BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049F02

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001288106.1|  D-xylose-proton symporter-like 2-like              178   3e-49   Solanum lycopersicum
ref|XP_006347568.1|  PREDICTED: D-xylose-proton symporter-like 2-...    178   4e-49   Solanum tuberosum [potatoes]
ref|XP_009777282.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    177   8e-49   Nicotiana sylvestris
ref|XP_009613870.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    176   9e-49   Nicotiana tomentosiformis
ref|XP_009777281.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    177   9e-49   Nicotiana sylvestris
emb|CDP04938.1|  unnamed protein product                                177   1e-48   Coffea canephora [robusta coffee]
ref|XP_009777280.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    177   2e-48   Nicotiana sylvestris
ref|XP_006443191.1|  hypothetical protein CICLE_v10019791mg             176   2e-48   Citrus clementina [clementine]
ref|XP_010492634.1|  PREDICTED: D-xylose-proton symporter-like 2        165   8e-48   Camelina sativa [gold-of-pleasure]
gb|AAF26115.1|AC012328_18  hypothetical protein                         170   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131530.1|  hypothetical protein PHAVU_011G020700g             172   3e-47   Phaseolus vulgaris [French bean]
ref|XP_006408343.1|  hypothetical protein EUTSA_v10020565mg             172   4e-47   Eutrema salsugineum [saltwater cress]
ref|XP_004137173.1|  PREDICTED: D-xylose-proton symporter-like 2-...    172   5e-47   Cucumis sativus [cucumbers]
emb|CDY43152.1|  BnaA05g32340D                                          172   6e-47   Brassica napus [oilseed rape]
ref|XP_010261641.1|  PREDICTED: D-xylose-proton symporter-like 2        170   8e-47   Nelumbo nucifera [Indian lotus]
emb|CDX92030.1|  BnaC03g33320D                                          172   9e-47   
emb|CDY49922.1|  BnaCnng18320D                                          171   1e-46   Brassica napus [oilseed rape]
ref|XP_008455658.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    170   1e-46   
ref|XP_009119042.1|  PREDICTED: D-xylose-proton symporter-like 1        171   1e-46   Brassica rapa
emb|CDY28736.1|  BnaCnng06220D                                          171   1e-46   Brassica napus [oilseed rape]
ref|XP_009130331.1|  PREDICTED: D-xylose-proton symporter-like 1        171   2e-46   Brassica rapa
emb|CDX92028.1|  BnaC03g33300D                                          170   2e-46   
ref|XP_009382608.1|  PREDICTED: D-xylose-proton symporter-like 2        170   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADP37177.1|  putative vacuolar glucose transporter                   169   4e-46   Vitis vinifera
gb|ABK95072.1|  unknown                                                 170   4e-46   Populus trichocarpa [western balsam poplar]
ref|NP_186959.2|  vacuolar glucose transporter 1                        170   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520022.1|  sugar transporter, putative                        169   5e-46   
gb|KDP21779.1|  hypothetical protein JCGZ_00566                         169   6e-46   Jatropha curcas
emb|CDX74227.1|  BnaA03g28200D                                          169   7e-46   
ref|XP_010662115.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    169   8e-46   Vitis vinifera
ref|XP_010489652.1|  PREDICTED: D-xylose-proton symporter-like 1        169   8e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008455657.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    169   8e-46   Cucumis melo [Oriental melon]
ref|XP_008234574.1|  PREDICTED: D-xylose-proton symporter-like 2        169   9e-46   Prunus mume [ume]
ref|XP_007029560.1|  Major facilitator superfamily protein              169   9e-46   
ref|XP_007219039.1|  hypothetical protein PRUPE_ppa004602mg             169   9e-46   Prunus persica
ref|XP_002277076.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    169   9e-46   Vitis vinifera
ref|XP_009134719.1|  PREDICTED: D-xylose-proton symporter-like 1        169   9e-46   Brassica rapa
ref|XP_011008112.1|  PREDICTED: D-xylose-proton symporter-like 2        169   1e-45   Populus euphratica
ref|XP_006590767.1|  PREDICTED: D-xylose-proton symporter-like 2-...    167   1e-45   
gb|EPS60345.1|  hypothetical protein M569_14457                         159   2e-45   Genlisea aurea
ref|XP_010463755.1|  PREDICTED: D-xylose-proton symporter-like 1        168   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010506301.1|  PREDICTED: D-xylose-proton symporter-like 1        168   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009351838.1|  PREDICTED: D-xylose-proton symporter-like 2        167   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_002884358.1|  sugar transporter family protein                   167   3e-45   
ref|XP_008362818.1|  PREDICTED: D-xylose-proton symporter-like 2        167   4e-45   Malus domestica [apple tree]
ref|XP_003540611.1|  PREDICTED: D-xylose-proton symporter-like 2-...    167   4e-45   Glycine max [soybeans]
gb|KHN46451.1|  D-xylose-proton symporter-like 2                        167   4e-45   Glycine soja [wild soybean]
gb|KFK37751.1|  hypothetical protein AALP_AA3G025300                    167   5e-45   Arabis alpina [alpine rockcress]
ref|NP_001065505.1|  Os10g0579200                                       167   5e-45   
gb|KHN05527.1|  D-xylose-proton symporter-like 2                        167   5e-45   Glycine soja [wild soybean]
ref|XP_003537722.1|  PREDICTED: D-xylose-proton symporter-like 2-...    167   5e-45   Glycine max [soybeans]
ref|XP_002873804.1|  sugar transporter family protein                   166   8e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_010558647.1|  PREDICTED: D-xylose-proton symporter-like 2        166   9e-45   Tarenaya hassleriana [spider flower]
gb|KJB26764.1|  hypothetical protein B456_004G258400                    166   1e-44   Gossypium raimondii
ref|XP_006662109.1|  PREDICTED: D-xylose-proton symporter-like 2-...    166   1e-44   Oryza brachyantha
ref|XP_010933396.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    166   2e-44   Elaeis guineensis
ref|XP_003607412.1|  D-xylose-proton symporter-like protein             165   2e-44   Medicago truncatula
ref|XP_009361176.1|  PREDICTED: D-xylose-proton symporter-like 2        165   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_006287575.1|  hypothetical protein CARUB_v10000784mg             165   2e-44   
ref|XP_004505609.1|  PREDICTED: D-xylose-proton symporter-like 2-...    165   2e-44   Cicer arietinum [garbanzo]
dbj|BAJ88105.1|  predicted protein                                      165   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010453878.1|  PREDICTED: D-xylose-proton symporter-like 2        164   3e-44   Camelina sativa [gold-of-pleasure]
ref|NP_850835.2|  D-xylose-proton symporter-like 2                      164   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EMS55132.1|  D-xylose-proton symporter-like 2                        164   4e-44   Triticum urartu
gb|EMT10196.1|  D-xylose-proton symporter-like protein 2                164   4e-44   
gb|KFK25925.1|  hypothetical protein AALP_AA8G181200                    164   5e-44   Arabis alpina [alpine rockcress]
gb|AFK39030.1|  unknown                                                 164   7e-44   Medicago truncatula
ref|XP_010420407.1|  PREDICTED: D-xylose-proton symporter-like 2        163   1e-43   Camelina sativa [gold-of-pleasure]
ref|NP_001141928.1|  uncharacterized protein LOC100274077               153   3e-43   
ref|XP_008791055.1|  PREDICTED: D-xylose-proton symporter-like 2        161   4e-43   
ref|XP_010671130.1|  PREDICTED: D-xylose-proton symporter-like 2        161   5e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004307871.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    161   7e-43   Fragaria vesca subsp. vesca
ref|XP_008376911.1|  PREDICTED: D-xylose-proton symporter-like 2        161   7e-43   Malus domestica [apple tree]
ref|XP_011470132.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    161   7e-43   Fragaria vesca subsp. vesca
ref|XP_010920045.1|  PREDICTED: D-xylose-proton symporter-like 2        161   8e-43   Elaeis guineensis
ref|XP_002464862.1|  hypothetical protein SORBIDRAFT_01g027800          160   1e-42   Sorghum bicolor [broomcorn]
ref|XP_008644913.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    160   1e-42   Zea mays [maize]
ref|XP_008644912.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    160   1e-42   Zea mays [maize]
gb|EYU43459.1|  hypothetical protein MIMGU_mgv1a004913mg                159   3e-42   Erythranthe guttata [common monkey flower]
ref|XP_002300123.2|  hypothetical protein POPTR_0001s25100g             159   5e-42   
ref|XP_010256836.1|  PREDICTED: D-xylose-proton symporter-like 3,...    159   5e-42   Nelumbo nucifera [Indian lotus]
ref|XP_003574402.1|  PREDICTED: D-xylose-proton symporter-like 2        159   6e-42   Brachypodium distachyon [annual false brome]
ref|XP_010685696.1|  PREDICTED: D-xylose-proton symporter-like 3,...    159   6e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW67123.1|  hypothetical protein ZEAMMB73_874760                    154   7e-42   
ref|XP_008809219.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    158   1e-41   
ref|NP_001287653.1|  D-xylose-proton symporter-like 3, chloroplas...    158   1e-41   Solanum lycopersicum
dbj|BAH19966.1|  AT5G59250                                              156   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463619.1|  hypothetical protein SORBIDRAFT_01g003010          152   1e-41   
ref|XP_006342314.1|  PREDICTED: D-xylose-proton symporter-like 3,...    158   1e-41   Solanum tuberosum [potatoes]
ref|XP_006279761.1|  hypothetical protein CARUB_v10027739mg             157   2e-41   Capsella rubella
gb|KDO39943.1|  hypothetical protein CISIN_1g0102391mg                  156   2e-41   Citrus sinensis [apfelsine]
ref|XP_010106537.1|  D-xylose-proton symporter-like 3                   156   3e-41   
ref|XP_009605730.1|  PREDICTED: D-xylose-proton symporter-like 3,...    157   3e-41   Nicotiana tomentosiformis
ref|XP_009779936.1|  PREDICTED: D-xylose-proton symporter-like 3,...    157   3e-41   Nicotiana sylvestris
gb|ABB17074.1|  putative sugar transporter                              157   4e-41   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_010454633.1|  PREDICTED: D-xylose-proton symporter-like 3,...    157   4e-41   Camelina sativa [gold-of-pleasure]
gb|KDO39944.1|  hypothetical protein CISIN_1g0102391mg                  156   4e-41   Citrus sinensis [apfelsine]
ref|XP_011035266.1|  PREDICTED: D-xylose-proton symporter-like 3,...    156   5e-41   Populus euphratica
emb|CDY54245.1|  BnaC09g53840D                                          156   5e-41   Brassica napus [oilseed rape]
emb|CDY33006.1|  BnaA10g12120D                                          156   5e-41   Brassica napus [oilseed rape]
ref|XP_011035268.1|  PREDICTED: D-xylose-proton symporter-like 3,...    156   6e-41   Populus euphratica
ref|XP_002866311.1|  hypothetical protein ARALYDRAFT_919128             156   6e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_009120413.1|  PREDICTED: D-xylose-proton symporter-like 3,...    156   6e-41   Brassica rapa
ref|XP_010535452.1|  PREDICTED: D-xylose-proton symporter-like 3,...    156   7e-41   Tarenaya hassleriana [spider flower]
dbj|BAE98379.1|  D-xylose-H+ symporter - like protein                   156   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483521.1|  PREDICTED: D-xylose-proton symporter-like 3,...    156   7e-41   Camelina sativa [gold-of-pleasure]
ref|NP_200733.2|  Major facilitator superfamily protein                 156   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443656.1|  PREDICTED: D-xylose-proton symporter-like 3,...    156   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004309072.1|  PREDICTED: D-xylose-proton symporter-like 2        155   1e-40   Fragaria vesca subsp. vesca
gb|KJB20004.1|  hypothetical protein B456_003G129000                    155   1e-40   Gossypium raimondii
ref|XP_006401006.1|  hypothetical protein EUTSA_v10013139mg             155   2e-40   Eutrema salsugineum [saltwater cress]
ref|NP_001173691.1|  Os03g0823200                                       151   2e-40   
ref|XP_007016336.1|  Major facilitator superfamily protein isoform 1    155   2e-40   
gb|KJB20000.1|  hypothetical protein B456_003G129000                    155   2e-40   Gossypium raimondii
ref|XP_011075803.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    154   4e-40   Sesamum indicum [beniseed]
ref|XP_011075802.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    154   4e-40   
ref|XP_008681531.1|  PREDICTED: uncharacterized protein LOC100274...    153   7e-40   
ref|XP_008681530.1|  PREDICTED: uncharacterized protein LOC100274...    153   7e-40   Zea mays [maize]
gb|ABK24923.1|  unknown                                                 153   9e-40   Picea sitchensis
gb|KDP42213.1|  hypothetical protein JCGZ_02943                         152   2e-39   Jatropha curcas
ref|XP_006651969.1|  PREDICTED: D-xylose-proton symporter-like 3,...    151   3e-39   Oryza brachyantha
ref|XP_006846330.1|  hypothetical protein AMTR_s00012p00255880          152   3e-39   Amborella trichopoda
ref|XP_006854111.1|  hypothetical protein AMTR_s00048p00147550          151   3e-39   Amborella trichopoda
ref|XP_010043498.1|  PREDICTED: D-xylose-proton symporter-like 3,...    151   4e-39   Eucalyptus grandis [rose gum]
gb|EEE60202.1|  hypothetical protein OsJ_13164                          150   4e-39   Oryza sativa Japonica Group [Japonica rice]
gb|AAO18445.1|  putative sugar transporter protein                      150   6e-39   Oryza sativa Japonica Group [Japonica rice]
gb|ABF99614.1|  sugar transporter family protein, putative, expre...    150   9e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76432.1|  hypothetical protein OsI_14118                          150   1e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_002520519.1|  sugar transporter, putative                        149   2e-38   
ref|XP_009381068.1|  PREDICTED: D-xylose-proton symporter-like 3,...    149   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007132040.1|  hypothetical protein PHAVU_011G061800g             149   2e-38   Phaseolus vulgaris [French bean]
ref|XP_004981232.1|  PREDICTED: D-xylose-proton symporter-like 3,...    149   2e-38   Setaria italica
emb|CDP09100.1|  unnamed protein product                                149   2e-38   Coffea canephora [robusta coffee]
ref|XP_008777375.1|  PREDICTED: D-xylose-proton symporter-like 3,...    149   3e-38   Phoenix dactylifera
ref|XP_003537973.1|  PREDICTED: D-xylose-proton symporter-like 3,...    149   3e-38   Glycine max [soybeans]
gb|KHN21925.1|  D-xylose-proton symporter-like 3, chloroplastic         149   3e-38   Glycine soja [wild soybean]
gb|AFK37407.1|  unknown                                                 148   4e-38   Lotus japonicus
ref|XP_009126155.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    148   4e-38   Brassica rapa
emb|CDX85478.1|  BnaA02g03350D                                          148   4e-38   
ref|XP_006400240.1|  hypothetical protein EUTSA_v10013319mg             148   4e-38   Eutrema salsugineum [saltwater cress]
ref|XP_009126154.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    148   5e-38   Brassica rapa
ref|XP_003539594.1|  PREDICTED: D-xylose-proton symporter-like 3,...    148   6e-38   Glycine max [soybeans]
gb|KHN32151.1|  D-xylose-proton symporter-like 3, chloroplastic         148   6e-38   Glycine soja [wild soybean]
dbj|BAJ95036.1|  predicted protein                                      147   8e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN72732.1|  hypothetical protein VITISV_037854                     146   1e-37   Vitis vinifera
ref|XP_010087486.1|  D-xylose-proton symporter-like 2                   145   3e-37   
ref|XP_004173923.1|  PREDICTED: D-xylose-proton symporter-like 3,...    138   5e-37   
ref|XP_004170091.1|  PREDICTED: D-xylose-proton symporter-like 2-...    144   5e-37   
ref|XP_003563522.2|  PREDICTED: D-xylose-proton symporter-like 3,...    145   6e-37   Brachypodium distachyon [annual false brome]
emb|CDY38076.1|  BnaC02g06970D                                          144   7e-37   Brassica napus [oilseed rape]
ref|XP_010907806.1|  PREDICTED: D-xylose-proton symporter-like 3,...    144   8e-37   Elaeis guineensis
gb|KJB26763.1|  hypothetical protein B456_004G258400                    144   1e-36   Gossypium raimondii
ref|XP_006297488.1|  hypothetical protein CARUB_v10013506mg             144   2e-36   Capsella rubella
ref|XP_011089518.1|  PREDICTED: D-xylose-proton symporter-like 3,...    142   5e-36   Sesamum indicum [beniseed]
ref|XP_004294661.1|  PREDICTED: D-xylose-proton symporter-like 3,...    141   1e-35   Fragaria vesca subsp. vesca
gb|EYU45952.1|  hypothetical protein MIMGU_mgv1a003885mg                141   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_008349595.1|  PREDICTED: D-xylose-proton symporter-like 3,...    139   1e-34   
ref|XP_008384924.1|  PREDICTED: D-xylose-proton symporter-like 3,...    139   1e-34   
ref|XP_010063233.1|  PREDICTED: D-xylose-proton symporter-like 2        138   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010535453.1|  PREDICTED: D-xylose-proton symporter-like 3,...    138   2e-34   Tarenaya hassleriana [spider flower]
gb|EPS59382.1|  hypothetical protein M569_15426                         137   2e-34   Genlisea aurea
ref|XP_006424896.1|  hypothetical protein CICLE_v10028127mg             137   2e-34   
gb|KDO66622.1|  hypothetical protein CISIN_1g008624mg                   137   3e-34   Citrus sinensis [apfelsine]
gb|KDO66620.1|  hypothetical protein CISIN_1g008624mg                   137   3e-34   Citrus sinensis [apfelsine]
ref|XP_009375941.1|  PREDICTED: D-xylose-proton symporter-like 3,...    137   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_008457451.1|  PREDICTED: D-xylose-proton symporter-like 3,...    137   4e-34   Cucumis melo [Oriental melon]
emb|CBI16087.3|  unnamed protein product                                137   4e-34   Vitis vinifera
ref|XP_002280634.1|  PREDICTED: D-xylose-proton symporter-like 3,...    137   5e-34   Vitis vinifera
ref|XP_004145283.1|  PREDICTED: D-xylose-proton symporter-like 3,...    137   5e-34   
ref|XP_006424897.1|  hypothetical protein CICLE_v10028127mg             137   5e-34   Citrus clementina [clementine]
ref|XP_002982112.1|  hypothetical protein SELMODRAFT_115745             136   6e-34   
gb|KHG28803.1|  hypothetical protein F383_00413                         136   6e-34   Gossypium arboreum [tree cotton]
ref|XP_006488379.1|  PREDICTED: D-xylose-proton symporter-like 3,...    136   7e-34   
gb|KDO66619.1|  hypothetical protein CISIN_1g008624mg                   136   7e-34   Citrus sinensis [apfelsine]
ref|XP_006488378.1|  PREDICTED: D-xylose-proton symporter-like 3,...    136   7e-34   Citrus sinensis [apfelsine]
gb|KDO66618.1|  hypothetical protein CISIN_1g008624mg                   136   7e-34   Citrus sinensis [apfelsine]
ref|XP_002991559.1|  hypothetical protein SELMODRAFT_133784             135   7e-34   
ref|XP_008222111.1|  PREDICTED: D-xylose-proton symporter-like 3,...    136   8e-34   Prunus mume [ume]
ref|XP_008222102.1|  PREDICTED: D-xylose-proton symporter-like 3,...    136   1e-33   Prunus mume [ume]
ref|XP_007207311.1|  hypothetical protein PRUPE_ppa003611mg             135   1e-33   Prunus persica
ref|XP_004983521.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    135   1e-33   
ref|XP_002992213.1|  hypothetical protein SELMODRAFT_134982             135   2e-33   
ref|XP_001773171.1|  predicted protein                                  130   5e-32   
ref|XP_001760396.1|  predicted protein                                  129   4e-31   
ref|XP_007016337.1|  Major facilitator superfamily protein isoform 2    127   8e-31   
emb|CAN83894.1|  hypothetical protein VITISV_039113                     122   1e-28   Vitis vinifera
ref|NP_001190323.1|  D-xylose-proton symporter-like 2                   114   4e-26   
ref|XP_010933397.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    113   8e-26   
ref|XP_006424895.1|  hypothetical protein CICLE_v10028127mg             109   4e-24   
gb|KDO66623.1|  hypothetical protein CISIN_1g008624mg                   108   7e-24   Citrus sinensis [apfelsine]
ref|XP_005845570.1|  hypothetical protein CHLNCDRAFT_25635              106   4e-23   Chlorella variabilis
gb|KEH30181.1|  monosaccharide-H+ symporter                           90.5    7e-20   Medicago truncatula
emb|CBJ33077.1|  conserved unknown protein                            95.9    2e-19   Ectocarpus siliculosus
ref|XP_011400947.1|  D-xylose-proton symporter-like 3, chloroplastic  94.7    6e-19   Auxenochlorella protothecoides
ref|WP_022247679.1|  sugar transporter                                93.2    1e-18   
ref|XP_005831465.1|  hypothetical protein GUITHDRAFT_109605           91.7    3e-18   Guillardia theta CCMP2712
ref|NP_197203.1|  D-xylose-proton symporter-like 2                    91.7    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005783754.1|  hypothetical protein EMIHUDRAFT_232111           90.5    1e-17   Emiliania huxleyi CCMP1516
ref|WP_013644894.1|  major facilitator transporter                    89.4    3e-17   Methanobacterium lacus
ref|XP_005708849.1|  MFS transporter, SP family, sugar:H+ symporter   89.0    7e-17   Galdieria sulphuraria
ref|WP_022187653.1|  sugar transporter                                86.7    3e-16   
gb|EWM26836.1|  d-xylose-proton symporter-like protein                87.4    3e-16   Nannochloropsis gaditana
gb|EKD53804.1|  hypothetical protein ACD_60C00149G0003                85.5    7e-16   uncultured bacterium
ref|WP_022021988.1|  sugar transporter                                83.2    4e-15   
ref|WP_022491563.1|  metabolite transport protein                     81.6    5e-15   
ref|WP_022486233.1|  sugar transporter                                82.8    5e-15   
ref|WP_025318950.1|  major facilitator transporter                    82.0    1e-14   Granulibacter bethesdensis
gb|KIZ01781.1|  hypothetical protein MNEG_6180                        82.4    1e-14   Monoraphidium neglectum
ref|WP_022196350.1|  putative metabolite transport protein ywtG       81.6    1e-14   
ref|WP_022006956.1|  d-xylose-proton symporter                        80.9    3e-14   
ref|WP_011631971.1|  major facilitator transporter                    80.5    3e-14   Granulibacter bethesdensis
ref|WP_025286678.1|  major facilitator transporter                    80.5    3e-14   Granulibacter bethesdensis
ref|WP_025320564.1|  major facilitator transporter                    80.1    4e-14   Granulibacter bethesdensis
ref|XP_007510995.1|  predicted protein                                80.1    6e-14   Bathycoccus prasinos
ref|XP_003062688.1|  major facilitator superfamily                    79.3    9e-14   Micromonas pusilla CCMP1545
ref|XP_001416926.1|  MFS family transporter: sugar (galactose/glu...  79.3    1e-13   Ostreococcus lucimarinus CCE9901
gb|ACJ18943.1|  D-xylose-proton symporter                             78.2    2e-13   Coxiella burnetii CbuG_Q212
ref|WP_011997243.1|  major facilitator transporter                    78.6    2e-13   Coxiella burnetii
gb|ACJ19821.1|  D-xylose-proton symporter                             78.2    2e-13   Coxiella burnetii CbuK_Q154
ref|WP_005772424.1|  major facilitator transporter                    78.2    2e-13   Coxiella burnetii
ref|WP_032138490.1|  major facilitator transporter                    78.2    2e-13   Coxiella burnetii
gb|EKE01224.1|  hypothetical protein ACD_21C00189G0006                78.2    2e-13   uncultured bacterium
ref|WP_005769170.1|  major facilitator transporter                    78.2    2e-13   Coxiella burnetii
ref|WP_021863576.1|  sugar transporter                                78.2    2e-13   
ref|XP_002179486.1|  TRD4                                             77.8    3e-13   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002501745.1|  sugar transporter                                77.8    3e-13   Micromonas commoda
