nicotiana tabacum]
Length=346

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>dbj|BAM28758.1| ROX1 homologue [Nicotiana benthamiana]
Length=346

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>ref|XP_009757117.1| PREDICTED: protein E6 [Nicotiana sylvestris]
Length=346

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINGEKHARDPYENAR  306



>ref|XP_002279294.1| PREDICTED: protein E6 [Vitis vinifera]
 emb|CAN60306.1| hypothetical protein VITISV_005068 [Vitis vinifera]
Length=253

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ENGRYYYD+N+EK  R+ YENSR
Sbjct  172  KQQGMSDTRFLENGRYYYDLNSEKNYRNEYENSR  205



>ref|XP_009613470.1| PREDICTED: homeobox protein 2 [Nicotiana tomentosiformis]
Length=346

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>gb|ABH01084.1| putative ROX1 [Nicotiana tabacum]
Length=346

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>ref|XP_004232917.1| PREDICTED: homeobox protein 2-like [Solanum lycopersicum]
Length=342

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  271  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  304



>ref|XP_006364298.1| PREDICTED: protein E6-like [Solanum tuberosum]
Length=352

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  504  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  403
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  278  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  311



>ref|XP_011096354.1| PREDICTED: protein E6-like [Sesamum indicum]
Length=302

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = -3

Query  513  NRFEQQGMSDTRFMENGRYYYDVNTEKYAR-HPYENSR  403
            N FE QGMSDTR + NG+YYYD+NT +Y+R HPYE+ R
Sbjct  216  NGFEPQGMSDTRSVGNGKYYYDINTGRYSRNHPYESLR  253



>gb|EYU43374.1| hypothetical protein MIMGU_mgv1a012195mg [Erythranthe guttata]
Length=259

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = -3

Query  528  NGGAANRFEQQGMSDTRFMENGRYYYDVNTEKY-ARHPYENSR  403
            NGG   R   QGMSDTR +ENG+YYYD+NTEKY + HPYE  R
Sbjct  169  NGGEFRR--PQGMSDTRSLENGKYYYDLNTEKYNSNHPYERLR  209



>ref|XP_008225146.1| PREDICTED: protein E6 [Prunus mume]
Length=296

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = -3

Query  513  NRFEQQGMSDTRFMENGRYYYDVNTEK-YARHPYENSR  403
            N  E+QGMSDTRF+ENGRY+YD+ +EK Y ++ YENSR
Sbjct  224  NNAEKQGMSDTRFLENGRYHYDIGSEKNYNQNQYENSR  261



>gb|EPS61380.1| hypothetical protein M569_13417 [Genlisea aurea]
Length=246

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -3

Query  519  AANRFEQQGMSDTRFMENGRYYYDVNTEKY-ARHPYE  412
            AA  F+ QGMSDTR  +NG+Y+YDVN E++ + HPYE
Sbjct  168  AAGEFQPQGMSDTRAFQNGKYFYDVNAERFSSSHPYE  204



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200