BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049A23

Length=446
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAC98299.1|  LEXYL2                                                 135   3e-34   Solanum lycopersicum
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    135   1e-33   
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   2e-33   Solanum tuberosum [potatoes]
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   4e-33   Solanum tuberosum [potatoes]
ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   1e-32   Nicotiana tomentosiformis
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   2e-32   Nicotiana sylvestris
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    129   1e-31   Sesamum indicum [beniseed]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    129   3e-31   
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    128   4e-31   
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    127   5e-31   Sesamum indicum [beniseed]
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    127   7e-31   
gb|KCW63063.1|  hypothetical protein EUGRSUZ_G00654                     126   1e-30   Eucalyptus grandis [rose gum]
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      126   1e-30   Solanum lycopersicum
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    126   1e-30   Fragaria vesca subsp. vesca
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             126   2e-30   Prunus persica
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    126   2e-30   Eucalyptus grandis [rose gum]
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    126   2e-30   Nicotiana tomentosiformis
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   3e-30   Prunus mume [ume]
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   4e-30   Fragaria vesca subsp. vesca
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   5e-30   Nicotiana sylvestris
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   5e-30   Fragaria vesca subsp. vesca
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    124   6e-30   
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    124   7e-30   Sesamum indicum [beniseed]
emb|CDO97479.1|  unnamed protein product                                124   7e-30   Coffea canephora [robusta coffee]
emb|CAN78858.1|  hypothetical protein VITISV_030325                     124   9e-30   Vitis vinifera
gb|KCW63060.1|  hypothetical protein EUGRSUZ_G00652                     120   3e-29   Eucalyptus grandis [rose gum]
ref|XP_010068199.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    120   5e-29   Eucalyptus grandis [rose gum]
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    122   5e-29   Populus euphratica
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    122   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI20072.3|  unnamed protein product                                118   7e-29   Vitis vinifera
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         121   1e-28   Jatropha curcas
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    121   1e-28   Eucalyptus grandis [rose gum]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      120   2e-28   Morus notabilis
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                120   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_002298197.2|  beta-glucosidase family protein                    120   2e-28   
gb|KJB31997.1|  hypothetical protein B456_005G218000                    119   2e-28   Gossypium raimondii
gb|ACL53913.1|  unknown                                                 117   5e-28   Zea mays [maize]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    119   5e-28   Elaeis guineensis
gb|AFW59618.1|  putative O-Glycosyl hydrolase superfamily protein       117   7e-28   
ref|NP_001146416.1|  uncharacterized protein LOC100279996               117   7e-28   
ref|XP_002303181.1|  beta-glucosidase family protein                    119   8e-28   
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    119   9e-28   Eucalyptus grandis [rose gum]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             118   1e-27   Citrus clementina [clementine]
ref|XP_008661823.1|  PREDICTED: uncharacterized protein LOC100279...    117   2e-27   Zea mays [maize]
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                117   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    117   2e-27   Eucalyptus grandis [rose gum]
gb|KCW63062.1|  hypothetical protein EUGRSUZ_G006531                    117   3e-27   Eucalyptus grandis [rose gum]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    117   3e-27   
emb|CBI40687.3|  unnamed protein product                                117   3e-27   Vitis vinifera
gb|KJB31996.1|  hypothetical protein B456_005G218000                    115   4e-27   Gossypium raimondii
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    117   4e-27   Eucalyptus grandis [rose gum]
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    117   4e-27   Vitis vinifera
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              117   4e-27   Populus tremula x Populus alba [gray poplar]
ref|XP_007043027.1|  Beta-D-xylosidase 4                                117   4e-27   
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          116   4e-27   Sorghum bicolor [broomcorn]
ref|XP_009407358.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    116   5e-27   
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        116   5e-27   Medicago truncatula
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    116   6e-27   Medicago sativa subsp. x varia
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           116   6e-27   Gossypium arboreum [tree cotton]
ref|XP_002513707.1|  Beta-glucosidase, putative                         116   8e-27   Ricinus communis
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    116   8e-27   Vitis vinifera
ref|NP_001054038.1|  Os04g0640700                                       115   1e-26   
gb|EEE61783.1|  hypothetical protein OsJ_16354                          115   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    115   1e-26   Citrus sinensis [apfelsine]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    115   1e-26   Gossypium raimondii
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                115   1e-26   Erythranthe guttata [common monkey flower]