ref|WP_007429069.1|  MFS transporter                                  77.4    4e-13   Paenibacillus sp. Aloe-11
ref|WP_034935483.1|  hypothetical protein                             77.4    4e-13   Erwinia mallotivora
gb|EKE10022.1|  sugar transporter                                     74.3    4e-13   uncultured bacterium
ref|WP_042531766.1|  major facilitator transporter                    77.4    4e-13   Oceanobacillus oncorhynchi
ref|WP_035532302.1|  major facilitator transporter                    77.0    5e-13   Halobacillus kuroshimensis
ref|WP_044786399.1|  MFS transporter                                  77.0    6e-13   Paenibacillus
ref|WP_016821403.1|  MULTISPECIES: MFS transporter                    77.0    6e-13   Paenibacillus
ref|WP_019686308.1|  MFS transporter                                  76.6    6e-13   Paenibacillus polymyxa
ref|WP_013369675.1|  MFS transporter                                  76.6    6e-13   Paenibacillus
ref|WP_025675784.1|  MFS transporter                                  76.6    6e-13   Paenibacillus
ref|WP_025722405.1|  MFS transporter                                  76.6    7e-13   Paenibacillus polymyxa
ref|WP_023987284.1|  MFS transporter                                  76.6    7e-13   Paenibacillus
ref|WP_036581666.1|  MFS transporter                                  76.6    7e-13   Paenibacillus darwinianus
ref|WP_028543212.1|  MFS transporter                                  76.6    7e-13   Paenibacillus
ref|WP_014280112.1|  MFS transporter                                  76.3    8e-13   Paenibacillus terrae
ref|WP_029516079.1|  MFS transporter                                  76.3    9e-13   Paenibacillus polymyxa
ref|XP_005645204.1|  hypothetical protein COCSUDRAFT_67173            76.6    9e-13   Coccomyxa subellipsoidea C-169
ref|WP_017577029.1|  hypothetical protein                             75.9    1e-12   Nocardiopsis kunsanensis
ref|WP_036621919.1|  MFS transporter                                  75.5    2e-12   Paenibacillus macerans
ref|WP_037344745.1|  major facilitator transporter                    75.5    2e-12   
gb|EKD46018.1|  hypothetical protein ACD_69C00046G0001                75.5    2e-12   uncultured bacterium
ref|XP_003971733.1|  PREDICTED: solute carrier family 2, facilita...  75.5    2e-12   
ref|WP_010641003.1|  major facilitator transporter                    75.1    2e-12   Acidithiobacillus thiooxidans
ref|WP_031572590.1|  major facilitator transporter                    75.1    2e-12   Acidithiobacillus thiooxidans
ref|WP_024893136.1|  major facilitator transporter                    75.1    2e-12   Acidithiobacillus thiooxidans
ref|WP_017611217.1|  hypothetical protein                             75.1    2e-12   Nocardiopsis xinjiangensis
ref|WP_013309023.1|  MFS transporter                                  75.1    3e-12   Paenibacillus polymyxa
emb|CEF97100.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcompl...  75.1    3e-12   Ostreococcus tauri
ref|WP_008494377.1|  major facilitator transporter                    74.7    3e-12   
ref|WP_018661922.1|  major facilitator transporter                    74.7    3e-12   Bacillus acidiproducens
ref|WP_041017256.1|  major facilitator transporter                    74.7    3e-12   Criblamydia sequanensis
emb|CAG09092.1|  unnamed protein product                              74.3    3e-12   Tetraodon nigroviridis
emb|CDR33502.1|  putative D-xylose-proton symporter                   74.7    3e-12   Criblamydia sequanensis CRIB-18
ref|WP_020429182.1|  hypothetical protein                             72.4    3e-12   
ref|WP_021946815.1|  d-xylose-proton symporter                        74.3    3e-12   
ref|WP_037346870.1|  major facilitator transporter                    74.3    4e-12   Sciscionella sp. SE31
ref|WP_020500425.1|  hypothetical protein                             73.9    5e-12   Sciscionella marina
ref|WP_009951262.1|  major facilitator transporter                    73.9    5e-12   Saccharopolyspora erythraea
ref|XP_002185301.1|  predicted protein                                73.9    6e-12   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_014866604.1|  major facilitator transporter                    73.9    6e-12   Methanoculleus bourgensis
gb|EHD13189.1|  sugar porter family MFS transporter                   73.9    6e-12   Commensalibacter intestini A911
ref|WP_040364358.1|  major facilitator transporter                    73.9    6e-12   Commensalibacter intestini
ref|WP_018699802.1|  hypothetical protein                             73.6    7e-12   Amorphus coralli
ref|WP_026439736.1|  major facilitator transporter                    73.6    7e-12   
ref|WP_041339107.1|  major facilitator transporter                    73.6    8e-12   Rubrobacter radiotolerans
ref|WP_004915014.1|  major facilitator transporter                    73.6    8e-12   Leuconostoc
ref|XP_009036253.1|  general sugar transporter                        73.6    8e-12   Aureococcus anophagefferens
ref|WP_038674510.1|  major facilitator transporter                    73.2    9e-12   Pelosinus sp. UFO1
gb|AIF54149.1|  sugar transporter                                     73.2    9e-12   Pelosinus sp. UFO1
ref|WP_024816367.1|  major facilitator transporter                    73.2    1e-11   Methylopila sp. 73B
ref|WP_035356541.1|  sugar transporter                                73.2    1e-11   Edaphobacter aggregans
ref|WP_039793159.1|  MFS transporter                                  73.2    1e-11   
ref|XP_011429027.1|  PREDICTED: solute carrier family 2, facilita...  73.6    1e-11   Crassostrea gigas
ref|WP_027699342.1|  major facilitator transporter                    73.2    1e-11   
ref|WP_020448594.1|  D-xylose-proton symporter                        73.2    1e-11   
ref|WP_044698574.1|  D-xylose transporter XylE                        70.1    1e-11   
ref|WP_007693086.1|  sugar transporter                                70.1    1e-11   
gb|EDP46643.1|  D-xylose-proton symporter                             72.8    1e-11   
ref|WP_040615275.1|  major facilitator transporter                    72.8    1e-11   
ref|XP_006625953.1|  PREDICTED: solute carrier family 2, facilita...  73.2    1e-11   
ref|WP_035187416.1|  major facilitator transporter                    72.8    1e-11   
ref|WP_007424295.1|  MULTISPECIES: major facilitator transporter      72.8    1e-11   
ref|WP_031564035.1|  hypothetical protein                             72.8    1e-11   
ref|XP_008301674.1|  PREDICTED: solute carrier family 2, facilita...  72.8    1e-11   
ref|WP_008415726.1|  major facilitator transporter                    72.8    2e-11   
ref|WP_013924234.1|  major facilitator transporter                    72.4    2e-11   
gb|KFM72443.1|  Solute carrier family 2, facilitated glucose tran...  70.5    2e-11   
ref|XP_002606343.1|  hypothetical protein BRAFLDRAFT_67586            72.8    2e-11   
ref|WP_034338388.1|  major facilitator transporter                    72.4    2e-11   
ref|WP_025849336.1|  MFS transporter                                  72.4    2e-11   
ref|WP_010282438.1|  major facilitator transporter                    72.0    2e-11   
ref|XP_010737643.1|  PREDICTED: solute carrier family 2, facilita...  72.4    2e-11   
ref|WP_043735154.1|  major facilitator transporter                    72.0    2e-11   
ref|WP_021037475.1|  D-xylose-proton symporter                        72.0    2e-11   
ref|WP_036745963.1|  major facilitator transporter                    72.0    2e-11   
ref|WP_035944149.1|  major facilitator transporter                    72.0    2e-11   
ref|WP_043236249.1|  sugar transporter                                72.0    3e-11   
gb|EFB42172.1|  hypothetical protein pah_c014o100                     72.0    3e-11   
ref|WP_020529689.1|  hypothetical protein                             72.0    3e-11   
ref|XP_001986495.1|  GH21392                                          72.4    3e-11   
ref|WP_005119931.1|  sugar (and other) transporter family protein     70.1    3e-11   
gb|EQX91462.1|  D-xylose-proton symporter                             70.1    3e-11   
ref|XP_006812575.1|  PREDICTED: solute carrier family 2, facilita...  72.0    3e-11   
gb|KDD76485.1|  sugar transporter                                     72.0    3e-11   
ref|WP_039838550.1|  MFS transporter                                  71.6    3e-11   
ref|XP_001959931.1|  GF13114                                          72.0    4e-11   
ref|WP_036579412.1|  major facilitator transporter                    71.6    4e-11   
ref|WP_015321733.1|  MFS transporter, sugar porter family             71.6    4e-11   
ref|WP_026475378.1|  major facilitator transporter                    71.2    4e-11   
sp|B3MG58.2|TRET1_DROAN  RecName: Full=Facilitated trehalose tran...  72.0    4e-11   
ref|WP_044813239.1|  D-xylose transporter XylE                        69.7    4e-11   
gb|EFP73175.1|  D-xylose-proton symporter                             69.3    4e-11   
ref|WP_018300862.1|  hypothetical protein                             71.2    5e-11   
ref|XP_002006426.1|  GI18572                                          71.6    5e-11   
ref|WP_042748938.1|  major facilitator transporter                    70.9    5e-11   
gb|EFW61830.1|  D-xylose proton-symporter XylE                        69.3    5e-11   
sp|B4KR05.2|TRET1_DROMO  RecName: Full=Facilitated trehalose tran...  71.6    5e-11   
gb|EIQ55161.1|  sugar (and other) transporter family protein          68.9    5e-11   
ref|WP_000374291.1|  D-xylose transporter                             69.3    5e-11   
ref|XP_005174792.1|  PREDICTED: facilitated trehalose transporter...  71.6    6e-11   
ref|XP_008335627.1|  PREDICTED: solute carrier family 2, facilita...  71.2    6e-11   
gb|EMZ36099.1|  sugar porter (SP) family MFS transporter              70.9    6e-11   
ref|WP_000086371.1|  hypothetical protein                             68.9    6e-11   
gb|EGW79604.1|  arabinose-proton symporter                            70.1    6e-11   
ref|WP_036685129.1|  MFS transporter                                  70.9    6e-11   
ref|WP_032330506.1|  MULTISPECIES: D-xylose transporter XylE          69.3    6e-11   
ref|XP_783766.3|  PREDICTED: solute carrier family 2, facilitated...  70.9    6e-11   
ref|WP_019395380.1|  MULTISPECIES: hypothetical protein               70.9    6e-11   
ref|WP_010347529.1|  MFS transporter                                  70.9    6e-11   
ref|WP_044215183.1|  MULTISPECIES: major facilitator transporter      70.9    6e-11   
gb|EGW78839.1|  arabinose-proton symporter                            70.1    6e-11   
ref|WP_034640102.1|  major facilitator transporter                    70.9    7e-11   
gb|EFI90602.1|  transporter, major facilitator family protein         68.9    7e-11   
ref|XP_009043387.1|  general solute carrier protein                   68.2    7e-11   
gb|AHA68349.1|  D-xylose-proton symporter                             69.3    7e-11   
ref|WP_039065387.1|  MULTISPECIES: D-xylose transporter XylE          68.9    7e-11   
gb|EZA12963.1|  D-xylose transporter XylE                             69.3    7e-11   
gb|EGJ82535.1|  arabinose-proton symporter                            70.1    7e-11   
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1         69.7    7e-11   
ref|XP_005914413.1|  PREDICTED: solute carrier family 2, facilita...  70.9    8e-11   
ref|WP_010374961.1|  major facilitator transporter                    70.5    8e-11   
ref|XP_004541992.1|  PREDICTED: solute carrier family 2, facilita...  70.9    8e-11   
ref|WP_044067240.1|  D-xylose transporter XylE                        69.3    8e-11   
ref|WP_032359687.1|  D-xylose transporter XylE                        69.3    8e-11   
ref|WP_022078476.1|  sugar transporter                                70.5    8e-11   
ref|WP_029311639.1|  major facilitator transporter                    70.5    8e-11   
ref|WP_010664370.1|  major facilitator transporter                    70.5    8e-11   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6         70.5    9e-11   
ref|WP_014106469.1|  D-galactose transporter                          70.5    9e-11   
ref|WP_032335888.1|  D-xylose transporter XylE                        68.9    9e-11   
ref|WP_019234073.1|  hypothetical protein                             70.1    9e-11   
ref|WP_043707797.1|  major facilitator transporter                    70.1    9e-11   
ref|XP_010527602.1|  PREDICTED: polyol transporter 5-like             67.0    1e-10   
gb|KDE57191.1|  major facilitator transporter                         70.1    1e-10   
ref|XP_003440771.2|  PREDICTED: solute carrier family 2, facilita...  70.5    1e-10   
gb|EHO53142.1|  hypothetical protein HMPREF9104_00707                 67.4    1e-10   
gb|ESE05157.1|  MFS transporter, SP family                            69.3    1e-10   
gb|EJL11115.1|  MFS transporter, sugar porter family protein          69.3    1e-10   
gb|EGW84708.1|  arabinose-proton symporter                            69.3    1e-10   
ref|WP_032233957.1|  D-xylose transporter XylE                        69.3    1e-10   
ref|WP_022899947.1|  major facilitator transporter                    70.1    1e-10   
gb|AEU36570.1|  sugar transporter                                     70.1    1e-10   
ref|XP_005800347.1|  PREDICTED: solute carrier family 2, facilita...  70.1    1e-10   
ref|WP_042346593.1|  D-xylose transporter XylE                        69.7    1e-10   
ref|WP_033900986.1|  major facilitator transporter                    70.1    1e-10   
ref|XP_006797246.1|  PREDICTED: solute carrier family 2, facilita...  70.1    1e-10   
ref|WP_040470988.1|  hypothetical protein                             67.4    1e-10   
ref|WP_036593689.1|  sugar transporter                                69.7    1e-10   
emb|CDG05332.1|  D-xylose proton-symporter                            69.7    1e-10   
ref|WP_044178408.1|  sugar transporter                                69.7    1e-10   
ref|WP_024176397.1|  D-xylose transporter XylE                        69.3    1e-10   
ref|WP_042046693.1|  D-xylose transporter XylE                        69.3    1e-10   
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like             70.1    1e-10   
ref|WP_032946960.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_003666501.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_032345145.1|  D-xylose transporter XylE                        69.7    1e-10   
ref|XP_008396179.1|  PREDICTED: solute carrier family 2, facilita...  70.1    1e-10   
ref|WP_035334185.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_029344056.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_015426662.1|  D-xylose proton-symporter                        69.7    1e-10   
ref|WP_012898121.1|  major facilitator transporter                    69.7    1e-10   
ref|XP_007553023.1|  PREDICTED: solute carrier family 2, facilita...  70.1    1e-10   
ref|XP_005154807.1|  PREDICTED: solute carrier family 2, facilita...  70.1    1e-10   
ref|XP_002514303.1|  sugar transporter, putative                      69.7    1e-10   
ref|XP_010881386.1|  PREDICTED: solute carrier family 2, facilita...  70.1    1e-10   
ref|WP_007741012.1|  sugar transporter                                69.7    1e-10   
ref|WP_044820166.1|  hypothetical protein                             66.2    1e-10   
ref|WP_044009698.1|  major facilitator transporter                    69.7    1e-10   
ref|WP_018754345.1|  MFS transporter                                  69.7    1e-10   
emb|CDL26356.1|  D-xylose proton-symporter XylE                       69.7    1e-10   
ref|WP_032096136.1|  MULTISPECIES: major facilitator transporter      69.7    2e-10   
ref|WP_019251315.1|  major facilitator transporter                    69.7    2e-10   
ref|WP_012907708.1|  D-xylose transporter                             69.7    2e-10   
dbj|GAK98049.1|  D-xylose proton-symporter ZylE                       69.3    2e-10   
gb|KGT10376.1|  D-xylose transporter XylE                             69.7    2e-10   
ref|WP_041576361.1|  sugar transporter                                69.3    2e-10   
ref|WP_001339148.1|  D-xylose transporter                             69.3    2e-10   
ref|WP_041585888.1|  sugar transporter                                69.3    2e-10   
ref|WP_001097271.1|  D-xylose transporter                             69.7    2e-10   
gb|KGT18006.1|  D-xylose transporter XylE                             69.7    2e-10   
ref|XP_002066107.1|  GK22112                                          70.1    2e-10   
ref|WP_001097262.1|  D-xylose transporter                             69.7    2e-10   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like             69.7    2e-10   
ref|WP_001474831.1|  MFS transporter, sugar porter family protein     69.7    2e-10   
ref|WP_001097260.1|  D-xylose transporter                             69.7    2e-10   
gb|ADV81310.1|  sugar transporter                                     69.3    2e-10   
ref|WP_032268539.1|  D-xylose transporter XylE                        69.7    2e-10   
ref|WP_001472706.1|  MFS transporter, sugar porter family protein     69.3    2e-10   
ref|WP_001508179.1|  MFS transporter, sugar porter family protein     69.3    2e-10   
ref|WP_001097286.1|  D-xylose transporter                             69.3    2e-10   
ref|WP_001097278.1|  D-xylose transporter                             69.3    2e-10   
ref|WP_001478563.1|  MFS transporter, sugar porter family protein     69.3    2e-10   
ref|WP_001395158.1|  MFS transporter, sugar porter family protein     69.3    2e-10   
ref|WP_001715885.1|  MFS transporter, sugar porter family protein     69.3    2e-10   
ref|WP_001709463.1|  MFS transporter, sugar porter family protein     69.3    2e-10   
ref|WP_005043038.1|  sugar transporter                                69.3    2e-10   
ref|WP_001097267.1|  D-xylose transporter                             69.3    2e-10   
ref|WP_001097261.1|  D-xylose transporter                             69.3    2e-10   
gb|ABS66075.1|  sugar transporter                                     69.3    2e-10   
ref|WP_039059949.1|  D-xylose transporter XylE                        69.3    2e-10   
ref|XP_002050122.1|  GJ20366                                          70.1    2e-10   
ref|WP_001388756.1|  MFS transporter, sugar porter family protein     69.3    2e-10   
ref|WP_014096118.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_010801280.1|  MULTISPECIES: sugar porter (SP) family MFS t...  69.3    2e-10   
ref|WP_001097259.1|  D-xylose transporter                             69.3    2e-10   
sp|B4LPX5.2|TRET1_DROVI  RecName: Full=Facilitated trehalose tran...  70.1    2e-10   
ref|WP_032717438.1|  MFS sugar transporter                            69.3    2e-10   
ref|WP_017261050.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_028551479.1|  MFS transporter                                  69.3    2e-10   
ref|XP_004992344.1|  hypothetical protein PTSG_06943                  69.3    2e-10   
ref|WP_025748920.1|  D-xylose transporter XylE                        69.3    2e-10   
ref|WP_015584353.1|  sugar transporter                                69.3    2e-10   
ref|WP_044346672.1|  MFS sugar transporter                            69.3    2e-10   
ref|WP_001097282.1|  D-xylose transporter                             69.3    2e-10   
ref|WP_026684983.1|  major facilitator transporter                    69.3    2e-10   
ref|WP_009860594.1|  MFS transporter                                  69.3    2e-10   
ref|WP_001097284.1|  D-xylose transporter                             69.3    2e-10   
ref|WP_009184975.1|  MFS transporter                                  69.3    2e-10   
ref|WP_032724722.1|  MFS sugar transporter                            69.3    2e-10   
gb|KIZ46811.1|  MFS sugar transporter                                 69.3    2e-10   
ref|WP_020708717.1|  hypothetical protein                             69.3    2e-10   
ref|WP_033395728.1|  MFS transporter                                  69.3    2e-10   
ref|WP_032181547.1|  D-xylose transporter XylE                        68.9    2e-10   
gb|KDT64056.1|  MFS transporter, sugar porter family protein          68.9    2e-10   
ref|WP_044724522.1|  D-xylose transporter XylE                        68.9    2e-10   
ref|WP_013551213.1|  major facilitator transporter                    68.9    2e-10   
ref|WP_032284872.1|  D-xylose transporter XylE                        68.9    2e-10   
gb|AAL38359.1|  sugar transporter protein                             67.0    2e-10   
ref|WP_024256320.1|  D-xylose transporter XylE                        68.9    2e-10   
ref|WP_032259642.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_020089467.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_038346854.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_000445063.1|  D-xylose transporter                             68.9    3e-10   
ref|WP_040072992.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_042531779.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_001097289.1|  MULTISPECIES: D-xylose transporter               68.9    3e-10   
ref|XP_002016109.1|  GL11419                                          69.3    3e-10   
ref|WP_006053328.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_044068929.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_032238490.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_001097292.1|  D-xylose transporter                             68.9    3e-10   
emb|CDK71018.1|  D-xylose proton-symporter XylE                       68.9    3e-10   
ref|WP_024233906.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|XP_006663074.1|  PREDICTED: sugar transporter ERD6-like 16-like   68.9    3e-10   
sp|Q291H8.3|TRET1_DROPS  RecName: Full=Facilitated trehalose tran...  69.3    3e-10   
sp|B4GAP7.2|TRET1_DROPE  RecName: Full=Facilitated trehalose tran...  69.3    3e-10   
ref|WP_042005652.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_032270354.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_001097250.1|  D-xylose transporter                             68.9    3e-10   
ref|XP_001360559.2|  GA15593                                          69.3    3e-10   
ref|WP_004052122.1|  sugar transporter                                68.9    3e-10   
ref|WP_033557592.1|  D-xylose transporter XylE                        68.9    3e-10   
dbj|GAF38781.1|  D-xylose proton-symporter XylT                       65.5    3e-10   
ref|WP_024230813.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_001097263.1|  MULTISPECIES: D-xylose transporter               68.9    3e-10   
ref|WP_001097253.1|  D-xylose transporter                             68.9    3e-10   
gb|KFI00677.1|  D-xylose transporter XylE                             68.9    3e-10   
ref|WP_000107424.1|  D-xylose transporter                             68.9    3e-10   
ref|WP_001097255.1|  D-xylose transporter                             68.9    3e-10   
ref|WP_023281605.1|  D-xylose-proton symporter                        68.9    3e-10   
ref|WP_021547240.1|  D-xylose-proton symporter                        68.9    3e-10   
ref|WP_032249949.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_001097274.1|  MULTISPECIES: D-xylose transporter               68.9    3e-10   
ref|WP_032279264.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_024246563.1|  D-xylose transporter XylE                        68.9    3e-10   
ref|WP_013942808.1|  putative metabolite transport protein ywtG       68.6    3e-10   
gb|KGM76771.1|  D-xylose transporter                                  68.9    3e-10   
ref|WP_032319157.1|  D-xylose transporter XylE                        68.9    3e-10   
pdb|4QIQ|A  Chain A, Crystal Structure Of D-xylose-proton Symporter   68.9    3e-10   
ref|WP_020222463.1|  hypothetical protein                             68.2    3e-10   
ref|WP_042280007.1|  major facilitator transporter                    68.9    3e-10   
ref|WP_037546042.1|  hypothetical protein                             68.6    3e-10   
gb|KGP40537.1|  D-xylose transporter XylE                             68.9    3e-10   
ref|WP_040078940.1|  D-xylose transporter XylE                        68.6    3e-10   