emb|CAE03635.1|  OSJNBb0003B01.27                                       115   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                115   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             115   2e-26   Phaseolus vulgaris [French bean]
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    114   2e-26   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    114   2e-26   Populus euphratica
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    114   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                114   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN39204.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           113   4e-26   Glycine soja [wild soybean]
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     114   4e-26   Setaria italica
gb|ACH60354.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           105   4e-26   Pseudotsuga menziesii
gb|KHN26728.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           113   5e-26   Glycine soja [wild soybean]
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    113   6e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    113   6e-26   
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    113   7e-26   Glycine max [soybeans]
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    113   7e-26   Cucumis melo [Oriental melon]
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                113   8e-26   
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    113   8e-26   
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    113   9e-26   
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    112   1e-25   Hordeum vulgare [barley]
dbj|BAK03439.1|  predicted protein                                      112   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                112   2e-25   Brachypodium distachyon [annual false brome]
dbj|BAJ90420.1|  predicted protein                                      112   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                      112   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    111   3e-25   Cicer arietinum [garbanzo]
dbj|BAK01582.1|  predicted protein                                      111   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN33504.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           111   3e-25   Glycine soja [wild soybean]
gb|ACH60351.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           103   4e-25   Pseudotsuga menziesii
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    111   4e-25   Glycine max [soybeans]
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    110   6e-25   Nelumbo nucifera [Indian lotus]
gb|EMT32951.1|  Beta-D-xylosidase 4                                     110   1e-24   
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    109   2e-24   Glycine max [soybeans]
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             108   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     108   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                107   6e-24   Brassica rapa
ref|NP_201262.1|  beta-D-xylosidase 4                                   107   6e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94481.1|  beta-xylosidase                                        105   2e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31313.1|  BnaA02g34280D                                          106   2e-23   Brassica napus [oilseed rape]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             105   3e-23   Eutrema salsugineum [saltwater cress]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    105   4e-23   Medicago truncatula
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    105   5e-23   Medicago sativa subsp. x varia
dbj|BAD94522.1|  beta-xylosidase - like protein                         102   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    104   8e-23   Cicer arietinum [garbanzo]
ref|XP_002866623.1|  beta-xylosidase 4                                  104   1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                103   1e-22   Camelina sativa [gold-of-pleasure]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    103   1e-22   Gossypium raimondii
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           103   2e-22   Gossypium arboreum [tree cotton]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            103   2e-22   Raphanus sativus
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    103   3e-22   Arabis alpina [alpine rockcress]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             103   3e-22   Capsella rubella
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             102   4e-22   Phaseolus vulgaris [French bean]
ref|NP_196535.1|  beta-xylosidase 3                                     102   5e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46812.1|  BnaC02g43200D                                          102   5e-22   Brassica napus [oilseed rape]
emb|CDY51290.1|  BnaA06g23560D                                          101   8e-22   Brassica napus [oilseed rape]
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     101   8e-22   Brassica rapa
emb|CDY56487.1|  BnaCnng30450D                                          101   8e-22   Brassica napus [oilseed rape]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          101   1e-21   Amborella trichopoda
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    101   1e-21   Arabis alpina [alpine rockcress]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     101   1e-21   Camelina sativa [gold-of-pleasure]
gb|AFG54596.1|  hypothetical protein 0_6952_01                        94.7    1e-21   Pinus taeda
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     101   1e-21   Camelina sativa [gold-of-pleasure]
gb|AFG54601.1|  hypothetical protein 0_6952_01                        94.7    1e-21   Pinus taeda
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          100   1e-21   Camelina sativa [gold-of-pleasure]
gb|AFG54595.1|  hypothetical protein 0_6952_01                        94.7    1e-21   Pinus taeda
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          100   2e-21   Camelina sativa [gold-of-pleasure]
emb|CAB89360.1|  beta-glucosidase-like protein                        98.6    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AFG54602.1|  hypothetical protein 0_6952_01                        94.4    2e-21   Pinus taeda
emb|CDY18705.1|  BnaA09g06900D                                          100   2e-21   Brassica napus [oilseed rape]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              100   2e-21   
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                100   3e-21   Brassica rapa
ref|XP_002873418.1|  beta-xylosidase 3                                  100   3e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                100   3e-21   Brassica rapa
emb|CDX97115.1|  BnaC09g45100D                                        99.8    4e-21   
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase            99.8    4e-21   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase            99.8    4e-21   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase            99.8    5e-21   
ref|NP_196532.2|  Glycosyl hydrolase family protein                   98.2    6e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35825.1|  BnaC09g37570D                                        99.0    8e-21   Brassica napus [oilseed rape]
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                   99.0    8e-21   Tarenaya hassleriana [spider flower]
emb|CDX81229.1|  BnaC09g06400D                                        99.0    8e-21   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor             98.2    1e-20   Malus domestica [apple tree]
emb|CDX69892.1|  BnaA10g22410D                                        97.8    2e-20   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase            96.3    6e-20   
emb|CDY01780.1|  BnaC06g28200D                                        96.3    8e-20   
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative           95.5    1e-19   
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like              94.7    2e-19   Camelina sativa [gold-of-pleasure]
emb|CDP17082.1|  unnamed protein product                              90.5    2e-19   Coffea canephora [robusta coffee]
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase            94.4    3e-19   Eucalyptus grandis [rose gum]
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                   94.0    4e-19   Eucalyptus grandis [rose gum]
dbj|BAF79669.1|  beta-D-xylosidase                                    94.0    4e-19   Pyrus pyrifolia [sha li]
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase      94.0    4e-19   Pyrus pyrifolia [sha li]
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like              94.0    4e-19   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2       94.0    4e-19   Pyrus x bretschneideri [bai li]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                          93.2    7e-19   Glycine soja [wild soybean]
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like     93.2    9e-19   Glycine max [soybeans]
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg           92.8    1e-18   
gb|EPS65933.1|  hypothetical protein M569_08842                       92.4    1e-18   Genlisea aurea
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like     92.0    2e-18   Solanum tuberosum [potatoes]
gb|KJB49844.1|  hypothetical protein B456_008G140600                  92.0    2e-18   Gossypium raimondii
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2          91.7    3e-18   Populus euphratica
gb|KDO71842.1|  hypothetical protein CISIN_1g0062242mg                89.4    3e-18   Citrus sinensis [apfelsine]
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg           91.7    3e-18   Citrus clementina [clementine]
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2          91.3    4e-18   Populus euphratica
gb|AEW09080.1|  hypothetical protein CL3618Contig1_02                 84.7    4e-18   Pinus lambertiana
gb|KDO71844.1|  hypothetical protein CISIN_1g0062242mg                90.1    4e-18   Citrus sinensis [apfelsine]
gb|KDO71845.1|  hypothetical protein CISIN_1g0062242mg                90.1    4e-18   Citrus sinensis [apfelsine]
gb|ABK96385.1|  unknown                                               88.6    4e-18   Populus trichocarpa x Populus deltoides
gb|KDO71843.1|  hypothetical protein CISIN_1g0062242mg                90.1    4e-18   Citrus sinensis [apfelsine]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2          90.9    4e-18   Nicotiana tomentosiformis
ref|XP_002316021.1|  beta-D-xylosidase family protein                 90.9    5e-18   Populus trichocarpa [western balsam poplar]
gb|KDO71849.1|  hypothetical protein CISIN_1g0062242mg                89.0    6e-18   Citrus sinensis [apfelsine]
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg              90.5    6e-18   Erythranthe guttata [common monkey flower]
emb|CDO98788.1|  unnamed protein product                              90.5    7e-18   Coffea canephora [robusta coffee]
gb|KDO87030.1|  hypothetical protein CISIN_1g0041901mg                89.7    7e-18   Citrus sinensis [apfelsine]
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                     90.5    7e-18   Solanum lycopersicum
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase            90.5    7e-18   Nelumbo nucifera [Indian lotus]
emb|CDX96113.1|  BnaA07g26180D                                        90.5    8e-18   
ref|XP_010094323.1|  Beta-D-xylosidase 1                              90.1    8e-18   Morus notabilis
ref|XP_010087253.1|  putative beta-D-xylosidase 2                     90.1    9e-18   Morus notabilis
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase            90.1    1e-17   Populus euphratica
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2          89.7    1e-17   Nelumbo nucifera [Indian lotus]
gb|AEW09079.1|  hypothetical protein CL3618Contig1_02                 83.2    1e-17   Pinus radiata
gb|KJB38535.1|  hypothetical protein B456_006G259500                  89.7    1e-17   Gossypium raimondii
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2          89.4    2e-17   Populus euphratica
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g           89.0    2e-17   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2          89.0    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2          89.0    2e-17   Sesamum indicum [beniseed]
ref|XP_010652235.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  88.6    3e-17   Vitis vinifera
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2          88.6    3e-17   Glycine max [soybeans]