>ref|NP_001288106.1| D-xylose-proton symporter-like 2-like [Solanum lycopersicum]
 dbj|BAO96239.1| vacuolar glucose transporter 2 [Solanum lycopersicum]
Length=503

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLLGSYYTFL +VP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  378  VSGIAMSLFLLGSYYTFLGDVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI VLVNFG NALV FAFSP+++L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEE
Sbjct  438  LSITVLVNFGANALVAFAFSPLQDLLGAGTVFFIFGGIAVLSLVFIFFIIPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAKYL
Sbjct  498  IEAKYL  503



>ref|XP_006347568.1| PREDICTED: D-xylose-proton symporter-like 2-like [Solanum tuberosum]
Length=503

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLLGSYYTFL +VP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  378  VSGIAMSLFLLGSYYTFLGDVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI VLVNFG NALV FAFSP+++L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEE
Sbjct  438  LSITVLVNFGANALVAFAFSPLQDLLGAGTVFFIFGGIAVLSLVFIFFIIPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAKYL
Sbjct  498  IEAKYL  503



>ref|XP_009777282.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009777283.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
Length=498

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  373  VSGIAISLFLLGSYYTYLGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  432

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI+VLVNFG NALV FAFSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEE
Sbjct  433  LSISVLVNFGANALVAFAFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEE  492

Query  230  IEAKYL  213
            IEAKYL
Sbjct  493  IEAKYL  498



>ref|XP_009613870.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Nicotiana tomentosiformis]
Length=462

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  337  VSGIAISLFLLGSYYTYLGNVPAVAVSALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  396

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI+VLVNFG NALV F+FSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEE
Sbjct  397  LSISVLVNFGANALVAFSFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEE  456

Query  230  IEAKYL  213
            IEAKYL
Sbjct  457  IEAKYL  462



>ref|XP_009777281.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Nicotiana 
sylvestris]
Length=508

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  383  VSGIAISLFLLGSYYTYLGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  442

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI+VLVNFG NALV FAFSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEE
Sbjct  443  LSISVLVNFGANALVAFAFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEE  502

Query  230  IEAKYL  213
            IEAKYL
Sbjct  503  IEAKYL  508



>emb|CDP04938.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYYTFLD+VP VAV+ LLLYVGCYQLSFGPIGWLMISEIFPLR RGRG
Sbjct  389  VSGMVISLFLLGSYYTFLDDVPAVAVVGLLLYVGCYQLSFGPIGWLMISEIFPLRSRGRG  448

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+++LVGAG VFFIFG IAV++VIF+FF++PETKGLTLEE
Sbjct  449  LSIAVLVNFGANALVTFAFSPLEDLVGAGVVFFIFGGIAVLSVIFIFFVVPETKGLTLEE  508

Query  230  IEAKYL  213
            IEAK L
Sbjct  509  IEAKLL  514



>ref|XP_009777280.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Nicotiana 
sylvestris]
Length=555

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLLGSYYT+L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  430  VSGIAISLFLLGSYYTYLGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  489

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI+VLVNFG NALV FAFSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEE
Sbjct  490  LSISVLVNFGANALVAFAFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEE  549

Query  230  IEAKYL  213
            IEAKYL
Sbjct  550  IEAKYL  555



>ref|XP_006443191.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 ref|XP_006478911.1| PREDICTED: D-xylose-proton symporter-like 2-like [Citrus sinensis]
 gb|ESR56431.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=506

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  381  VSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  440

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+K+L+GAG +F+ FGVIAV+++ F+FFI+PETKGLTLEE
Sbjct  441  LSVAVLVNFGANALVTFAFSPLKDLLGAGILFYAFGVIAVLSLAFIFFIVPETKGLTLEE  500

Query  230  IEAKYL  213
            IEAK L
Sbjct  501  IEAKCL  506



>ref|XP_010492634.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=147

 Score =   165 bits (417),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  22   VGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  81

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V+++ F+FFI+PETKGL+LEE
Sbjct  82   LSLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVLSLFFIFFIVPETKGLSLEE  141

Query  230  IEAKYL  213
            IEAK L
Sbjct  142  IEAKCL  147



>gb|AAF26115.1|AC012328_18 hypothetical protein [Arabidopsis thaliana]
Length=342

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F  NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  217  VSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  276

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI VV++ F+++I+PETKGLTLEE
Sbjct  277  ISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSLFFIYYIVPETKGLTLEE  336

Query  230  IEAKYL  213
            IEAK L
Sbjct  337  IEAKCL  342



>ref|XP_007131530.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
 gb|ESW03524.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
Length=498

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY FLDN P VAV+ LLLYVGCYQ+SFGPIGWLMI+EIFPLR+RGRG
Sbjct  373  VSGMVISLFLLGSYYVFLDNAPVVAVVGLLLYVGCYQISFGPIGWLMIAEIFPLRLRGRG  432

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L IAVLVNFG NALVTFAFSP+KEL+GAG +F+IF VIAV ++ F++ ++PETKGLTLEE
Sbjct  433  LGIAVLVNFGANALVTFAFSPLKELLGAGILFYIFCVIAVASLAFIYLVVPETKGLTLEE  492

Query  230  IEAKYL  213
            IEAK L
Sbjct  493  IEAKCL  498



>ref|XP_006408343.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
 gb|ESQ49796.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
Length=502

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ V+LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VSGMVVSLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI V+++ F++FI+PETKGLTLEE
Sbjct  437  ISIAVLVNFGTNALVTFAFSPLKELLGAGVLFSGFGVICVLSLFFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_004137173.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cucumis sativus]
 gb|KGN53693.1| hypothetical protein Csa_4G106860 [Cucumis sativus]
Length=502

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  377  VSGITISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+KEL+GAG +FFIFGV+A+++++F+FFI+PETKGLTLEE
Sbjct  437  LSIAVLVNFGANALVTFAFSPLKELLGAGILFFIFGVVAILSLVFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEA+ L
Sbjct  497  IEARCL  502



>emb|CDY43152.1| BnaA05g32340D [Brassica napus]
Length=504

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  379  VSGMMISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  438

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI VV++ F++FI+PETKGLTLEE
Sbjct  439  ISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVVSLFFIYFIVPETKGLTLEE  498

Query  230  IEAKYL  213
            IEAK L
Sbjct  499  IEAKCL  504



>ref|XP_010261641.1| PREDICTED: D-xylose-proton symporter-like 2, partial [Nelumbo 
nucifera]
Length=429

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLL +YYTFL+N P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  304  VSGIVISLFLLAAYYTFLNNAPFVAVVALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRG  363

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTFAFSP++ L+GAG +F +FGVI+V++++F+FFI+PETKGL+LEE
Sbjct  364  LSIAVLVNFASNALVTFAFSPLESLIGAGMLFVVFGVISVLSLLFIFFIVPETKGLSLEE  423

Query  230  IEAKYL  213
            IEAK L
Sbjct  424  IEAKIL  429



>emb|CDX92030.1| BnaC03g33320D [Brassica napus]
Length=502

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFPL++RGRG
Sbjct  377  VSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSPMKEL+GAG +F  FG I V+++ F++FI+PETKGLTLEE
Sbjct  437  ISIAVLVNFGTNALVTFAFSPMKELLGAGVLFCGFGAICVLSLFFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>emb|CDY49922.1| BnaCnng18320D [Brassica napus]
Length=503

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  378  VSGMVISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL GAG +FF FGVI V+++ F++FI+PETKGLTLEE
Sbjct  438  ISIAVLVNFGTNALVTFAFSPLKELFGAGVLFFGFGVICVLSLFFIYFIVPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAK L
Sbjct  498  IEAKCL  503



>ref|XP_008455658.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Cucumis 
melo]
Length=408

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  283  VFGIVISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVFPLRLRGRG  342

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+KEL+GAG +FFIFGV+A+++++F+FFI+PETKGLTLEE
Sbjct  343  LSIAVLVNFGANALVTFAFSPLKELLGAGILFFIFGVVAILSLVFIFFIVPETKGLTLEE  402

Query  230  IEAKYL  213
            IEA+ L
Sbjct  403  IEARCL  408



>ref|XP_009119042.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
 emb|CDY23466.1| BnaC04g49940D [Brassica napus]
Length=503

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  378  VSGMVISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL GAG +FF FGVI V+++ F++FI+PETKGLTLEE
Sbjct  438  ISIAVLVNFGTNALVTFAFSPLKELFGAGVLFFGFGVICVLSLFFIYFIVPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAK L
Sbjct  498  IEAKCL  503



>emb|CDY28736.1| BnaCnng06220D [Brassica napus]
Length=503

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F   VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  378  VSGMMISLFLLGSYYIFYTTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI VV++ F++FI+PETKGLTLEE
Sbjct  438  ISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVVSLFFIYFIVPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAK L
Sbjct  498  IEAKCL  503



>ref|XP_009130331.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=504

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  379  VSGMMISLFLLGSYYIFYNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  438

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI VV++ F++FI+PETKGLTLEE
Sbjct  439  ISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVVSLFFIYFIVPETKGLTLEE  498

Query  230  IEAKYL  213
            IE+K L
Sbjct  499  IESKCL  504



>emb|CDX92028.1| BnaC03g33300D [Brassica napus]
Length=480

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFPL++RGRG
Sbjct  355  VSGMVLSLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFPLKLRGRG  414

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  FGVI V+++ F++FI+PETKGLTLEE
Sbjct  415  ISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVLSLFFIYFIVPETKGLTLEE  474

Query  230  IEAKYL  213
            IEAK L
Sbjct  475  IEAKCL  480



>ref|XP_009382608.1| PREDICTED: D-xylose-proton symporter-like 2 [Musa acuminata subsp. 
malaccensis]
Length=498

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL SYYT L+++P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  373  VSGIAISLFLLSSYYTLLNSLPSVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRG  432

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTFAFSP++ LVG G +F  FGVIA+ +++F+FFI+PETKGLTLEE
Sbjct  433  LSIAVLVNFASNALVTFAFSPLETLVGTGVLFAGFGVIAISSLLFIFFIVPETKGLTLEE  492

Query  230  IEAKYL  213
            IEAK L
Sbjct  493  IEAKIL  498



>gb|ADP37177.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=453

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  328  VSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  387

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NA+VTF+FSP+K L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEE
Sbjct  388  LSIAVLVNFGANAIVTFSFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEE  447

Query  230  IEAKYL  213
            IEAK L
Sbjct  448  IEAKLL  453



>gb|ABK95072.1| unknown [Populus trichocarpa]
Length=502

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY FLDN P VAV ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  377  VSGMVISLFLLGSYYIFLDNAPVVAVAALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L IAVLVNFG NALVTF FSP+K L+GAG +F+ FGVIAVV+++F+FFI+PETKGLTLEE
Sbjct  437  LGIAVLVNFGANALVTFTFSPLKALLGAGILFYAFGVIAVVSLLFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|NP_186959.2| vacuolar glucose transporter 1 [Arabidopsis thaliana]
 sp|Q8L6Z8.1|XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1 [Arabidopsis thaliana]
 gb|AAM98195.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56818.1| At3g03090 [Arabidopsis thaliana]
 gb|AEE73900.1| vacuolar glucose transporter 1 [Arabidopsis thaliana]
Length=503

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F  NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  378  VSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI VV++ F+++I+PETKGLTLEE
Sbjct  438  ISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSLFFIYYIVPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAK L
Sbjct  498  IEAKCL  503



>ref|XP_002520022.1| sugar transporter, putative [Ricinus communis]
 gb|EEF42346.1| sugar transporter, putative [Ricinus communis]
Length=502

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLLGSYY FL++VP VAV+ALLLYVGCYQ SFGPIGWLMISEIFPLR+RGR 
Sbjct  377  VSGMAISLFLLGSYYRFLNDVPAVAVVALLLYVGCYQFSFGPIGWLMISEIFPLRLRGRA  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L IAVLVNFG NA+VTFAFSP+K L+GAG +F+ FGVI+VV+++F+FF++PETKGLTLEE
Sbjct  437  LGIAVLVNFGANAIVTFAFSPLKALIGAGILFYGFGVISVVSLLFIFFVVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>gb|KDP21779.1| hypothetical protein JCGZ_00566 [Jatropha curcas]
Length=501

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY FLDN P VAV ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  376  VSGMVISLFLLGSYYLFLDNAPFVAVAALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+K  +GAG +F+ FGVI +++++F+FFI+PETKGLTLEE
Sbjct  436  LSIAVLVNFGANALVTFAFSPLKAWLGAGILFYAFGVIGILSLLFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>emb|CDX74227.1| BnaA03g28200D [Brassica napus]
Length=483

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFL+GSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFPL++RGRG
Sbjct  358  VSGMVLSLFLMGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFPLKLRGRG  417

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PETKGLTLEE
Sbjct  418  ISIAVLVNFGTNALVTFAFSPLKELLGAGILFCVFGVICVLSLFFIYFIVPETKGLTLEE  477

Query  230  IEAKYL  213
            IEAK L
Sbjct  478  IEAKCL  483



>ref|XP_010662115.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Vitis 
vinifera]
Length=493

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  368  VSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  427

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NA+VTF+FSP+K L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEE
Sbjct  428  LSIAVLVNFGANAIVTFSFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEE  487

Query  230  IEAKYL  213
            IEAK L
Sbjct  488  IEAKLL  493



>ref|XP_010489652.1| PREDICTED: D-xylose-proton symporter-like 1, partial [Camelina 
sativa]
Length=469

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  344  VSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  403

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI V+++ F++FI+PETKGLTLEE
Sbjct  404  ISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICVLSLFFIYFIVPETKGLTLEE  463

Query  230  IEAKYL  213
            IEAK L
Sbjct  464  IEAKCL  469



>ref|XP_008455657.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Cucumis 
melo]
Length=502

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  377  VFGIVISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+KEL+GAG +FFIFGV+A+++++F+FFI+PETKGLTLEE
Sbjct  437  LSIAVLVNFGANALVTFAFSPLKELLGAGILFFIFGVVAILSLVFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEA+ L
Sbjct  497  IEARCL  502



>ref|XP_008234574.1| PREDICTED: D-xylose-proton symporter-like 2 [Prunus mume]
Length=500

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  375  VSGMVISLFLLGSYYLFFDNAPVAAVVALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRG  434

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP+K L+GAG +F++FG IAV +++F+FFI+PETKGLTLEE
Sbjct  435  LSIAVLVNFAANALVTFAFSPLKVLLGAGILFYVFGAIAVASLVFIFFIVPETKGLTLEE  494

Query  230  IEAKYL  213
            IEAK L
Sbjct  495  IEAKCL  500



>ref|XP_007029560.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY10062.1| Major facilitator superfamily protein [Theobroma cacao]
Length=501

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ V+LFLLGSYY FLD+VP +AV ALLLYVGCYQLSFGPIGWLMISE+FPLR RGRG
Sbjct  376  VSGMVVSLFLLGSYYLFLDDVPAIAVAALLLYVGCYQLSFGPIGWLMISEVFPLRHRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP++  +GAG VF++FGVIA+++++F+FFI+PETKGLTLEE
Sbjct  436  LSIAVLVNFGANALVTFAFSPLEAWLGAGIVFYVFGVIAMLSLLFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_007219039.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
 gb|EMJ20238.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
Length=500

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  375  VSGMVISLFLLGSYYLFFDNAPIAAVVALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRG  434

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP+K L+GAG +F+ FG IAV +++F+FFI+PETKGLTLEE
Sbjct  435  LSIAVLVNFAANALVTFAFSPLKVLLGAGILFYAFGAIAVASLVFIFFIVPETKGLTLEE  494

Query  230  IEAKYL  213
            IEAK L
Sbjct  495  IEAKCL  500



>ref|XP_002277076.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Vitis 
vinifera]
 emb|CBI26530.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  375  VSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  434

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NA+VTF+FSP+K L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEE
Sbjct  435  LSIAVLVNFGANAIVTFSFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEE  494

Query  230  IEAKYL  213
            IEAK L
Sbjct  495  IEAKLL  500



>ref|XP_009134719.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=502

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFL+GSYY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFPL++RGRG
Sbjct  377  VSGMVLSLFLMGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVLVNFGTNALVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PETKGLTLEE
Sbjct  437  ISIAVLVNFGTNALVTFAFSPLKELLGAGILFCVFGVICVLSLFFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_011008112.1| PREDICTED: D-xylose-proton symporter-like 2 [Populus euphratica]
Length=502

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY FLD+ P VAV ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  377  VSGMVISLFLLGSYYIFLDDAPVVAVAALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L IAVLVNFG NALVTF FSP+K L+GAG +F++F  IAVV+++F+FFI+PETKGLTLEE
Sbjct  437  LGIAVLVNFGANALVTFTFSPLKALLGAGILFYVFAAIAVVSLLFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_006590767.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X2 [Glycine 
max]
Length=435

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LF LGSYY FLDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRG
Sbjct  310  VSGIVISLFFLGSYYIFLDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRG  369

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+K L+GAG +F+ F VIAV +++F++F+IPETKGLTLEE
Sbjct  370  LSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPETKGLTLEE  429

Query  230  IEAKYL  213
            IEAK L
Sbjct  430  IEAKCL  435



>gb|EPS60345.1| hypothetical protein M569_14457, partial [Genlisea aurea]
Length=153

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI V+LFLLGSYY F D  P +AV ALL+YVG YQ+SFGPIGWLMISEIFPL +RGRG
Sbjct  30   VSGIVVSLFLLGSYYAFFDQAPGLAVFALLVYVGSYQVSFGPIGWLMISEIFPLCLRGRG  89

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI VLVNFG NA+VT AFSP++ELVGAG VFF FGV+AV+++ F+F ++PETKGLTLEE
Sbjct  90   LSIVVLVNFGANAVVTLAFSPLQELVGAGAVFFAFGVVAVLSLAFIFSVVPETKGLTLEE  149

Query  230  IEAK  219
            IEAK
Sbjct  150  IEAK  153



>ref|XP_010463755.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=498

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  373  VSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  432

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI V+++ F++FI+PETKGLTLEE
Sbjct  433  ISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICVLSLFFIYFIVPETKGLTLEE  492

Query  230  IEAKYL  213
            IEAK L
Sbjct  493  IEAKCL  498



>ref|XP_010506301.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=502

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F +NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI V+++ F++FI+PETKGLTLEE
Sbjct  437  ISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICVLSLFFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_009351838.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V+G+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQ+SFGPIGWLMISEIFPLR+RGRG
Sbjct  376  VTGMVISLFLLGSYYLFFDNAPVAAVVALLLYVGCYQISFGPIGWLMISEIFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP+K L+GAG +F++FG IAV +++F+FFI+PETKGLTLEE
Sbjct  436  LSIAVLVNFAANALVTFAFSPLKALLGAGILFYVFGAIAVASLVFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_002884358.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60617.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F   VP VAV ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  376  VSGMVISLFLLGSYYMFYKTVPAVAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI VV++ F+++I+PETKGLTLEE
Sbjct  436  ISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSLFFIYYIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_008362818.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V+G+ ++LFLLGSYY F DN P  AV+ALLLYVGCYQ+SFGPIGWLMISEIFPLR+RGRG
Sbjct  376  VTGMVISLFLLGSYYLFFDNAPVAAVVALLLYVGCYQISFGPIGWLMISEIFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP+K L+GAG +F+ FG IAV +++F+FFI+PETKGLTLEE
Sbjct  436  LSIAVLVNFAANALVTFAFSPLKALLGAGILFYGFGAIAVASLVFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_003540611.1| PREDICTED: D-xylose-proton symporter-like 2-like [Glycine max]
Length=497

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LF LGSYY FLDN P VAV+ LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRG
Sbjct  372  VSGIVISLFFLGSYYIFLDNTPVVAVVGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRG  431

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+K L+GAG +F+ FGVIAV +++F++ +IPETKGLTLEE
Sbjct  432  LSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFGVIAVTSLVFIYLVIPETKGLTLEE  491

Query  230  IEAKYL  213
            IEAK L
Sbjct  492  IEAKCL  497



>gb|KHN46451.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=497

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LF LGSYY FLDN P VAV+ LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRG
Sbjct  372  VSGIVISLFFLGSYYIFLDNTPVVAVVGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRG  431

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+K L+GAG +F+ FGVIAV +++F++ +IPETKGLTLEE
Sbjct  432  LSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFGVIAVTSLVFIYLVIPETKGLTLEE  491

Query  230  IEAKYL  213
            IEAK L
Sbjct  492  IEAKCL  497



>gb|KFK37751.1| hypothetical protein AALP_AA3G025300 [Arabis alpina]
Length=503

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ +ALFLLGSYY F   VP VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR+RGRG
Sbjct  378  VSGMVIALFLLGSYYIFYHTVPAVAVGALLLYVGCYQISFGPISWLMLSEIFPLRLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVLVNFGTNALVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PETKGLTLEE
Sbjct  438  ISLAVLVNFGTNALVTFAFSPLKELLGAGVLFCVFGVICVLSLFFIYFIVPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAK L
Sbjct  498  IEAKCL  503



>ref|NP_001065505.1| Os10g0579200 [Oryza sativa Japonica Group]
 gb|AAG46179.1|AC018727_31 putative sugar transporter protein [Oryza sativa Japonica Group]
 gb|AAP55176.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27342.1| Os10g0579200 [Oryza sativa Japonica Group]
 dbj|BAG95336.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67505.1| hypothetical protein OsI_34793 [Oryza sativa Indica Group]
 gb|EEE51468.1| hypothetical protein OsJ_32598 [Oryza sativa Japonica Group]
Length=502

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAV+LFLL SYYT L + P VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  378  VSGIAVSLFLLSSYYTLLKDAPYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV +++F+FFI+PETKGLTLEE
Sbjct  438  LSIAVLVNFASNALVTFAFSPLEDLIGTGILFSAFGVIAVASLVFIFFIVPETKGLTLEE  497

Query  230  IEAK  219
            IEA 
Sbjct  498  IEAS  501



>gb|KHN05527.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=501

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LF LGSYY FLDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRG
Sbjct  376  VSGIVISLFFLGSYYIFLDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+K L+GAG +F+ F VIAV +++F++F+IPETKGLTLEE
Sbjct  436  LSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_003537722.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X1 [Glycine 
max]
Length=501

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LF LGSYY FLDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRG
Sbjct  376  VSGIVISLFFLGSYYIFLDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+K L+GAG +F+ F VIAV +++F++F+IPETKGLTLEE
Sbjct  436  LSIAVLVNFGANALVTFAFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_002873804.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50063.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VSGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PETKGLTLEE
Sbjct  437  LSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSLVFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_010558647.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
 ref|XP_010558648.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
Length=501

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ V+LFLLGSYY F  +   VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  376  VSGMGVSLFLLGSYYIFFGDASSVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP+KE++GAG +F+ FGVI +++++F+FFI+PETKGLTLEE
Sbjct  436  LSIAVLVNFGANALVTFAFSPLKEMLGAGILFYGFGVICLLSLLFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>gb|KJB26764.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=501

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY FLD++  +AV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  376  VSGMVISLFLLGSYYLFLDDLAAIAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+K  +GAG VF++FGVIAV++++F+FFI+PETKGLTLEE
Sbjct  436  LSVAVLVNFGANALVTFAFSPLKAWLGAGIVFYVFGVIAVLSLVFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IE K L
Sbjct  496  IEVKCL  501



>ref|XP_006662109.1| PREDICTED: D-xylose-proton symporter-like 2-like [Oryza brachyantha]
Length=500

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAV+LFLL SYYT L + P VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  376  VSGIAVSLFLLSSYYTLLKDAPYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV +++F+F I+PETKGLTLEE
Sbjct  436  LSIAVLVNFASNALVTFAFSPLEDLIGTGILFCGFGVIAVASLVFIFCIVPETKGLTLEE  495

Query  230  IEAK  219
            IEA 
Sbjct  496  IEAS  499



>ref|XP_010933396.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLL SYYT L + P VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  376  VSGIVISLFLLSSYYTLLKDSPFVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTFAFSP++ LVG G +F  FGVIAV +++F+FF++PETKGLTLEE
Sbjct  436  LSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGVIAVASLLFIFFVVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKIL  501



>ref|XP_003607412.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 ref|XP_003607415.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 gb|AES89609.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=501

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FLDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIFPLR+RG+G
Sbjct  376  VSGIVISLFLLGSYYIFLDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIFPLRLRGKG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP+K+L+GAG +F+IF  IAV +++F++FI+PETKGLTLEE
Sbjct  436  LSIAVLVNFAANALVTFAFSPLKDLLGAGILFYIFSAIAVASLVFIYFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_009361176.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V+G+ ++LFLLGSYY F D+ P  AV+AL+LYVGCYQ+SFGPIGWLMISEIFPLR+RGRG
Sbjct  376  VTGMVISLFLLGSYYLFFDDAPVAAVVALMLYVGCYQISFGPIGWLMISEIFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP+K L+GAG +F++FGVIAV +++F+FFI+PETKGLTLEE
Sbjct  436  LSIAVLVNFAANALVTFAFSPLKALLGAGILFYVFGVIAVASLLFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_006287575.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
 gb|EOA20473.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
Length=502

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PETKGLTLEE
Sbjct  437  LSLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVLSLLFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_004505609.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cicer arietinum]
Length=502

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FLDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIFPLR+RGRG
Sbjct  377  VSGIVISLFLLGSYYIFLDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP+K+L+GAG +F+IF  IAV +++F++FI+PETKGLTLEE
Sbjct  437  LSIAVLVNFTANALVTFAFSPLKDLLGAGILFYIFCAIAVASLVFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>dbj|BAJ88105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAV+LFLL SYYT     P VAVIALLLYVGCYQLSFGPIGWLMISE+FPL++RGRG
Sbjct  371  VSGIAVSLFLLSSYYTLFTGAPYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLKLRGRG  430

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F I+PETKGLTLEE
Sbjct  431  LSVAVLVNFASNALVTFAFSPLEDLIGTGVLFASFGVIAVASLAFIFCIVPETKGLTLEE  490

Query  230  IEAK  219
            IEAK
Sbjct  491  IEAK  494



>ref|XP_010453878.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453879.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453880.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453881.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NA+VTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PETKGLTLEE
Sbjct  437  LSLAVLVNFGANAIVTFAFSPLKELLGAGILFCAFGVICVLSLVFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|NP_850835.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 ref|NP_850836.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 sp|Q6AWX0.1|XYLL2_ARATH RecName: Full=D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AAT85724.1| At5g17010 [Arabidopsis thaliana]
 dbj|BAF00329.1| sugar transporter like protein [Arabidopsis thaliana]
 gb|AED92369.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92370.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=503

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  378  VGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+FFI+PETKGLTLEE
Sbjct  438  LSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSLVFIFFIVPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAK L
Sbjct  498  IEAKCL  503



>gb|EMS55132.1| D-xylose-proton symporter-like 2 [Triticum urartu]
Length=495

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAV+LFLL SYYT     P VAVIALLLYVGCYQLSFGPIGWLMISE+FPL++RGRG
Sbjct  371  VSGIAVSLFLLSSYYTLFTGAPYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLKLRGRG  430

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F I+PETKGLTLEE
Sbjct  431  LSVAVLVNFASNALVTFAFSPLEDLIGTGVLFASFGVIAVASLAFIFCIVPETKGLTLEE  490

Query  230  IEAK  219
            IEAK
Sbjct  491  IEAK  494



>gb|EMT10196.1| D-xylose-proton symporter-like protein 2 [Aegilops tauschii]
Length=524

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAV+LFLL SYYT     P VAVIALLLYVGCYQLSFGPIGWLMISE+FPL++RGRG
Sbjct  400  VSGIAVSLFLLSSYYTLFTGAPYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLKLRGRG  459

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F I+PETKGLTLEE
Sbjct  460  LSVAVLVNFASNALVTFAFSPLEDLIGTGVLFASFGVIAVASLAFIFCIVPETKGLTLEE  519

Query  230  IEAK  219
            IEAK
Sbjct  520  IEAK  523



>gb|KFK25925.1| hypothetical protein AALP_AA8G181200 [Arabis alpina]
Length=504

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  379  VGGMVVSLFLLGSYYIFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  438

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NA+VTF+FSP+KEL+GAG +FF FGVI V++++F+FFI+PETKGLTLEE
Sbjct  439  LSIAVLVNFGANAIVTFSFSPLKELLGAGILFFGFGVICVLSLVFIFFIVPETKGLTLEE  498

Query  230  IEAKYL  213
            IEAK L
Sbjct  499  IEAKCL  504



>gb|AFK39030.1| unknown [Medicago truncatula]
Length=501

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FLDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIFPLR+RG+G
Sbjct  376  VSGIVISLFLLGSYYIFLDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIFPLRLRGKG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAV VNF  NALVTFAFSP+K+L+GAG +F+IF  IAV +++F++FI+PETKGLTLEE
Sbjct  436  LSIAVFVNFAANALVTFAFSPLKDLLGAGILFYIFSAIAVASLVFIYFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKCL  501



>ref|XP_010420407.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420408.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420410.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420411.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWL+ISEIFPL++RGRG
Sbjct  377  VGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLIISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V+++ F+FFI+PETKGLTLEE
Sbjct  437  LSLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVLSLFFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|NP_001141928.1| uncharacterized protein LOC100274077 [Zea mays]
 gb|ACF87321.1| unknown [Zea mays]
Length=148

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  22   VGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRG  81

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PETKGL+LEE
Sbjct  82   ISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPETKGLSLEE  141

Query  230  IEAKYL  213
            IE+K L
Sbjct  142  IESKIL  147



>ref|XP_008791055.1| PREDICTED: D-xylose-proton symporter-like 2 [Phoenix dactylifera]
Length=475

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VS IA++LFLL SYYT L++ P VAVIALLLYVGCYQLSFGPIGWL+ISE+FPLR+RGR 
Sbjct  350  VSWIAISLFLLSSYYTLLNDSPFVAVIALLLYVGCYQLSFGPIGWLLISEVFPLRLRGRA  409

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTFAFSP++ LVG G +F  FGVIAV A++F+FF+IPETKGLTLEE
Sbjct  410  LSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGVIAVGALLFIFFVIPETKGLTLEE  469

Query  230  IEAKYL  213
            IEAK L
Sbjct  470  IEAKIL  475



>ref|XP_010671130.1| PREDICTED: D-xylose-proton symporter-like 2 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++L  LG+YYTFL + P +AV+ LLLYVGCYQLS+GPIGWLMISEIFPLR+RGRG
Sbjct  378  VSGMVISLLFLGAYYTFLGDAPAIAVVGLLLYVGCYQLSYGPIGWLMISEIFPLRMRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL+NFG NALVTFAFSP+K+L+GAG VFF+FG IAV++++F+FFIIPETKGLTLEE
Sbjct  438  ISLAVLMNFGANALVTFAFSPLKDLIGAGAVFFMFGGIAVLSLVFIFFIIPETKGLTLEE  497

Query  230  IEA  222
            IEA
Sbjct  498  IEA  500



>ref|XP_004307871.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F D+ P VAVIALL YVGCYQ SFGPIGWLMISEIFPLR+RGRG
Sbjct  372  VSGMVISLFLLGSYYLFFDDTPAVAVIALLAYVGCYQFSFGPIGWLMISEIFPLRLRGRG  431

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTF+FSP++  +GAG VF+IFG IAV +++F+FFI+PETKGLTLEE
Sbjct  432  LSIAVLVNFAANALVTFSFSPLEAWLGAGIVFYIFGAIAVASLVFIFFIVPETKGLTLEE  491

Query  230  IEAK  219
            IE K
Sbjct  492  IETK  495



>ref|XP_008376911.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V+G+ ++LFLLGSYY F D+ P  AV+ALLLYVGCYQ+SFGPIGWLMISE+FPLR+RGRG
Sbjct  376  VTGMVISLFLLGSYYLFFDDAPVAAVVALLLYVGCYQISFGPIGWLMISEVFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L IAVLVNF  NALVTFAFSP+K L+GAG +F+ FGVIAV ++ F+FFI+PETKGLTLEE
Sbjct  436  LGIAVLVNFAANALVTFAFSPLKALLGAGILFYAFGVIAVASLFFIFFIVPETKGLTLEE  495

Query  230  IEAKYL  213
            IEA  L
Sbjct  496  IEANCL  501



>ref|XP_011470132.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=495

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY F D+ P VAVIALL YVGCYQ SFGPIGWLMISEIFPLR+RGRG
Sbjct  370  VSGMVISLFLLGSYYLFFDDTPAVAVIALLAYVGCYQFSFGPIGWLMISEIFPLRLRGRG  429

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTF+FSP++  +GAG VF+IFG IAV +++F+FFI+PETKGLTLEE
Sbjct  430  LSIAVLVNFAANALVTFSFSPLEAWLGAGIVFYIFGAIAVASLVFIFFIVPETKGLTLEE  489

Query  230  IEAK  219
            IE K
Sbjct  490  IETK  493



>ref|XP_010920045.1| PREDICTED: D-xylose-proton symporter-like 2 [Elaeis guineensis]
Length=501

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VS I ++LFLL SYYT L++ P VAVIALLLYVGCYQLSFGPIGWL+ISE+FPLR+RGRG
Sbjct  376  VSWIVISLFLLSSYYTLLNDSPFVAVIALLLYVGCYQLSFGPIGWLLISEVFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTFAFSP++ LVG G +F  FG+IAV A++F+FF+IPETKGLTLEE
Sbjct  436  LSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGIIAVAALLFIFFVIPETKGLTLEE  495

Query  230  IEAKYL  213
            IEAK L
Sbjct  496  IEAKIL  501



>ref|XP_002464862.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
 gb|EER91860.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
Length=511

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI VALFLL SYYT L +   VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  387  VSGITVALFLLSSYYTLLKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  446

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L +AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F+I+PETKGLTLEE
Sbjct  447  LGVAVLVNFASNALVTFAFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPETKGLTLEE  506

Query  230  IEAK  219
            IEA 
Sbjct  507  IEAS  510



>ref|XP_008644913.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Zea mays]
 gb|AFW69044.1| hypothetical protein ZEAMMB73_344214 [Zea mays]
Length=517

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI VALFLL SYYT L +   VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  393  VSGITVALFLLSSYYTLLKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  452

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L +AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F+I+PETKGLTLEE
Sbjct  453  LGVAVLVNFASNALVTFAFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPETKGLTLEE  512

Query  230  IEAK  219
            IEA 
Sbjct  513  IEAS  516



>ref|XP_008644912.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Zea mays]
Length=518

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI VALFLL SYYT L +   VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  394  VSGITVALFLLSSYYTLLKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  453

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L +AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F+I+PETKGLTLEE
Sbjct  454  LGVAVLVNFASNALVTFAFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPETKGLTLEE  513

Query  230  IEAK  219
            IEA 
Sbjct  514  IEAS  517



>gb|EYU43459.1| hypothetical protein MIMGU_mgv1a004913mg [Erythranthe guttata]
Length=504

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAV+LFLLGSYYT+L ++P VAV+ALL+YVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  379  VSGIAVSLFLLGSYYTYLGDIPAVAVVALLVYVGCYQLSFGPIGWLMISEIFPLRLRGRG  438

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVL+NFG NALVTFAFSP+KEL+GAG +FFIFG IA++++IF+FFIIPETKGLTLEE
Sbjct  439  LSIAVLINFGANALVTFAFSPLKELLGAGILFFIFGGIAILSLIFIFFIIPETKGLTLEE  498

Query  230  IEAKYL  213
            IEAK L
Sbjct  499  IEAKLL  504



>ref|XP_002300123.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
 gb|EEE84928.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
Length=559

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +SIAVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV  I+PETKGL+LEE
Sbjct  493  ISIAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLSLLFVVVIVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>ref|XP_010256836.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Nelumbo 
nucifera]
Length=568

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  442  VSGIALSLFLLTAYYKFLGGFPIVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  501

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++F    +PETKGL+LEE
Sbjct  502  LSLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGIALLSLLFAIVFVPETKGLSLEE  561

Query  230  IEAKYL  213
            IE+K L
Sbjct  562  IESKIL  567



>ref|XP_003574402.1| PREDICTED: D-xylose-proton symporter-like 2 [Brachypodium distachyon]
Length=503

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAVALFLL SYYT       VAVIALLLYVG YQLSFGPIGWLMISE+FPL++RGRG
Sbjct  379  VSGIAVALFLLSSYYTLFKGASYVAVIALLLYVGSYQLSFGPIGWLMISEVFPLKLRGRG  438