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                     88.6    3e-17   Gossypium arboreum [tree cotton]
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like              88.6    3e-17   Brassica rapa
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  88.2    4e-17   Vitis vinifera
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2          88.2    5e-17   Nicotiana sylvestris
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase            87.8    6e-17   Populus euphratica
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2          87.8    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2          87.8    6e-17   Camelina sativa [gold-of-pleasure]
gb|KHG28205.1|  putative beta-D-xylosidase 2 -like protein            87.0    7e-17   Gossypium arboreum [tree cotton]
gb|ADV41671.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         87.0    8e-17   Actinidia deliciosa var. deliciosa
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2          87.4    8e-17   Brassica rapa
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222           87.4    8e-17   
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase            87.0    9e-17   Prunus mume [ume]
ref|XP_006306830.1|  hypothetical protein CARUB_v10008371mg           87.0    1e-16   
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein            87.0    1e-16   Gossypium arboreum [tree cotton]
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase            87.0    1e-16   Vitis vinifera
emb|CDX89954.1|  BnaA10g01280D                                        87.0    1e-16   
gb|KJB72795.1|  hypothetical protein B456_011G198200                  87.0    1e-16   Gossypium raimondii
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         87.0    1e-16   Prunus salicina [Japanese plum]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg           87.0    1e-16   Capsella rubella
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         87.0    1e-16   Prunus salicina [Japanese plum]
gb|AFG60329.1|  hypothetical protein CL3618Contig1_02                 80.5    1e-16   Pinus taeda
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like              86.7    1e-16   Cucumis sativus [cucumbers]
gb|AAG10624.1|AC022521_2  Similar to xylosidase                       86.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28242.1|  hypothetical protein JCGZ_14013                       86.7    2e-16   Jatropha curcas
emb|CDY15255.1|  BnaC05g01340D                                        86.3    2e-16   Brassica napus [oilseed rape]
ref|NP_563659.1|  probable beta-D-xylosidase 2                        86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g           86.3    2e-16   
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                     85.9    3e-16   
gb|KJB09457.1|  hypothetical protein B456_001G143600                  85.9    3e-16   Gossypium raimondii
gb|ACD93208.1|  beta xylosidase                                       85.9    3e-16   Camellia sinensis [black tea]
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg           85.9    3e-16   Prunus persica
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg           85.9    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2          85.9    3e-16   Sesamum indicum [beniseed]
ref|XP_010313018.1|  PREDICTED: slArf/Xyl1 protein isoform X1         85.5    3e-16   Solanum lycopersicum
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                   85.5    4e-16   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI22910.3|  unnamed protein product                              85.1    4e-16   Vitis vinifera
ref|XP_007051080.1|  Beta-xylosidase 2                                85.5    4e-16   
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120        85.1    6e-16   Amborella trichopoda
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2          84.7    6e-16   Tarenaya hassleriana [spider flower]
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  84.7    6e-16   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                       84.7    6e-16   Jatropha curcas
dbj|BAF43576.1|  arabinofuranosidase/xylosidase homolog               82.4    8e-16   Prunus persica
ref|XP_004172482.1|  PREDICTED: beta-D-xylosidase 1-like              84.0    9e-16   
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like              84.0    1e-15   Solanum tuberosum [potatoes]
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2          84.0    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_002515300.1|  Beta-glucosidase, putative                       83.6    2e-15   Ricinus communis
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                  83.6    2e-15   Arabis alpina [alpine rockcress]
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g           83.6    2e-15   Phaseolus vulgaris [French bean]
ref|XP_002311398.2|  beta-D-xylosidase family protein                 83.6    2e-15   
sp|P83344.1|XYNB_PRUPE  RecName: Full=Putative beta-D-xylosidase;...  82.4    2e-15   Prunus persica
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2          83.2    2e-15   Cucumis melo [Oriental melon]
emb|CAJ41429.1|  beta (1,4)-xylosidase                                82.8    3e-15   Populus tremula x Populus alba [gray poplar]
dbj|BAC41913.1|  putative beta-xylosidase                             82.4    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g           82.4    4e-15   Phaseolus vulgaris [French bean]
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2          82.0    5e-15   Eucalyptus grandis [rose gum]
ref|NP_196618.1|  putative beta-D-xylosidase 6                        82.0    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KCW58371.1|  hypothetical protein EUGRSUZ_H010551                  81.6    6e-15   Eucalyptus grandis [rose gum]
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2          82.0    6e-15   Pyrus x bretschneideri [bai li]
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2          81.6    8e-15   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg           81.3    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...  81.3    1e-14   Ricinus communis
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2          81.3    1e-14   Fragaria vesca subsp. vesca
dbj|BAJ51947.1|  putative beta-D-xylosidase                           78.2    1e-14   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_001784462.1|  predicted protein                                80.9    1e-14   