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIA+ ++ F+  I+PETKGLTLEE
Sbjct  439  LSVAVLVNFASNALVTFAFSPLEDLIGTGVLFASFGVIALASLGFILCIVPETKGLTLEE  498

Query  230  IEAK  219
            IEAK
Sbjct  499  IEAK  502



>ref|XP_010685696.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=565

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI VALFLL +YY FL  +P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  439  VSGITVALFLLAAYYKFLGGLPFVAVAALLLYVGSYQISFGPISWLMVSEIFPLRTRGRG  498

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KEL+GA N+F +FGVIA+++++FV  ++PETKGL+LEE
Sbjct  499  ISLAVLTNFGSNALVTFAFSPLKELLGADNLFLLFGVIALLSLVFVLTLVPETKGLSLEE  558

Query  230  IEAK  219
            IEAK
Sbjct  559  IEAK  562



>gb|AFW67123.1| hypothetical protein ZEAMMB73_874760 [Zea mays]
Length=295

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  169  VGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRG  228

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PETKGL+LEE
Sbjct  229  ISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPETKGLSLEE  288

Query  230  IEAKYL  213
            IE+K L
Sbjct  289  IESKIL  294



>ref|XP_008809219.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Phoenix dactylifera]
Length=502

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLL SYYT   +   VAVIALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRG
Sbjct  377  VSGIVISLFLLSSYYTLFKDSAFVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALVTF+FSP++ LVG G +F  FGVIAV +++F+FF++PETKGLTLE+
Sbjct  437  LSIAVLVNFASNALVTFSFSPLEALVGTGILFAGFGVIAVASLVFIFFVVPETKGLTLED  496

Query  230  IEAKYL  213
            IE K L
Sbjct  497  IETKIL  502



>ref|NP_001287653.1| D-xylose-proton symporter-like 3, chloroplastic-like [Solanum 
lycopersicum]
 ref|XP_004235087.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
 dbj|BAO96238.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
 dbj|BAQ03806.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
Length=545

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  419  VSGIALSLFLLSAYYKFLGSYPFVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  478

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PETKGLTLEE
Sbjct  479  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALLSLVFVVTSVPETKGLTLEE  538

Query  230  IEAKYL  213
            IE+K L
Sbjct  539  IESKIL  544



>dbj|BAH19966.1| AT5G59250 [Arabidopsis thaliana]
Length=415

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  289  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  348

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  349  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPETKGLSLEE  408

Query  230  IEAKYLT  210
            IE+K L 
Sbjct  409  IESKILK  415



>ref|XP_002463619.1| hypothetical protein SORBIDRAFT_01g003010 [Sorghum bicolor]
 gb|EER90617.1| hypothetical protein SORBIDRAFT_01g003010 [Sorghum bicolor]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  LD  P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  133  VGGIALSLFLLAAYYKILDGFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRG  192

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KE +G  N+FF+FGVIAV++++FV  ++PETKGL+LEE
Sbjct  193  ISLAVLTNFGSNALVTFAFSPLKEFLGPANIFFLFGVIAVLSLVFVILVVPETKGLSLEE  252

Query  230  IEAKYL  213
            IE+K L
Sbjct  253  IESKIL  258



>ref|XP_006342314.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Solanum tuberosum]
Length=545

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  419  VSGIALSLFLLSAYYKFLGSYPFVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  478

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PETKGLTLEE
Sbjct  479  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALLSLVFVVTSVPETKGLTLEE  538

Query  230  IEAKYL  213
            IE+K L
Sbjct  539  IESKIL  544



>ref|XP_006279761.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
 gb|EOA12659.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
Length=559

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  432  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  491

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  492  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGIALVSLLFVILVVPETKGLSLEE  551

Query  230  IEAKYL  213
            IE+K L
Sbjct  552  IESKIL  557



>gb|KDO39943.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=453

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  347  VSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  406

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAG  324
            LS+AVLVNFG NALVTFAFSP+K+L+GAG
Sbjct  407  LSVAVLVNFGANALVTFAFSPLKDLLGAG  435



>ref|XP_010106537.1| D-xylose-proton symporter-like 3 [Morus notabilis]
 gb|EXC10713.1| D-xylose-proton symporter-like 3 [Morus notabilis]
Length=500

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIAV+L LL +YY FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  374  VSGIAVSLLLLSAYYKFLGGYPLVAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  433

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA ++++FV   +PETKGL+LEE
Sbjct  434  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLVFGVIAFLSLLFVVLYVPETKGLSLEE  493

Query  230  IEAKYLT  210
            IE+K L 
Sbjct  494  IESKILK  500



>ref|XP_009605730.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=547

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  421  VSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  480

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV   +PETKGL+LEE
Sbjct  481  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAIALLSLLFVITSVPETKGLSLEE  540

Query  230  IEAKYL  213
            IE+K L
Sbjct  541  IESKIL  546



>ref|XP_009779936.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=552

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  426  VSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  485

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV   +PETKGL+LEE
Sbjct  486  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAIALLSLLFVVTSVPETKGLSLEE  545

Query  230  IEAKYL  213
            IE+K L
Sbjct  546  IESKIL  551



>gb|ABB17074.1| putative sugar transporter [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=552

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  426  VSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  485

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV   +PETKGL+LEE
Sbjct  486  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAIALLSLLFVVTSVPETKGLSLEE  545

Query  230  IEAKYL  213
            IE+K L
Sbjct  546  IESKIL  551



>ref|XP_010454633.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  493  ISLAVLTNFGSNALVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>gb|KDO39944.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=487

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  381  VSGIVISLFLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  440

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAG  324
            LS+AVLVNFG NALVTFAFSP+K+L+GAG
Sbjct  441  LSVAVLVNFGANALVTFAFSPLKDLLGAG  469



>ref|XP_011035266.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Populus euphratica]
Length=557

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  431  VSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  490

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+G  N+F +FG IA+++++FV  I+PETKGL+LEE
Sbjct  491  ISLAVLTNFGSNAIVTFAFSPLKELLGVENLFLLFGAIALLSLLFVVVIVPETKGLSLEE  550

Query  230  IEAKYL  213
            IE+K L
Sbjct  551  IESKIL  556



>emb|CDY54245.1| BnaC09g53840D [Brassica napus]
Length=559

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  493  ISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVVLVVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>emb|CDY33006.1| BnaA10g12120D [Brassica napus]
Length=555

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  429  VSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  488

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  489  ISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVVLVVPETKGLSLEE  548

Query  230  IEAKYL  213
            IE+K L
Sbjct  549  IESKIL  554



>ref|XP_011035268.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Populus euphratica]
Length=555

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  429  VSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  488

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+G  N+F +FG IA+++++FV  I+PETKGL+LEE
Sbjct  489  ISLAVLTNFGSNAIVTFAFSPLKELLGVENLFLLFGAIALLSLLFVVVIVPETKGLSLEE  548

Query  230  IEAKYL  213
            IE+K L
Sbjct  549  IESKIL  554



>ref|XP_002866311.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42570.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  493  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>ref|XP_009120413.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brassica 
rapa]
Length=555

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  429  VSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  488

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  489  ISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVVLVVPETKGLSLEE  548

Query  230  IEAKYL  213
            IE+K L
Sbjct  549  IESKIL  554



>ref|XP_010535452.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=557

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  431  VSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  490

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA VTFAFSP+KEL+GA N+F +FG +A+V+++FV  I+PETKGL+LEE
Sbjct  491  ISLAVLTNFGSNAAVTFAFSPLKELLGAENLFLLFGAVALVSLLFVILIVPETKGLSLEE  550

Query  230  IEAKYL  213
            IE+K L
Sbjct  551  IESKIL  556



>dbj|BAE98379.1| D-xylose-H+ symporter - like protein [Arabidopsis thaliana]
Length=558

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  432  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  491

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  492  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPETKGLSLEE  551

Query  230  IEAKYL  213
            IE+K L
Sbjct  552  IESKIL  557



>ref|XP_010483521.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=560

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+++++FV  ++PETKGL+LEE
Sbjct  493  ISLAVLANFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALISLLFVILVVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>ref|NP_200733.2| Major facilitator superfamily protein [Arabidopsis thaliana]
 sp|Q0WWW9.2|XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09770.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AAU05477.1| At5g59250 [Arabidopsis thaliana]
 gb|AAV85693.1| At5g59250 [Arabidopsis thaliana]
 gb|AED97162.1| Major facilitator superfamily protein [Arabidopsis thaliana]
Length=558

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  432  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  491

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  492  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPETKGLSLEE  551

Query  230  IEAKYL  213
            IE+K L
Sbjct  552  IESKIL  557



>ref|XP_010443656.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  432  VSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  491

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  492  ISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILVVPETKGLSLEE  551

Query  230  IEAKYL  213
            IE+K L
Sbjct  552  IESKIL  557



>ref|XP_004309072.1| PREDICTED: D-xylose-proton symporter-like 2 [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LF+LGSYY FL+  P VA IALLLYVGCYQLSFGPIGWLMISEIFPLR RG+G
Sbjct  373  VSGMVISLFMLGSYYLFLNEAPAVAAIALLLYVGCYQLSFGPIGWLMISEIFPLRFRGQG  432

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI VLVNF  NALVT AFSP+K  +GAG +F++FG IAV ++ F+FFI+PETKGL+LEE
Sbjct  433  LSIGVLVNFAANALVTLAFSPLKAWLGAGLLFYVFGAIAVASLAFIFFIVPETKGLSLEE  492

Query  230  IEAKYL  213
            IE + L
Sbjct  493  IEEQCL  498



>gb|KJB20004.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=541

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  415  VGGIALSLFLLCAYYKFLGEFPYVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  474

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PETKGL+LEE
Sbjct  475  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALISLLFVALYVPETKGLSLEE  534

Query  230  IEAKYLT  210
            IE+K L 
Sbjct  535  IESKLLK  541



>ref|XP_006401006.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
 gb|ESQ42459.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
Length=558

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  432  VSGIALSLFLLSAYYKFLGGYPLVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  491

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG IA+V+++FV  ++PETKGL+LEE
Sbjct  492  ISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAIALVSLLFVILVVPETKGLSLEE  551

Query  230  IEAK  219
            IE+K
Sbjct  552  IESK  555



>ref|NP_001173691.1| Os03g0823200 [Oryza sativa Japonica Group]
 dbj|BAH92419.1| Os03g0823200, partial [Oryza sativa Japonica Group]
Length=303

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            + GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  177  IGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  236

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PETKGLTLEE
Sbjct  237  ISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPETKGLTLEE  296

Query  230  IEAKYLT  210
            IE+K L 
Sbjct  297  IESKLLK  303



>ref|XP_007016336.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY33955.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=561

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  435  VGGIALSLFLLSAYYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  494

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+ +++FV   +PETKGL+LEE
Sbjct  495  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLVFGAIALSSLLFVVLYVPETKGLSLEE  554

Query  230  IEAKYLT  210
            IE+K L 
Sbjct  555  IESKILK  561



>gb|KJB20000.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
 gb|KJB20001.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=561

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  435  VGGIALSLFLLCAYYKFLGEFPYVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  494

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVIA+++++FV   +PETKGL+LEE
Sbjct  495  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVIALISLLFVALYVPETKGLSLEE  554

Query  230  IEAKYLT  210
            IE+K L 
Sbjct  555  IESKLLK  561



>ref|XP_011075803.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Sesamum 
indicum]
Length=502

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYYT+L ++P VAV+ALL+YVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  377  VSGIVISLFLLGSYYTYLGDIPAVAVVALLVYVGCYQLSFGPIGWLMISEVFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP++EL+GAG +FF FG IAV+++IF+FFIIPETKGLTLEE
Sbjct  437  LSIAVLVNFAANALVTFAFSPLRELLGAGILFFSFGGIAVLSLIFIFFIIPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKLL  502



>ref|XP_011075802.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Sesamum 
indicum]
Length=524

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYYT+L ++P VAV+ALL+YVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  399  VSGIVISLFLLGSYYTYLGDIPAVAVVALLVYVGCYQLSFGPIGWLMISEVFPLRLRGRG  458

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF  NALVTFAFSP++EL+GAG +FF FG IAV+++IF+FFIIPETKGLTLEE
Sbjct  459  LSIAVLVNFAANALVTFAFSPLRELLGAGILFFSFGGIAVLSLIFIFFIIPETKGLTLEE  518

Query  230  IEAKYL  213
            IEAK L
Sbjct  519  IEAKLL  524



>ref|XP_008681531.1| PREDICTED: uncharacterized protein LOC100274077 isoform X2 [Zea 
mays]
Length=559

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PETKGL+LEE
Sbjct  493  ISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>ref|XP_008681530.1| PREDICTED: uncharacterized protein LOC100274077 isoform X1 [Zea 
mays]
Length=586

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  460  VGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRG  519

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PETKGL+LEE
Sbjct  520  ISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPETKGLSLEE  579

Query  230  IEAKYL  213
            IE+K L
Sbjct  580  IESKIL  585



>gb|ABK24923.1| unknown [Picea sitchensis]
Length=521

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLL +YY+FL+  P VAV+ALL YV CYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  395  VSGIVLSLFLLAAYYSFLNGTPIVAVLALLFYVSCYQVSFGPISWLMVSEIFPLRTRGRG  454

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVLVNF +NALVTF+FSP++EL+GA  +F  FGVIA+++++FV F +PETKGL+LEE
Sbjct  455  ISVAVLVNFASNALVTFSFSPLQELLGASMLFVTFGVIALLSLLFVIFYVPETKGLSLEE  514

Query  230  IEAKYL  213
            IE+K L
Sbjct  515  IESKIL  520



>gb|KDP42213.1| hypothetical protein JCGZ_02943 [Jatropha curcas]
Length=559

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  L   P VAV+ALLLYVG YQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  433  VGGIALSLFLLSAYYKVLGGFPFVAVVALLLYVGSYQISFGPISWLMVSEIFPLRTRGKG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++F  F +PETKGL+LEE
Sbjct  493  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFVLFGAIALLSLLFTIFFVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K+L
Sbjct  553  IESKFL  558



>ref|XP_006651969.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Oryza brachyantha]
Length=473

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            + GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  347  IGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  406

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PETKGLTLEE
Sbjct  407  ISLAVLTNFGSNALVTFAFSPLQEFLGPANIFILFGAISLLSLVFVILKVPETKGLTLEE  466

Query  230  IEAKYL  213
            IE+K L
Sbjct  467  IESKIL  472



>ref|XP_006846330.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
 gb|ERN08005.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
Length=570

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI  +LFLL +YY  L   P  AV+ALLLYV CYQ+SFGPI WLM+SEIFPL  RGRG
Sbjct  444  VSGIVFSLFLLAAYYKILQGFPVAAVVALLLYVSCYQISFGPISWLMVSEIFPLHTRGRG  503

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV F +PETKGL+LEE
Sbjct  504  ISLAVLANFGSNAIVTFAFSPLKELLGAANLFALFGGIAMLSLLFVIFYVPETKGLSLEE  563

Query  230  IEAKYL  213
            IE+K L
Sbjct  564  IESKVL  569



>ref|XP_006854111.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
 gb|ERN15578.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
Length=505

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI +ALFLL +YYTFL ++P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPLR RG+G
Sbjct  380  VSGIVIALFLLAAYYTFLSSLPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLRFRGKG  439

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNF +NALV FAFSP+K L+GAG +F  FGVIA++A++F+FF +PETKGL+LEE
Sbjct  440  LSIAVLVNFASNALVAFAFSPLKALLGAGLLFAAFGVIAILALLFIFFYVPETKGLSLEE  499

Query  230  IEAKYL  213
            IE+K L
Sbjct  500  IESKIL  505



>ref|XP_010043498.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW85511.1| hypothetical protein EUGRSUZ_B02309 [Eucalyptus grandis]
Length=570

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V+GI ++L  L SYY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  444  VAGIVISLLFLSSYYKFLGEFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  503

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+ EL+GA NVF +FGVIA+++++FV  ++PETKGL+LEE
Sbjct  504  ISLAVLTNFGSNAIVTFAFSPLTELLGAENVFLLFGVIALLSLLFVVLLVPETKGLSLEE  563

Query  230  IEAKYLT  210
            IE+K L 
Sbjct  564  IESKILK  570



>gb|EEE60202.1| hypothetical protein OsJ_13164 [Oryza sativa Japonica Group]
Length=488

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            + GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  362  IGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  421

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PETKGLTLEE
Sbjct  422  ISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPETKGLTLEE  481

Query  230  IEAKYL  213
            IE+K L
Sbjct  482  IESKLL  487



>gb|AAO18445.1| putative sugar transporter protein [Oryza sativa Japonica Group]
Length=525

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            + GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  399  IGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  458

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PETKGLTLEE
Sbjct  459  ISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPETKGLTLEE  518

Query  230  IEAKYL  213
            IE+K L
Sbjct  519  IESKLL  524



>gb|ABF99614.1| sugar transporter family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=545

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            + GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  419  IGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  478

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PETKGLTLEE
Sbjct  479  ISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPETKGLTLEE  538

Query  230  IEAKYL  213
            IE+K L
Sbjct  539  IESKLL  544



>gb|EEC76432.1| hypothetical protein OsI_14118 [Oryza sativa Indica Group]
Length=579

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            + GIAV+LFLL +YY  L++ P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  453  IGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  512

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++E +G  N+F +FG I++++++FV   +PETKGLTLEE
Sbjct  513  ISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLFGAISLLSLVFVILKVPETKGLTLEE  572

Query  230  IEAKYL  213
            IE+K L
Sbjct  573  IESKLL  578



>ref|XP_002520519.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41932.1| sugar transporter, putative [Ricinus communis]
Length=505

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  L   P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  379  VGGIALSLFLLSAYYKVLGGFPVVAVAALLLYVGSYQISFGPISWLMVSEIFPLRTRGKG  438

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA++A++F    +PETKGL+LEE
Sbjct  439  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLALLFAIVYVPETKGLSLEE  498

Query  230  IEAKYL  213
            IE+K L
Sbjct  499  IESKIL  504



>ref|XP_009381068.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GI ++LFLL +YY  L ++P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  431  VGGIVLSLFLLAAYYNVLGSLPLVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  490

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KEL+G  N+F +FG IA++++ FVFF +PETKGL+LEE
Sbjct  491  ISLAVLTNFGSNALVTFAFSPLKELLGPANIFLLFGAIALLSLAFVFFYVPETKGLSLEE  550

Query  230  IEAKYLT  210
            IEAK L 
Sbjct  551  IEAKILN  557



>ref|XP_007132040.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
 gb|ESW04034.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
Length=558

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFP+R RG+G
Sbjct  432  VSGIALSLVLLSAYYKFLGGFPFVAVGALLLYVGCYQISFGPISWLMVSEIFPIRTRGKG  491

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV F +PETKGL+LE+
Sbjct  492  ISLAVLTNFASNAVVTFAFSPLKELLGAENLFLLFGAIAILSLLFVIFSVPETKGLSLED  551

Query  230  IEAKYL  213
            IE+K L
Sbjct  552  IESKIL  557



>ref|XP_004981232.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Setaria italica]
Length=563

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  437  VGGIALSLFLLAAYYKILNNSPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRG  496

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++E +G  N+FF+FG IAV++++FV   +PETKGL+LEE
Sbjct  497  ISLAVLTNFGSNALVTFAFSPLQEFLGPENIFFLFGAIAVLSLVFVILNVPETKGLSLEE  556

Query  230  IEAKYL  213
            IE+K L
Sbjct  557  IESKIL  562



>emb|CDP09100.1| unnamed protein product [Coffea canephora]
Length=567

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY FL   P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  441  VGGIALSLLLLWAYYKFLGGYPLVAVAALLLYVGSYQVSFGPISWLMVSEIFPLRTRGKG  500

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++F    +PETKGL+LEE
Sbjct  501  ISLAVLTNFGSNAIVTFAFSPLKELLGAANLFLLFGAIALLSLVFAVVYVPETKGLSLEE  560

Query  230  IEAKYL  213
            IE+K L
Sbjct  561  IESKIL  566



>ref|XP_008777375.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
 ref|XP_008777383.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
Length=564

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLL +YY FL   P VAV ALLLYVG YQ+SFGPI WL++SEIFPLR RGRG
Sbjct  438  VSGIVLSLFLLAAYYKFLGGFPLVAVGALLLYVGSYQVSFGPISWLVVSEIFPLRTRGRG  497

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA VTFAFSP+KEL+G  N+F IFG +A+++++FV F +PETKGL+LEE
Sbjct  498  ISLAVLTNFGSNAFVTFAFSPLKELLGPDNLFLIFGAVALLSLLFVLFYVPETKGLSLEE  557

Query  230  IEAKYL  213
            IEAK L
Sbjct  558  IEAKIL  563



>ref|XP_003537973.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Glycine max]
Length=552

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FPLR RG+G
Sbjct  426  VSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFPLRTRGKG  485

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA+++++F+ F +PETKGL+LE+
Sbjct  486  ISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIAILSLLFIIFSVPETKGLSLED  545

Query  230  IEAKYL  213
            IE+K L
Sbjct  546  IESKIL  551



>gb|KHN21925.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=552

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FPLR RG+G
Sbjct  426  VSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFPLRTRGKG  485

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA+++++F+ F +PETKGL+LE+
Sbjct  486  ISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIAILSLLFIIFSVPETKGLSLED  545

Query  230  IEAKYL  213
            IE+K L
Sbjct  546  IESKIL  551



>gb|AFK37407.1| unknown [Lotus japonicus]
Length=563

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE FP+R RGRG
Sbjct  437  VSGIGLSLGLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSETFPIRTRGRG  496

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KEL+GA N+F +FG I++VA++FV F +PETKGL+LEE
Sbjct  497  ISLAVLTNFASNAVVTFAFSPLKELLGAENLFLLFGAISLVALLFVIFSVPETKGLSLEE  556

Query  230  IEAKYL  213
            IE+K L
Sbjct  557  IESKIL  562



>ref|XP_009126155.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Brassica 
rapa]
Length=502

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PETKGLTLEE
Sbjct  437  LSLAVLVNFGANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>emb|CDX85478.1| BnaA02g03350D [Brassica napus]
Length=505

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  380  VGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  439

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PETKGLTLEE
Sbjct  440  LSLAVLVNFGANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPETKGLTLEE  499

Query  230  IEAKYL  213
            IEAK L
Sbjct  500  IEAKCL  505



>ref|XP_006400240.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
 gb|ESQ41693.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
Length=502

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP++EL+GAG +FF FGVI V++++F+FFI+PETKGLTLEE
Sbjct  437  LSIAVLVNFGANALVTFAFSPLEELLGAGILFFGFGVICVLSLLFIFFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_009126154.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  380  VGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  439

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PETKGLTLEE
Sbjct  440  LSLAVLVNFGANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPETKGLTLEE  499

Query  230  IEAKYL  213
            IEAK L
Sbjct  500  IEAKCL  505



>ref|XP_003539594.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006592182.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=560

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FPLR RG+G
Sbjct  434  VSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFPLRTRGKG  493

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA ++++F+ F +PETKG++LE+
Sbjct  494  ISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIATLSLLFIIFSVPETKGMSLED  553

Query  230  IEAKYL  213
            IE+K L
Sbjct  554  IESKIL  559



>gb|KHN32151.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=560

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SE+FPLR RG+G
Sbjct  434  VSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVSEVFPLRTRGKG  493

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA ++++F+ F +PETKG++LE+
Sbjct  494  ISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAIATLSLLFIIFSVPETKGMSLED  553

Query  230  IEAKYL  213
            IE+K L
Sbjct  554  IESKIL  559



>dbj|BAJ95036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI VALFLL +YY  L   P VAV ALLLYVGCYQLSFGPI WLM+SEIFPLR RG G
Sbjct  394  VSGITVALFLLAAYYKALSGFPFVAVGALLLYVGCYQLSFGPISWLMVSEIFPLRTRGCG  453

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++  +G  NVF +F  I+++A++FV   +PETKGL+LEE
Sbjct  454  ISLAVLTNFGSNALVTFAFSPLQGYLGPANVFLLFAAISLLALLFVILNVPETKGLSLEE  513

Query  230  IEAKYL  213
            IE+K L
Sbjct  514  IESKIL  519



>emb|CAN72732.1| hypothetical protein VITISV_037854 [Vitis vinifera]
Length=458

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 9/126 (7%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY +L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG
Sbjct  342  VSGIVISLFLLGSYYIYLGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  401

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NA+          L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEE
Sbjct  402  LSIAVLVNFGANAI---------ALLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEE  452

Query  230  IEAKYL  213
            IEAK L
Sbjct  453  IEAKLL  458



>ref|XP_010087486.1| D-xylose-proton symporter-like 2 [Morus notabilis]
 gb|EXB29167.1| D-xylose-proton symporter-like 2 [Morus notabilis]
Length=518

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY FL NV  VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  393  VSGMVISLFLLGSYYLFLGNVWVVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  452

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSIAVLVNFG NALVTFAFSP++ L+GAG +F++FGVIAVV++ F+FF++PETKGLTLEE
Sbjct  453  LSIAVLVNFGANALVTFAFSPLEALLGAGILFYVFGVIAVVSLGFIFFVVPETKGLTLEE  512

Query  230  IEAKYL  213
            IEA  L
Sbjct  513  IEANCL  518



>ref|XP_004173923.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like, 
partial [Cucumis sativus]
Length=171

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  45   VSGIALSLLLLSAYYKFLGGFPIVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  104

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV   +PETKGL+LE+
Sbjct  105  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLSLLFVVLKVPETKGLSLED  164

Query  230  IEAKYL  213
            IE+K L
Sbjct  165  IESKIL  170



>ref|XP_004170091.1| PREDICTED: D-xylose-proton symporter-like 2-like, partial [Cucumis 
sativus]
Length=459

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++LFLLGSYY FL NVP VAV+ALLLYVG YQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  377  VSGITISLFLLGSYYLFLGNVPAVAVVALLLYVGSYQLSFGPIGWLMISEVFPLRLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMK  342
            LSIAVLVNFG NALVTFAFSP+K
Sbjct  437  LSIAVLVNFGANALVTFAFSPLK  459



>ref|XP_003563522.2| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brachypodium 
distachyon]
Length=568

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI VALFLL +YY  L   P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  442  VSGITVALFLLAAYYKILSGFPFVAVGALLLYVGSYQVSFGPISWLMVSEIFPLRTRGRG  501

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP++  +G  N+F +FG I+++A++FV   +PETKGL+LE+
Sbjct  502  ISLAVLTNFGSNALVTFAFSPLQGYLGPANIFLLFGAISLLALVFVILNVPETKGLSLED  561

Query  230  IEAKYL  213
            IE+K L
Sbjct  562  IESKIL  567



>emb|CDY38076.1| BnaC02g06970D [Brassica napus]
Length=502

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V G+ V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVL+NF  NALVTFAFSP+KEL GAG +F  FGVI V++++F++FI+PETKGLTLEE
Sbjct  437  LSLAVLLNFSANALVTFAFSPLKELFGAGILFMGFGVICVLSLLFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_010907806.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
 ref|XP_010907807.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
Length=564

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GI ++LFLL +YY  L   P VAV ALLLYVG YQ+SFGPI WL++SEIFPLR RGRG
Sbjct  438  VVGIVLSLFLLAAYYKILGGFPLVAVGALLLYVGSYQVSFGPISWLVVSEIFPLRTRGRG  497

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KEL+G  N+F +FG IA+++++F+ F +PETKGL+LEE
Sbjct  498  ISLAVLTNFGSNALVTFAFSPLKELLGPDNLFLLFGAIALLSLLFILFYVPETKGLSLEE  557

Query  230  IEAKYL  213
            IEAK L
Sbjct  558  IEAKIL  563



>gb|KJB26763.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=460

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ ++LFLLGSYY FLD++  +AV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRG
Sbjct  376  VSGMVISLFLLGSYYLFLDDLAAIAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRG  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKEL  336
            LS+AVLVNFG NALVTFAFSP+K L
Sbjct  436  LSVAVLVNFGANALVTFAFSPLKVL  460



>ref|XP_006297488.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
 gb|EOA30386.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
Length=502

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ V+LFLLGSYY F +  P VAV ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG
Sbjct  377  VSGMVVSLFLLGSYYIFYNTAPAVAVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRG  436

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL+NFG NALVTFAFSP+K+L+GAG +F  FGVI ++++ F++FI+PETKGLTLEE
Sbjct  437  ISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICLLSLFFIYFIVPETKGLTLEE  496

Query  230  IEAKYL  213
            IEAK L
Sbjct  497  IEAKCL  502



>ref|XP_011089518.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Sesamum 
indicum]
Length=558

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  551  YYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNA  372
            YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA
Sbjct  445  YYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNA  504

Query  371  LVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +VTFAFSP+KEL+GA N+F +FG IAV++++FV   +PETKGL+LEEIE+K L
Sbjct  505  IVTFAFSPLKELLGAENLFLLFGAIAVLSLVFVVTSVPETKGLSLEEIESKIL  557



>ref|XP_004294661.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLL +YY FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  432  VSGLALSLFLLSAYYKFLGGFPLVAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  491

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NALVTFAFSP+KE +GA N+F +FG IA+++++FV  I+PETKGL+LEE
Sbjct  492  ISLAVLTNFGSNALVTFAFSPLKEALGADNLFLLFGAIALISLLFVVLIVPETKGLSLEE  551

Query  230  IEAKYL  213
            IE+K L
Sbjct  552  IESKLL  557



>gb|EYU45952.1| hypothetical protein MIMGU_mgv1a003885mg [Erythranthe guttata]
Length=558

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  551  YYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNA  372
            YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G+S++VL NFG+NA
Sbjct  445  YYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKGISLSVLTNFGSNA  504

Query  371  LVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            LVTFAF P+KEL+GA N+F +FG IA++A++FV  I+PETKGLTLEEIE+K L
Sbjct  505  LVTFAFFPLKELLGADNLFLLFGAIALLALVFVVLIVPETKGLTLEEIESKIL  557



>ref|XP_008349595.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  437  VSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  496

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA++++IFV  I+PETKGLTLEE
Sbjct  497  ISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAIALLSLIFVVLIVPETKGLTLEE  556

Query  230  IEAK  219
            IE+K
Sbjct  557  IESK  560



>ref|XP_008384924.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  437  VSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  496

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA++++IFV  I+PETKGLTLEE
Sbjct  497  ISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAIALLSLIFVVLIVPETKGLTLEE  556

Query  230  IEAK  219
            IE+K
Sbjct  557  IESK  560



>ref|XP_010063233.1| PREDICTED: D-xylose-proton symporter-like 2 [Eucalyptus grandis]
 gb|KCW90943.1| hypothetical protein EUGRSUZ_A02968 [Eucalyptus grandis]
Length=503

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+ V+L LLGSYY FLD+VP  AV+ LLLYVGCYQ+SFGPIGWL+ISEIFPLR+RGRG
Sbjct  378  VSGMFVSLLLLGSYYLFLDDVPAAAVVGLLLYVGCYQVSFGPIGWLLISEIFPLRLRGRG  437

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNFG NALVT AFSP+ +L+G+G +F+ FGVI +VA++F+FFI+PETKGLTLEE
Sbjct  438  LSMAVLVNFGANALVTLAFSPLVDLLGSGLLFYGFGVITLVALLFIFFIVPETKGLTLEE  497

Query  230  IEAKYL  213
            IEAK L
Sbjct  498  IEAKCL  503



>ref|XP_010535453.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=531

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  431  VSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  490

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGN  321
            +S+AVL NFG+NA VTFAFSP+KEL+GA N
Sbjct  491  ISLAVLTNFGSNAAVTFAFSPLKELLGAEN  520



>gb|EPS59382.1| hypothetical protein M569_15426, partial [Genlisea aurea]
Length=411

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A +L LL +YY FL   P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  285  VSGLAFSLLLLSAYYKFLGAFPFVAVAALLLYVGSYQISFGPISWLMVSEIFPLRTRGKG  344

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTF+FSP+KEL+GA N+F +FG I++++++FV   +PETKGL+LEE
Sbjct  345  ISLAVLTNFASNAVVTFSFSPLKELLGAENLFLLFGGISLLSLVFVVLFVPETKGLSLEE  404

Query  230  IEAKYL  213
            IE+K+L
Sbjct  405  IESKFL  410



>ref|XP_006424896.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38136.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=443

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  317  VCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  376

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  377  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  436

Query  230  IEAKYL  213
            IE+K L
Sbjct  437  IESKIL  442



>gb|KDO66622.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=436

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  310  VCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  369

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  370  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  429

Query  230  IEAKYL  213
            IE+K L
Sbjct  430  IESKIL  435



>gb|KDO66620.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
 gb|KDO66621.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=443

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  317  VCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  376

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  377  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  436

Query  230  IEAKYL  213
            IE+K L
Sbjct  437  IESKIL  442



>ref|XP_009375941.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Pyrus 
x bretschneideri]
Length=563

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  437  VSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  496

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG IA++++IFV  I+PETKGL+LEE
Sbjct  497  ISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAIALLSLIFVVLIVPETKGLSLEE  556

Query  230  IEAK  219
            IE+K
Sbjct  557  IESK  560



>ref|XP_008457451.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Cucumis 
melo]
Length=585

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  459  VSGIALSLLLLSAYYKFLGGFPIVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  518

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV   +PETKGL+LE+
Sbjct  519  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLSLLFVVLQVPETKGLSLED  578

Query  230  IEAKYL  213
            IE+K L
Sbjct  579  IESKIL  584



>emb|CBI16087.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  542  FLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVT  363
            FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VT
Sbjct  397  FLGGFPVVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVT  456

Query  362  FAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FAFSP++EL+GA N+F +FG+IA+++++FV   +PETKGL+LEEIE+K L
Sbjct  457  FAFSPLEELLGAENLFLLFGIIALLSLLFVIVYVPETKGLSLEEIESKIL  506



>ref|XP_002280634.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Vitis 
vinifera]
 gb|ADP37178.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=561

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  542  FLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVT  363
            FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VT
Sbjct  451  FLGGFPVVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVT  510

Query  362  FAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FAFSP++EL+GA N+F +FG+IA+++++FV   +PETKGL+LEEIE+K L
Sbjct  511  FAFSPLEELLGAENLFLLFGIIALLSLLFVIVYVPETKGLSLEEIESKIL  560



>ref|XP_004145283.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004153144.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65747.1| hypothetical protein Csa_1G524690 [Cucumis sativus]
Length=585

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  459  VSGIALSLLLLSAYYKFLGGFPIVAVGALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  518

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV   +PETKGL+LE+
Sbjct  519  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAIALLSLLFVVLKVPETKGLSLED  578

Query  230  IEAKYL  213
            IE+K L
Sbjct  579  IESKIL  584



>ref|XP_006424897.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38137.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=553

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  427  VCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  486

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  487  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  546

Query  230  IEAKYL  213
            IE+K L
Sbjct  547  IESKIL  552



>ref|XP_002982112.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
 gb|EFJ16780.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
Length=470

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI V+LF+L S++ F   +  +AVIALLLYVGCYQ+SFGPI WLMISEIFPLR RGR 
Sbjct  341  VSGIVVSLFMLASFFVFGKGLSFLAVIALLLYVGCYQISFGPISWLMISEIFPLRTRGRA  400

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI+ LVNF  NALV  A+SP++EL+GA   F  FGVI +VA++F+   +PETKGL+LEE
Sbjct  401  LSISTLVNFAANALVALAYSPLQELLGAPLTFVGFGVIGIVALVFIVSTVPETKGLSLEE  460

Query  230  IEAK  219
            IE +
Sbjct  461  IEQQ  464



>gb|KHG28803.1| hypothetical protein F383_00413 [Gossypium arboreum]
Length=559

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 103/126 (82%), Gaps = 5/126 (4%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY FL   P VAV ALLLY+     SFGPI WLM+SEIFPLR RG+G
Sbjct  435  VGGIALSLFLLCAYYKFLGEFPYVAVAALLLYI-----SFGPISWLMVSEIFPLRTRGKG  489

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG IA+++++FV   +PETKGL+LEE
Sbjct  490  ISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGIALISLLFVALYVPETKGLSLEE  549

Query  230  IEAKYL  213
            IE+K L
Sbjct  550  IESKIL  555



>ref|XP_006488379.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=553

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  427  VCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  486

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  487  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  546

Query  230  IEAKYL  213
            IE+K L
Sbjct  547  IESKIL  552



>gb|KDO66619.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  493  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>ref|XP_006488378.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=559

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  493  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  552

Query  230  IEAKYL  213
            IE+K L
Sbjct  553  IESKIL  558



>gb|KDO66618.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=553

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  427  VCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  486

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  IA +AV+F+   +PETKGL+LEE
Sbjct  487  ISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEE  546

Query  230  IEAKYL  213
            IE+K L
Sbjct  547  IESKIL  552



>ref|XP_002991559.1| hypothetical protein SELMODRAFT_133784, partial [Selaginella 
moellendorffii]
 gb|EFJ07313.1| hypothetical protein SELMODRAFT_133784, partial [Selaginella 
moellendorffii]
Length=378

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI V+LF+L +++ F   +  +AVIALLLYVGCYQ+SFGPI WLMISEIFPLR RGR 
Sbjct  249  VSGIVVSLFMLAAFFVFGKGLSFLAVIALLLYVGCYQISFGPISWLMISEIFPLRTRGRA  308

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI+ LVNF  NALV  A+SP++EL+GA   F  FGVI +VA++F+   +PETKGL+LEE
Sbjct  309  LSISTLVNFAANALVALAYSPLQELLGAPLTFVGFGVIGIVALVFIVSTVPETKGLSLEE  368

Query  230  IEAK  219
            IE +
Sbjct  369  IEQQ  372



>ref|XP_008222111.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Prunus mume]
Length=521

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  395  VSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  454

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVIA+++++FV  ++PETKGL+LEE
Sbjct  455  ISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVIALLSLLFVVLLVPETKGLSLEE  514

Query  230  IEAK  219
            IE+K
Sbjct  515  IESK  518



>ref|XP_008222102.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Prunus mume]
Length=562

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  436  VSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  495

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVIA+++++FV  ++PETKGL+LEE
Sbjct  496  ISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVIALLSLLFVVLLVPETKGLSLEE  555

Query  230  IEAK  219
            IE+K
Sbjct  556  IESK  559



>ref|XP_007207311.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
 gb|EMJ08510.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
Length=562

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  436  VSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQVSFGPISWLMVSEIFPLRTRGKG  495

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVIA+++++FV  ++PETKGL+LEE
Sbjct  496  ISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVIALLSLLFVVLLVPETKGLSLEE  555

Query  230  IEAK  219
            IE+K
Sbjct  556  IESK  559



>ref|XP_004983521.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2-like [Setaria italica]
Length=515

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI   LFLL S     ++   VAV ALLLYVGCYQLSFGPIGWLMISE+FPL++RGRG
Sbjct  393  VSGITF-LFLL-SLLHITEDASYVAVXALLLYVGCYQLSFGPIGWLMISEVFPLKLRGRG  450

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+AVLVNF +NALVTFAFSP+++L+G G +F  FGVIAV +++F+F+IIPETKGLTLEE
Sbjct  451  LSVAVLVNFASNALVTFAFSPLEDLIGTGLLFCGFGVIAVASLVFIFWIIPETKGLTLEE  510

Query  230  IEAK  219
            IEA 
Sbjct  511  IEAS  514



>ref|XP_002992213.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
 gb|EFJ06710.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
Length=470

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI V+LF+L +++ F   +  +AVIALLLYVGCYQ+SFGPI WLMISEIFPLR RGR 
Sbjct  341  VSGIVVSLFMLAAFFVFGKGLSFLAVIALLLYVGCYQISFGPISWLMISEIFPLRTRGRA  400

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LSI+ LVNF  NALV  A+SP++EL+GA   F  FGVI +VA++F+   +PETKGL+LEE
Sbjct  401  LSISTLVNFAANALVALAYSPLQELLGAPLTFVGFGVIGIVALVFIVSTVPETKGLSLEE  460

Query  230  IEAK  219
            IE +
Sbjct  461  IEQQ  464



>ref|XP_001773171.1| predicted protein [Physcomitrella patens]
 gb|EDQ62024.1| predicted protein, partial [Physcomitrella patens]
Length=464

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V+GI ++L  L +Y++FL + P +AV +LLLYVGCYQ+SFGPI WL++SE+FPLR RGR 
Sbjct  340  VTGITLSLVTLAAYFSFLKDYPYLAVGSLLLYVGCYQISFGPISWLVVSEVFPLRTRGRA  399

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            LS+  L+NFG+NA+V  AF+P+++LVG    F IFG++++ A++F+F  +PETKGLTLE+
Sbjct  400  LSMTTLINFGSNAVVALAFAPLQDLVGESYTFVIFGIVSLFALVFIFTSVPETKGLTLEQ  459

Query  230  IEAK  219
            I AK
Sbjct  460  ITAK  463



>ref|XP_001760396.1| predicted protein [Physcomitrella patens]
 gb|EDQ74787.1| predicted protein [Physcomitrella patens]
Length=584

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V+GI ++L  L +Y++FL + P +AV +LLLYVG YQ+SFGPI WLM+SEIFPLR RGR 
Sbjct  457  VAGITISLATLAAYFSFLQDYPYLAVGSLLLYVGSYQISFGPISWLMVSEIFPLRTRGRA  516

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            L +  LVNFG+NALV  AF+P+++LVG    F IFG+I  +A+ F++  +PETKGL+LE+
Sbjct  517  LGVTTLVNFGSNALVALAFAPLQDLVGESYTFVIFGIIGTLALTFIYTSVPETKGLSLEQ  576

Query  230  IEAK  219
            I AK
Sbjct  577  ISAK  580



>ref|XP_007016337.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY33956.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=493

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RG+G
Sbjct  411  VGGIALSLFLLSAYYKFLGGFPFVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGKG  470

Query  410  LSIAVLVNFGTNALVTFAFSPMK  342
            +S+AVL NFG+NA+VTFAFSP+K
Sbjct  471  ISLAVLTNFGSNAIVTFAFSPLK  493



>emb|CAN83894.1| hypothetical protein VITISV_039113 [Vitis vinifera]
Length=606

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  545  TFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALV  366
             FL   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+V
Sbjct  466  KFLGGFPVVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIV  525

Query  365  TFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTL  237
            TFAFSP++EL+GA N+F +FG+IA+++++FV   +PETKG+ +
Sbjct  526  TFAFSPLEELLGAENLFLLFGIIALLSLLFVIVYVPETKGIAI  568



>ref|NP_001190323.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92372.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=470

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI
Sbjct  383  SFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVI  442

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
             V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  443  CVLSLVFIFFIVPETKGLTLEEIEAKCL  470



>ref|XP_010933397.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Elaeis 
guineensis]
Length=468

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  479  LSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgv  300
            LSFGPIGWLMISE+FPLR+RGRGLSIAVLVNF +NALVTFAFSP++ LVG G +F  FGV
Sbjct  380  LSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFASNALVTFAFSPLEALVGTGILFAGFGV  439

Query  299  iavvavifvffiIPETKGLTLEEIEAKYL  213
            IAV +++F+FF++PETKGLTLEEIEAK L
Sbjct  440  IAVASLLFIFFVVPETKGLTLEEIEAKIL  468



>ref|XP_006424895.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38135.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=534

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMK  342
            +S+AVL NFG+NA+VTFAFSP+K
Sbjct  493  ISLAVLTNFGSNAIVTFAFSPLK  515



>gb|KDO66623.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            V GIA++L LL +YY  L   P VAV ALLLYVGCYQ+SFGPI WLM+SEIFPLR RGRG
Sbjct  433  VCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRG  492

Query  410  LSIAVLVNFGTNALVTFAFSPMK  342
            +S+AVL NFG+NA+VTFAFSP+K
Sbjct  493  ISLAVLTNFGSNAIVTFAFSPLK  515



>ref|XP_005845570.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
 gb|EFN53468.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
Length=502

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRG  411
            VSGI ++L  LG+     D V    ++ALLLYVGCYQLSFGPI WL+  E+FPL+VRG+ 
Sbjct  376  VSGIVLSLLALGTAQVARDMVAWTNLVALLLYVGCYQLSFGPISWLLCGEVFPLKVRGQA  435

Query  410  LSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEE  231
            +++A L NFG+N LV+ A   + E  G    +F F  I V AV+ +  I+PETKG TLEE
Sbjct  436  IALATLTNFGSNFLVSLALPTITESFGPAATYFTFAAIGVGAVVTIHAIVPETKGKTLEE  495

Query  230  IEAKY  216
            IEA +
Sbjct  496  IEALW  500



>gb|KEH30181.1| monosaccharide-H+ symporter [Medicago truncatula]
Length=81

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  452  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  273
            M+SEIFPLR RGRG+S+AVL NF  NA+VTFAFSP+KE +GA N+F +F  IA+V+++F+
Sbjct  1    MVSEIFPLRTRGRGISMAVLTNFAANAVVTFAFSPLKEYLGAENLFLLFAAIALVSLVFI  60

Query  272  ffiIPETKGLTLEEIEAKYL  213
               +PETKGL+LEEIE+K L
Sbjct  61   VTSVPETKGLSLEEIESKIL  80



>emb|CBJ33077.1| conserved unknown protein [Ectocarpus siliculosus]
Length=523

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = -2

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LD      + A+ +Y+G YQ+ FGP+ WL+ISEIFPL VRG+ +S+AV+VNFG N LVTF
Sbjct  403  LDTQKACILAAMFVYIGGYQVGFGPVVWLIISEIFPLDVRGKAISVAVVVNFGFNLLVTF  462

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYLT*LFLRMMHNH  180
             F  M E +G+   F IF V    ++ F+   +PETKGL+LE+IEA     LFLR    +
Sbjct  463  IFPTMLEDLGSSWTFAIFAVADAYSLYFIKTRVPETKGLSLEQIEA-----LFLRRGQRN  517



>ref|XP_011400947.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27940.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
Length=529

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -2

Query  509  ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVG  330
            ALL+YVGCYQ+SFGPI WL++SEIFPL+VRG+ +++A L NF +N  V+ A   ++E +G
Sbjct  423  ALLVYVGCYQVSFGPISWLIVSEIFPLKVRGQAMALATLTNFSSNFAVSLALPSVRESIG  482

Query  329  AGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
                + +F V+ V +++ ++ I+PETKG TLEEIEA ++
Sbjct  483  PSATYLVFAVVGVASLVTIYNIVPETKGKTLEEIEALWM  521



>ref|WP_022247679.1| sugar transporter [Clostridium sp. CAG:306]
 emb|CDC20516.1| sugar transporter [Clostridium sp. CAG:306]
Length=455

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 88/130 (68%), Gaps = 4/130 (3%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRV  423
            ++G+ ++L  LG  + F D    N+  VAV +L+ Y+ C+  S GPIGW+++SE+FPLR+
Sbjct  318  LTGVMLSLIALGCAFQFADVLGDNLKWVAVGSLITYIICFACSLGPIGWILVSEVFPLRI  377

Query  422  RGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGL  243
            RG  +S+  + NFG N LV F+F P+   +G    F++FG ++++ + FV+F +PETKG+
Sbjct  378  RGAAMSLCTVANFGFNFLVVFSFLPLIHRIGEACTFWMFGAVSLLCIFFVYFCVPETKGI  437

Query  242  TLEEIEAKYL  213
            +LE IE  ++
Sbjct  438  SLETIEKNWI  447



>ref|XP_005831465.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
 gb|EKX44485.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
Length=431

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTF-LDNVPPVAVIA-LLLYVGCYQLSFGPIGWLMISEIFPLRVRG  417
             SG+AV+L +L + ++   D++   AVIA ++ YVGCYQ+ FGPI WL++SE+FPL++R 
Sbjct  301  TSGMAVSLLVLAALFSGGADSINQSAVIASIVAYVGCYQIGFGPITWLILSEVFPLKIRA  360

Query  416  RGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETK-GLT  240
              +S+  L NFG+N LVT AF   ++ +G   +F  F  IAV AV F F ++PET+ GLT
Sbjct  361  AAVSVGTLANFGSNVLVTLAFESERQSLGETLLFLQFAAIAVAAVAFEFKMVPETRWGLT  420

Query  239  LEEIEAK  219
            LE+IE K
Sbjct  421  LEQIEEK  427



>ref|NP_197203.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 emb|CAC01714.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AED92371.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=440

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -2

Query  452  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  273
            ++ EIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V++++F+
Sbjct  361  LLPEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSLVFI  420

Query  272  ffiIPETKGLTLEEIEAKYL  213
            FFI+PETKGLTLEEIEAK L
Sbjct  421  FFIVPETKGLTLEEIEAKCL  440



>ref|XP_005783754.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
 gb|EOD31325.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
Length=502

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = -2

Query  527  PPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSP  348
            PPV V AL+LYV  YQ+ FGPI WL+ISE+FP++ R R LS+AV VNFG N LVTF  SP
Sbjct  391  PPVVVFALMLYVCGYQVGFGPIAWLIISEVFPIKTRTRALSMAVTVNFGFNLLVTFLLSP  450

Query  347  MKELV-------GAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            ++  +       G+  +F I+  + +V+  FV   +PETKG +LE+IEA
Sbjct  451  LQTALDALSPGKGSSYLFAIYAALCLVSSTFVHACVPETKGKSLEQIEA  499



>ref|WP_013644894.1| major facilitator transporter [Methanobacterium lacus]
 ref|YP_004290515.1| sugar transporter [Methanobacterium lacus]
 gb|ADZ09543.1| sugar transporter [Methanobacterium lacus]
Length=453

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYT---FLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVR  420
            ++G+ V+L ++G  +       ++  +AVI L+LYVG + +S GPI WLMI+EI+PLR+R
Sbjct  322  ITGMIVSLGIMGLAFIIPGLTSSLGWLAVICLMLYVGSFAISLGPIFWLMIAEIYPLRIR  381

Query  419  GRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLT  240
            GR +SI  ++N+ TN +V   F  + EL+GA   F+++GVIAV++++FV++ +PETKG +
Sbjct  382  GRAMSIVTMINWATNLVVAITFLTIIELLGASGTFWLYGVIAVLSLLFVYYRVPETKGKS  441

Query  239  LEEIE  225
            LEEIE
Sbjct  442  LEEIE  446



>ref|XP_005708849.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
 gb|EME32329.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
Length=592

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 80/126 (63%), Gaps = 4/126 (3%)
 Frame = -2

Query  587  SGIAVALFLLGSYYTFLDNVP---PVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRG  417
            +GI V LF+L   ++    V    P+ V+ +  YVG YQ+ FGPI WL++SEIFPLRVR 
Sbjct  465  TGITVTLFVLAWLFSGNGEVSLQIPI-VLGIFCYVGSYQIGFGPITWLVLSEIFPLRVRS  523

Query  416  RGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTL  237
              L+I  L+NFG N +VT  F   +E  G   +F  F +I + ++ F++  + ETKGLTL
Sbjct  524  ASLAIGTLINFGMNLMVTSTFEWEREWFGTSGLFLQFALIGLFSIWFIYEKVVETKGLTL  583

Query  236  EEIEAK  219
            EEIEAK
Sbjct  584  EEIEAK  589



>ref|WP_022187653.1| sugar transporter [Azospirillum sp. CAG:260]
 emb|CDB39512.1| sugar transporter [Azospirillum sp. CAG:260]
Length=462

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 83/129 (64%), Gaps = 4/129 (3%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRV  423
            ++GI  +LF+LG  +   D    ++  VAV ++++Y+ C+  S GPIGW++ISEI PL++
Sbjct  325  LAGITASLFVLGGSFWLTDYLGDSLKWVAVGSIVIYIACFAFSLGPIGWIIISEIMPLKI  384

Query  422  RGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGL  243
            RG  +SI  + NFG N LV   F  + E +G    F++FG++ + ++ F F  IPETKG 
Sbjct  385  RGLAMSICTMANFGFNFLVALTFPVLLEHIGEAYTFWMFGLVGIFSLWFTFRYIPETKGR  444

Query  242  TLEEIEAKY  216
            +LE+IE  +
Sbjct  445  SLEQIEKNW  453



>gb|EWM26836.1| d-xylose-proton symporter-like protein [Nannochloropsis gaditana]
Length=663

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -2

Query  521  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            V + A+ LY+  YQ+ FGP+ W+++SEI+P  VRG  + +AV+ NFG+N LVTFAF P++
Sbjct  424  VLIAAMFLYIAGYQVGFGPVSWILVSEIYPTEVRGETVGLAVMANFGSNLLVTFAFDPVR  483

Query  341  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYLT  210
            E +G    F +F  +A+ A +FV+ ++PETKGL LE I A++ +
Sbjct  484  ESIGTSATFGLFLGVAMAAWLFVYMLLPETKGLALEMIGAQFQS  527



>gb|EKD53804.1| hypothetical protein ACD_60C00149G0003 [uncultured bacterium]
Length=466

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = -2

Query  584  GIAVALFLLGSYYTFLDNVPPVAVIAL---LLYVGCYQLSFGPIGWLMISEIFPLRVRGR  414
            G+A++L LL   ++     P +  IAL   L+Y+ C+  S GPI WLMI+EI+PL++RG 
Sbjct  319  GMALSLGLLSIAFSHAGTFPFLKWIALSSMLIYIACFGFSLGPIMWLMIAEIYPLKIRGL  378

Query  413  GLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLE  234
            G SIA   N+G+N +V   F  + E +GA + F I+ ++++++++F+++++PETK +TLE
Sbjct  379  GCSIATAANWGSNMIVALTFLSLIEYMGASHTFLIYCLLSIISLLFIYYLVPETKDITLE  438

Query  233  EIEAKYLT*LFLRMM  189
            +IE      L+ + M
Sbjct  439  QIEENLRAGLYFKKM  453



>ref|WP_022021988.1| sugar transporter [Acinetobacter sp. CAG:196]
 emb|CCZ51005.1| sugar transporter [Acinetobacter sp. CAG:196]
Length=451

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFL----DNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRV  423
            ++G+ ++LF LG+ + F      ++  VAV +L+ Y+ C+ +S GPIGW+++SE+FPLR+
Sbjct  314  LTGVMLSLFALGTSFAFAGVLGSSLKWVAVGSLVTYIICFAMSLGPIGWILVSEVFPLRI  373

Query  422  RGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGL  243
            RG  +S+  + NF  N  V  +F  +   +G    F+IFG+++++ +IFV+F +PETKG+
Sbjct  374  RGIAMSVCTVSNFAFNFFVVGSFPVLLHRIGGAWTFWIFGIVSILCIIFVYFFVPETKGI  433

Query  242  TLEEIEAKY  216
            +LEEIE+ +
Sbjct  434  SLEEIESNW  442



>ref|WP_022491563.1| metabolite transport protein, partial [Clostridium sp. CAG:813]
 emb|CDE97891.1| metabolite transport protein [Clostridium sp. CAG:813]
Length=336

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 87/130 (67%), Gaps = 4/130 (3%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFL----DNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRV  423
            ++G+ ++L  LG  + F     D++  VAV +L+ Y+ C+ +S GPIGW+++SE+FPL++
Sbjct  196  LTGVMLSLVALGCAFAFSSVSGDSLKWVAVGSLVTYIICFAMSLGPIGWIIVSEVFPLKI  255

Query  422  RGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGL  243
            RG  +SI  + NF  N  V  +F  +   +G    F+ F V++++ ++FV+F +PETKG+
Sbjct  256  RGVAMSICTVSNFAFNFFVVGSFPILIHRIGGAYTFWGFAVVSLLCILFVYFFVPETKGI  315

Query  242  TLEEIEAKYL  213
            +LE+IE+ +L
Sbjct  316  SLEQIESNWL  325



>ref|WP_022486233.1| sugar transporter [Fusobacterium sp. CAG:815]
 emb|CDE92933.1| sugar transporter [Fusobacterium sp. CAG:815]
Length=453

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 87/130 (67%), Gaps = 4/130 (3%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRV  423
            ++G+ ++L  LG  + F D    N+  V V +L++Y+ C+ +S GPIGW+++SE+FPLR+
Sbjct  316  LTGVMLSLIALGCGFAFADFFGDNLKWVTVGSLVIYIICFAMSLGPIGWILVSEVFPLRI  375

Query  422  RGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGL  243
            RG  +SI  + NF  N  V  +F  +   +G    F+ FG+++++ ++FV+F +PETKG+
Sbjct  376  RGVAMSICTVSNFAFNFFVVSSFPILLHRIGGAWTFWGFGIVSLLCIVFVYFCVPETKGI  435

Query  242  TLEEIEAKYL  213
            +LE IE+ ++
Sbjct  436  SLETIESNWI  445



>ref|WP_025318950.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ68933.1| hypothetical protein GbCGDNIH2_1264 [Granulibacter bethesdensis 
CGDNIH2]
Length=448

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = -2

Query  521  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            +A+ AL +Y+  + +  GP+ WL+ISEIFPL  RGRG+++A +VN+G+NA+V + F PM 
Sbjct  344  IAIAALSIYIAAFAIGMGPVFWLIISEIFPLHARGRGMAVATVVNWGSNAIVAYTFLPML  403

Query  341  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
              VG  + F IF  ++V++V F    +PET G TLE+IE
Sbjct  404  NSVGIISTFLIFAFMSVLSVFFTIRFVPETTGQTLEDIE  442



>gb|KIZ01781.1| hypothetical protein MNEG_6180 [Monoraphidium neglectum]
Length=537

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -2

Query  503  LLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAG  324
            LLYVGCYQ+SFGPI WL++ E+FPL VR + +++A ++N+ +N  V+ A   ++E VG  
Sbjct  419  LLYVGCYQVSFGPISWLIVGEVFPLAVRSQAIALAAVMNYASNFGVSLALPTVQEAVGLP  478

Query  323  NvffifgviavvavifvffiIPETKGLTLEEIEAKY  216
              +  F  + VVA++ ++  +PETKG TLEEIEA +
Sbjct  479  ATYLGFAGVGVVALLSIYLTVPETKGKTLEEIEAMW  514



>ref|WP_022196350.1| putative metabolite transport protein ywtG [Azospirillum sp. 
CAG:239]
 emb|CDB53004.1| putative metabolite transport protein ywtG [Azospirillum sp. 
CAG:239]
Length=463

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = -2

Query  590  VSGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRV  423
            +SG+ V+LF LG+ + F D    N+  +AV ++++Y+  +  S GPIGW+++SEI PL++
Sbjct  326  LSGVTVSLFALGASFWFADALGDNLKWMAVGSVVVYIASFAFSLGPIGWIVVSEILPLKI  385

Query  422  RGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGL  243
            RG  +SI  + N   N +V   F P+   VG    F+++G+I +  + F +  +PETKG 
Sbjct  386  RGLAMSICTVANMAFNFVVVLTFLPLINSVGEARTFWMYGIIGIFCLFFTYRYLPETKGR  445

Query  242  TLEEIEAKY  216
            +LE+IE  +
Sbjct  446  SLEQIEKNW  454



>ref|WP_022006956.1| d-xylose-proton symporter [Proteobacteria bacterium CAG:495]
 emb|CCZ29782.1| d-xylose-proton symporter [Proteobacteria bacterium CAG:495]
Length=456

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = -2

Query  584  GIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRG  417
            GI ++L  LG  + + D    ++  +AV +++LY+  + +S GPIGW+++SEI PL++RG
Sbjct  321  GILISLLSLGFAFHYSDVLGESLKWIAVGSVVLYIASFAMSLGPIGWILVSEILPLKIRG  380

Query  416  RGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTL  237
              +S+  + NFG N +V  +F P+   +G    F+IF +IA ++++FV+F +PETKG++L
Sbjct  381  FAMSLCTVANFGFNFIVVLSFLPLINSIGEARTFWIFALIAALSLLFVYFFVPETKGISL  440

Query  236  EEIEAKY  216
            E+IE  +
Sbjct  441  EKIERNW  447



>ref|WP_011631971.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|ABI62162.1| sugar-proton symporter [Granulibacter bethesdensis CGDNIH1]
Length=448

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = -2

Query  521  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            +A+ AL +Y+  + +  GP+ WL+ISEIFPL  RGRG+++A + N+G+NA+V + F PM 
Sbjct  344  IAIAALSIYIAAFAIGMGPVFWLIISEIFPLHARGRGMAVATVANWGSNAIVAYTFLPML  403

Query  341  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
              VG  + F IF +++VV++ F    +PET G TLE+IE
Sbjct  404  NSVGIISTFLIFALMSVVSIFFTIRFVPETTGQTLEDIE  442



>ref|WP_025286678.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ63069.1| hypothetical protein GbCGDNIH3_1264 [Granulibacter bethesdensis 
CGDNIH3]
Length=448

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = -2

Query  521  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            +A+ AL +Y+  + +  GP+ WL+ISEIFPL  RGRG+++A + N+G+NA+V + F PM 
Sbjct  344  IAIAALSIYIAAFAIGMGPVFWLIISEIFPLHARGRGMAVATVANWGSNAIVAYTFLPML  403

Query  341  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
              VG  + F IF +++VV++ F    +PET G TLE+IE
Sbjct  404  NSVGIISTFLIFALMSVVSIFFTIRFVPETTGQTLEDIE  442



>ref|WP_025320564.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ66299.1| hypothetical protein GbCGDNIH4_1264 [Granulibacter bethesdensis 
CGDNIH4]
Length=448

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = -2

Query  521  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            +A+ AL +Y+  + +  GP+ WL+ISEIFPL  RGRG+++A + N+G+NA+V + F PM 
Sbjct  344  IAIAALSIYIAAFAIGMGPVFWLIISEIFPLHARGRGMAVATVANWGSNAIVAYTFLPML  403

Query  341  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
              VG  + F IF +++VV++ F    +PET G TLE+IE
Sbjct  404  NNVGIISTFLIFALMSVVSIFFTIRFVPETTGQTLEDIE  442



>ref|XP_007510995.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66555.1| predicted protein [Bathycoccus prasinos]
Length=595

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -2

Query  521  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            ++V A+ LYVG YQ+SFGPI WL++ E+FP +VR + + IA L+NFG+N +V+       
Sbjct  483  ISVAAIFLYVGAYQVSFGPIAWLLVGEVFPTKVRSQAVGIATLLNFGSNFIVSLNLPYAI  542

Query  341  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKY  216
            E +G  + +F F  I V++V  ++F + ETKG TLEEIE  Y
Sbjct  543  EQIGIKSTYFGFASIGVLSVASIYFSVVETKGKTLEEIEDAY  584



>ref|XP_003062688.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
 gb|EEH53507.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
Length=510

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = -2

Query  533  NVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAF  354
            N   ++V+A+  YVG YQ+SFGPI WL++ EIFP RVR   +  A L NF +N LV    
Sbjct  403  NTARLSVLAIFAYVGAYQVSFGPIAWLLVGEIFPQRVRSAAVGTATLTNFASNYLVALYL  462

Query  353  SPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
              M    G    ++IF V+ V+A+  ++  +PETKG +LEEIEA+
Sbjct  463  PTMIASYGQAGTYYIFSVMGVIALASIYLTVPETKGKSLEEIEAE  507



>ref|XP_001416926.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO95219.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
Length=530

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = -2

Query  518  AVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKE  339
            +V A+ LYVG YQLSFGPI WL++ E+FP +VR   + +A L NFG+N LV+     ++E
Sbjct  428  SVAAIFLYVGAYQLSFGPIAWLLVGEVFPSKVRSAAVGLATLSNFGSNFLVSLFLPTVQE  487

Query  338  LVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
             VG    +  F  + V+A+  ++F + ET+G TLEEIEA+ +
Sbjct  488  TVGLRGTYLGFASVGVLALASIYFTVVETRGKTLEEIEAELM  529



>gb|ACJ18943.1| D-xylose-proton symporter [Coxiella burnetii CbuG_Q212]
Length=409

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -2

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            +D +  +A  +LL+++  + +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT 
Sbjct  291  MDYMRWIAFGSLLVFISGFSISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTI  350

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
             F  + E +G    FFI+ +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  351  TFLTLIEYLGPSGTFFIYFIISVITLIFIYTSVPETKGVTLEQIE  395



>ref|WP_011997243.1| major facilitator transporter [Coxiella burnetii]
 gb|ABS76630.1| D-xylose-proton symporter [Coxiella burnetii Dugway 5J108-111]
Length=463

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -2

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            +D +  +A  +LL+++  + +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT 
Sbjct  345  MDYMRWIAFGSLLVFISGFSISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTI  404

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
             F  + E +G    FFI+ +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  405  TFLTLIEYLGPSGTFFIYFIISVITLIFIYTSVPETKGVTLEQIE  449



>gb|ACJ19821.1| D-xylose-proton symporter [Coxiella burnetii CbuK_Q154]
Length=409

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -2

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            +D +  +A  +LL+++  + +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT 
Sbjct  291  MDYMRWIAFGSLLVFISGFSISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTI  350

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
             F  + E +G    FFI+ +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  351  TFLTLIEYLGPSGTFFIYFIISVITLIFIYTSVPETKGVTLEQIE  395



>ref|WP_005772424.1| major facilitator transporter [Coxiella burnetii]
 ref|NP_819388.2| D-xylose-proton symporter [Coxiella burnetii RSA 493]
 gb|ABX78561.1| D-xylose-proton symporter [Coxiella burnetii RSA 331]
 gb|EDR36245.1| D-xylose-proton symporter [Coxiella burnetii Q321]
 gb|AAO89902.2| D-xylose-proton symporter [Coxiella burnetii RSA 493]
 gb|AIT62840.1| Sugar transporter (Precursor) [Coxiella burnetii str. Namibia]
Length=463

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -2

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            +D +  +A  +LL+++  + +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT 
Sbjct  345  MDYMRWIAFGSLLVFISGFSISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTI  404

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
             F  + E +G    FFI+ +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  405  TFLTLIEYLGPSGTFFIYFIISVITLIFIYTSVPETKGVTLEQIE  449



>ref|WP_032138490.1| major facilitator transporter [Coxiella burnetii]
Length=463

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -2

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            +D +  +A  +LL+++  + +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT 
Sbjct  345  MDYMRWIAFGSLLVFISGFSISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTI  404

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
             F  + E +G    FFI+ +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  405  TFLTLIEYLGPSGTFFIYFIISVITLIFIYTSVPETKGVTLEQIE  449



>gb|EKE01224.1| hypothetical protein ACD_21C00189G0006 [uncultured bacterium]
Length=460

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = -2

Query  515  VIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKEL  336
            +I  ++Y+  + +SFGPIGWLMISEIFPLRVRG  +S+A    +G N LV   F PM +L
Sbjct  350  LIGSIVYIASFAISFGPIGWLMISEIFPLRVRGLAMSLATATIWGFNMLVILTFIPMIKL  409

Query  335  VGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
            + +  VF I+ V   + +IFV+F++PETK +TLE IEA 
Sbjct  410  LHSSVVFGIYSVFCFLGLIFVYFLVPETKKITLERIEAN  448



>ref|WP_005769170.1| major facilitator transporter [Coxiella burnetii]
 gb|EAX33375.1| D-xylose-proton symporter [Coxiella burnetii 'MSU Goat Q177']
Length=463

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -2

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            +D +  +A  +LL+++  + +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT 
Sbjct  345  MDYMRWIAFGSLLVFISGFSISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTI  404

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
             F  + E +G    FFI+ +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  405  TFLTLIEYLGPSGTFFIYFIISVITLIFIYTSVPETKGVTLEQIE  449



>ref|WP_021863576.1| sugar transporter [Clostridium sp. CAG:715]
 emb|CCX79408.1| sugar transporter [Clostridium sp. CAG:715]
Length=455

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = -2

Query  536  DNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFA  357
            DN+  VAV +L  Y+ C+  S GPIGW+++SE+FPL++RG  +S+  + NF  N  V  +
Sbjct  340  DNLKWVAVGSLATYIICFAFSLGPIGWIIVSEVFPLKIRGLAMSLCTVANFAFNFFVVGS  399

Query  356  FSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            F  +   +G    F+IF  ++++ +IFV+F +PETKG++LE+IE+ ++
Sbjct  400  FPVLIHRIGGAYTFWIFAAVSLLCIIFVYFFVPETKGISLEKIESNWI  447



>ref|XP_002179486.1| TRD4 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49309.1| TRD4, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=467

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = -2

Query  530  VPPVAV-IALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAF  354
            +  VAV +A+ +Y+G YQ+ FGPI WL+ SE++PL +RG+ ++IAV +NF  N  V F  
Sbjct  365  IAKVAVLVAMFVYIGGYQVGFGPITWLLTSELYPLSIRGQAVAIAVQMNFLLNTAVQFGV  424

Query  353  SPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
              ++E++G    F +FG++   ++ FV   +PETKGL+LEEIE
Sbjct  425  PLLQEVIGLSFTFALFGILTAYSIFFVATRVPETKGLSLEEIE  467



>ref|XP_002501745.1| sugar transporter [Micromonas sp. RCC299]
 gb|ACO63003.1| sugar transporter [Micromonas sp. RCC299]
Length=506

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -2

Query  518  AVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKE  339
            +V A+  YVG YQ+SFGPI WL++ EIFP RVR   +  A L NF +N LV+     + E
Sbjct  405  SVAAIFAYVGAYQVSFGPIAWLLVGEIFPQRVRSAAVGTATLTNFFSNFLVSLYLPTLNE  464

Query  338  LVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
             +G    +++F V++VVA+  ++  +PETKG TLEEIE
Sbjct  465  NLGTAGTYYLFSVMSVVALSSIYLTVPETKGKTLEEIE  502



>ref|WP_007429069.1| MFS transporter [Paenibacillus sp. Aloe-11]
 gb|EHS58830.1| sugar transporter [Paenibacillus sp. Aloe-11]
Length=466

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP RVRG+ ++I
Sbjct  342  MTLCLIIIGAAFKMGLTTGPLVLIMILIYVAAYAISLGPIVWVMISEIFPNRVRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F+ FG I++  V F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWTFGAISLFVVFFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_034935483.1| hypothetical protein [Erwinia mallotivora]
 gb|EXU76216.1| hypothetical protein BG55_06355 [Erwinia mallotivora]
Length=488

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 87/130 (67%), Gaps = 9/130 (7%)
 Frame = -2

Query  584  GIAVALFLLGS-YYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGL  408
            G+AV +F LGS +Y+ L   P VA+ A+L YV  + +S+GP+ W++++EIFP R+R + +
Sbjct  349  GMAVGMFTLGSAFYSKLS--PTVALAAMLFYVAAFAISWGPVCWVLLAEIFPNRIRSKAM  406

Query  407  SIAVLVNFGTNALVTFAFSPMKE------LVGAGNvffifgviavvavifvffiIPETKG  246
            S+AV   +  N LV++ F  M +          G  ++++GV+A++A +F++  +PETKG
Sbjct  407  SVAVAAQWIANYLVSWTFPMMDKNSYLNAHFNNGFAYWMYGVMALLAALFMWKYVPETKG  466

Query  245  LTLEEIEAKY  216
             TLEE+EA++
Sbjct  467  RTLEELEAQW  476



>gb|EKE10022.1| sugar transporter [uncultured bacterium]
Length=164

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  584  GIAVALFLLGSYYTFL-DNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGL  408
            G+A +L +LG+ + F  D +   AV ++L+YV  + +S GP+ WL+ISE++PL +RGR +
Sbjct  39   GMAFSLIVLGTTFLFKGDALGLAAVASMLVYVAFFAVSLGPVAWLIISEVYPLGIRGRAM  98

Query  407  SIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEI  228
             IA   N+  N +V+  F  + E +     F+++  I ++++ FV  ++PETKG T EEI
Sbjct  99   GIATFANWTANYIVSLTFLTLIEQLTITGTFWLYAAICLLSLWFVMVLVPETKGKTFEEI  158

Query  227  E  225
            +
Sbjct  159  Q  159



>ref|WP_042531766.1| major facilitator transporter [Oceanobacillus oncorhynchi]
 emb|CEI82150.1| D-xylose-proton symporter [Oceanobacillus oncorhynchi]
Length=470

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  584  GIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLS  405
            G+AV +F + +   +LD +   A+I +L++V  Y LSFGP+ W++ SE+FP +VRG+ ++
Sbjct  337  GMAVGMFGVAAL-AYLDQMGIGALIFILIFVAFYNLSFGPLMWVLASELFPNKVRGQIMA  395

Query  404  IAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
            I V+ N+G+N L++  F  + E  GAG  +  +G++ V+A++FV  ++PETKG TLEEIE
Sbjct  396  ITVVANWGSNLLISSTFPSLLEF-GAGFAYTFYGIMCVLALLFVLKLVPETKGKTLEEIE  454

Query  224  AKY  216
             KY
Sbjct  455  -KY  456



>ref|WP_035532302.1| major facilitator transporter [Halobacillus kuroshimensis]
Length=484

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = -2

Query  584  GIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLS  405
            G+AV +F + +   F  ++   A+I++L++V  Y LSFGP+ W++ SE+FP ++RG+ ++
Sbjct  340  GMAVGMFGIAAL-AFAGSMGVGALISILVFVAFYNLSFGPLTWVLASELFPNKIRGQVMA  398

Query  404  IAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
            + V VN+G+N LV+  F  + E+ GAG  + ++G++ V++  FV+ ++PETKG TLEEIE
Sbjct  399  LTVAVNWGSNLLVSTTFPTLLEM-GAGFTYGLYGLMCVLSFAFVWKLVPETKGKTLEEIE  457

Query  224  AKYLT  210
              +L+
Sbjct  458  QYWLS  462



>ref|WP_044786399.1| MFS transporter [Paenibacillus polymyxa]
 gb|KJD39913.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLIIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_016821403.1| MULTISPECIES: MFS transporter [Paenibacillus]
 gb|AHM64706.1| sugar transporter [Paenibacillus polymyxa SQR-21]
 gb|AIY10329.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLIIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_019686308.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLIIIGAAFKIGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_013369675.1| MFS transporter [Paenibacillus polymyxa]
 gb|ADO55042.1| Sugar transporter [Paenibacillus polymyxa SC2]
 emb|CCC83913.1| arabinose-proton symporter Arabinose transporter [Paenibacillus 
polymyxa M1]
Length=466

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_025675784.1| MFS transporter [Paenibacillus polymyxa]
 gb|AJE50781.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F+IFG I++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGAISLFVVVFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_025722405.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = -2

Query  587  SGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGL  408
            S + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ +
Sbjct  340  SLMTLCLVIIGAAFKLGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAV  399

Query  407  SIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEI  228
            +IA +  +  + LV+ AF P+    G  N F++FG I++  VIF++  +PETKG +LE++
Sbjct  400  AIASMALWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVIFLWRKVPETKGRSLEQM  459

Query  227  EAKYL  213
            E  +L
Sbjct  460  ENMWL  464



>ref|WP_023987284.1| MFS transporter [Paenibacillus polymyxa]
 ref|YP_008910510.1| MFS transporter [Paenibacillus polymyxa CR1]
 gb|AHC18659.1| MFS transporter [Paenibacillus polymyxa CR1]
Length=466

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F++FG I++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVVFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_036581666.1| MFS transporter [Paenibacillus darwinianus]
 gb|EXX87521.1| MFS transporter [Paenibacillus darwinianus]
 gb|EXX88411.1| MFS transporter [Paenibacillus darwinianus]
 gb|EXX88752.1| MFS transporter [Paenibacillus darwinianus]
Length=468

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = -2

Query  557  GSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGT  378
            G++YT L    P+ +I +L+YV  + +S GP+ W+M+SEIFP RVRG  ++IA +  +G 
Sbjct  353  GAFYTGLTT-GPLVLIFILVYVAAFAISLGPVVWVMLSEIFPNRVRGIAIAIASVALWGG  411

Query  377  NALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKY  216
            + +V+  F PM E  GA   F+IFG  ++    F +  +PETKG TLE++EA +
Sbjct  412  DYVVSQMFPPMLEFAGAAMTFWIFGAASLFTFFFTWRSVPETKGKTLEDMEAMW  465



>ref|WP_028543212.1| MFS transporter [Paenibacillus sp. UNCCL52]
Length=466

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F++FG I++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVVFLWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_014280112.1| MFS transporter [Paenibacillus terrae]
 gb|AET59385.1| sugar transporter [Paenibacillus terrae HPL-003]
Length=466

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++I
Sbjct  342  MTLCLVIIGAAFKMGLTTGPLVLIMILIYVAAYAISLGPIVWVMISEIFPNRIRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+ AF P+    G  N F+IFGVI++  V F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQAFPPLLSSAGPSNTFWIFGVISLFVVFFIWRKVPETKGRSLEQMEN  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_029516079.1| MFS transporter [Paenibacillus polymyxa]
 gb|KEO80016.1| MFS transporter [Paenibacillus polymyxa]
Length=466

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = -2

Query  569  LFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLV  390
            L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP R+RG+ ++IA + 
Sbjct  346  LVIIGAAFKMGLTTGPLVLIMILIYVASYAISLGPIVWVMISEIFPNRIRGKAVAIASMA  405

Query  389  NFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
             +  + LV+ AF P+    G  N F++FG I++  V+F++  +PETKG +LE++E  +L
Sbjct  406  LWAGDYLVSQAFPPLLSSAGPSNTFWLFGAISLFVVVFIWRKVPETKGRSLEQMENMWL  464



>ref|XP_005645204.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20660.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
Length=564

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = -2

Query  521  VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
             +VIALL+YV     SFGPI WL++ EIFPL VRG   ++A + NFG+N LV+     ++
Sbjct  463  TSVIALLMYV-----SFGPISWLIVGEIFPLAVRGPASALATITNFGSNFLVSLVLPSVQ  517

Query  341  ELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            E  G G  +  F  I VVA+  +F I+PETKG TLEEIEA
Sbjct  518  EAFGPGGTYLAFAGIGVVALATIFAIVPETKGKTLEEIEA  557



>ref|WP_017577029.1| hypothetical protein [Nocardiopsis kunsanensis]
Length=464

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 80/123 (65%), Gaps = 3/123 (2%)
 Frame = -2

Query  584  GIAVALFLLGSYYTFLDNVPPVAVIALLL-YVGCYQLSFGPIGWLMISEIFPLRVRGRGL  408
            G+A +LFLLG    F  + P   ++ALL+ Y+  + +S GP+ WL+++EIFPLRVRG  +
Sbjct  321  GMAGSLFLLG--IAFGTDAPGFLLVALLMIYISVFAVSLGPVVWLLLAEIFPLRVRGAAM  378

Query  407  SIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEI  228
            S    + +  N +V   F PM E + A   F+++ VI V++ +FV F +PETKG TLEEI
Sbjct  379  SFGSALLWAANFVVALVFLPMVEAITASGAFWVYTVICVLSFLFVLFKVPETKGRTLEEI  438

Query  227  EAK  219
            EA+
Sbjct  439  EAE  441



>ref|WP_036621919.1| MFS transporter [Paenibacillus macerans]
 gb|KFN09600.1| MFS transporter, sugar porter family protein [Paenibacillus macerans]
Length=466

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + + L ++G+ +       P+ +I +L+YV  Y +S GPI W+MISEIFP RVRG+ ++I
Sbjct  342  MTICLAVIGAAFKMDLTAGPLVLIMILIYVAAYAISLGPIVWVMISEIFPNRVRGKAVAI  401

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            A +  +  + LV+  F P+    G  N F+ FGVI++  V+F++  +PETKG +LE++E 
Sbjct  402  ASMALWAGDYLVSQLFPPLLSSAGPSNTFWTFGVISLFVVVFIWRKVPETKGRSLEQMEH  461

Query  221  KYL  213
             +L
Sbjct  462  MWL  464



>ref|WP_037344745.1| major facilitator transporter [Sciscionella sp. SE31]
Length=454

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -2

Query  581  IAVALFLLGSYYTFLDNVPP-VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLS  405
            +AV L LL   + F  + P  ++V AL+ +VG + +  GP  WL+ SEI+PLR+R R   
Sbjct  319  MAVCLALLA--FVFSASAPGWLSVTALMAFVGAFAIGLGPAFWLINSEIYPLRLRARAAG  376

Query  404  IAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIE  225
            +A ++ FG+NA+V+  F P+ EL+G   VF ++  + + AV+F++  +PET+G +LEEIE
Sbjct  377  LATMMIFGSNAIVSITFLPLVELLGQAQVFLLYLALTIAAVLFMYRWVPETRGRSLEEIE  436



>gb|EKD46018.1| hypothetical protein ACD_69C00046G0001 [uncultured bacterium]
Length=458

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -2

Query  587  SGIAVALFLLGSYYTFLDN----VPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVR  420
            +G+ ++L +L   + FL      +     I +++Y+  + +SFGPIGWL+ISE+FPLR+R
Sbjct  320  TGMMLSLLMLSITFEFLQKDSVLLTWFLFINVIIYLASFAISFGPIGWLIISEMFPLRIR  379

Query  419  GRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLT  240
            G   S+A    +G N LV F F P+  L+  G VF ++ ++  +++ FV+F++PET+ ++
Sbjct  380  GLATSLATGTIWGVNLLVIFTFLPLMRLMQLGGVFLLYSILCFLSLFFVYFLVPETRNVS  439

Query  239  LEEIEAK  219
            LE IE  
Sbjct  440  LEHIETN  446



>ref|XP_003971733.1| PREDICTED: solute carrier family 2, facilitated glucose transporter 
member 12-like [Takifugu rubripes]
Length=543

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 69/112 (62%), Gaps = 0/112 (0%)
 Frame = -2

Query  554  SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTN  375
            S  T   ++   ++I+LL+YV  + +S GP+ +++ISEIFP+ VRGR +S+   VN+ TN
Sbjct  399  SNETAASSLKIASLISLLVYVAAFSVSLGPMVYVVISEIFPMGVRGRAVSVVAAVNWATN  458

Query  374  ALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
             L++  F  + E  G  N+ F    +    ++FV   +PETKGLTLEEI  +
Sbjct  459  LLISMTFLTITEKAGVPNIMFFHSAMCFALLVFVILCVPETKGLTLEEISKE  510



>ref|WP_010641003.1| major facilitator transporter [Acidithiobacillus thiooxidans]
Length=456

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  497  YVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNv  318
            +V  + +S GPI WL+ISEIFPL +RGR +S+A ++N+ +N LV   F  +   +G G  
Sbjct  359  FVAFFAMSLGPIFWLLISEIFPLAIRGRAMSLATVINWLSNMLVAGVFLDLVGAIGRGAT  418

Query  317  ffifgviavvavifvffiIPETKGLTLEEIEAKYLT  210
            F I+ ++  +A++F   ++PETKGL+LEEIE ++++
Sbjct  419  FLIYALMTFLAILFTLKLVPETKGLSLEEIERQFIS  454



>ref|WP_031572590.1| major facilitator transporter [Acidithiobacillus thiooxidans]
Length=456

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  497  YVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNv  318
            +V  + +S GPI WL+ISEIFPL +RGR +S+A ++N+ +N LV   F  +   +G G  
Sbjct  359  FVAFFAMSLGPIFWLLISEIFPLAIRGRAMSLATVINWLSNMLVAGVFLDLVGAIGRGAT  418

Query  317  ffifgviavvavifvffiIPETKGLTLEEIEAKYLT  210
            F I+ ++  +A++F   ++PETKGL+LEEIE ++++
Sbjct  419  FLIYALMTFLAILFTLKLVPETKGLSLEEIERQFIS  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250