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2          80.5    2e-14   Elaeis guineensis
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg           80.5    2e-14   
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  80.5    2e-14   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like     80.5    2e-14   Cucumis sativus [cucumbers]
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase            80.5    2e-14   Fragaria vesca subsp. vesca
gb|AAS17751.2|  beta xylosidase                                       80.5    2e-14   Fragaria x ananassa
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6          80.1    2e-14   
ref|XP_003625957.1|  Beta-xylosidase                                  80.1    3e-14   Medicago truncatula
dbj|BAO45878.1|  beta-D-xylosidase                                    80.1    3e-14   Acacia mangium
gb|AAP83934.1|  auxin-induced beta-glucosidase                        79.7    3e-14   Oxybasis rubra [pigweed]
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg              79.7    4e-14   Erythranthe guttata [common monkey flower]
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                  79.7    4e-14   Arabis alpina [alpine rockcress]
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein              79.3    4e-14   Arabidopsis lyrata subsp. lyrata
gb|KCW59657.1|  hypothetical protein EUGRSUZ_H02409                   79.0    5e-14   Eucalyptus grandis [rose gum]
ref|XP_003591420.1|  Beta xylosidase                                  79.0    6e-14   Medicago truncatula
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6          79.0    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010023414.1|  PREDICTED: probable beta-D-xylosidase 6          78.6    9e-14   Eucalyptus grandis [rose gum]
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase        78.2    1e-13   Persea americana
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like              78.2    1e-13   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2          78.2    1e-13   
gb|KHN14659.1|  Beta-D-xylosidase 1                                   77.8    1e-13   
emb|CDX97026.1|  BnaC09g45990D                                        77.8    2e-13   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6          77.8    2e-13   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like              77.8    2e-13   
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102            77.4    2e-13   
gb|KHN19223.1|  Putative beta-D-xylosidase 2                          77.0    3e-13   
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6          77.0    3e-13   
gb|KJB44020.1|  hypothetical protein B456_007G230000                  77.0    3e-13   
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1        76.6    3e-13   
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1   76.6    4e-13   
emb|CDY49607.1|  BnaA09g03310D                                        76.6    4e-13   
gb|KHN12900.1|  Beta-D-xylosidase 1                                   76.3    5e-13   
ref|XP_009609889.1|  PREDICTED: putative beta-D-xylosidase            75.9    5e-13   
emb|CDY21595.1|  BnaC09g46970D                                        76.6    5e-13   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like              76.3    5e-13   
ref|XP_011026854.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  76.3    5e-13   
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like              76.3    5e-13   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like     76.3    6e-13   
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  75.5    9e-13   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2          75.1    1e-12   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg           75.1    1e-12   
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like     74.7    2e-12   
emb|CDX69822.1|  BnaA10g21710D                                        74.7    2e-12   
gb|ABY48135.1|  beta-D-xylosidase                                     74.7    2e-12   
ref|XP_003612944.1|  Beta-D-xylosidase                                74.7    2e-12   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like     74.3    2e-12   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                74.3    2e-12   
ref|XP_010105119.1|  putative beta-D-xylosidase 6                     74.3    2e-12   
gb|KHN38910.1|  Putative beta-D-xylosidase 6                          73.9    3e-12   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg           73.9    3e-12   
gb|KDP32160.1|  hypothetical protein JCGZ_12621                       73.9    3e-12   
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                  73.9    3e-12   
dbj|BAF02134.1|  xylosidase                                           71.6    3e-12   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like              73.9    3e-12   
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like     73.9    3e-12   
ref|XP_010442400.1|  PREDICTED: beta-D-xylosidase 1-like              73.6    3e-12   
emb|CDY05634.1|  BnaC02g39030D                                        73.9    4e-12   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                 73.6    4e-12   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                 73.6    4e-12   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like     73.6    4e-12   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg           73.6    4e-12   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like     73.6    4e-12   
emb|CBI25718.3|  unnamed protein product                              73.6    5e-12   
ref|XP_002527213.1|  Thermostable beta-glucosidase B, putative        72.8    5e-12   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6          73.6    5e-12   
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733           73.6    5e-12   
ref|XP_004512546.1|  PREDICTED: probable beta-D-xylosidase 6-like     73.6    5e-12   
gb|KHN43468.1|  Putative beta-D-xylosidase 2                          73.6    5e-12   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6          73.2    6e-12   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6          73.2    6e-12   
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like              72.8    7e-12   
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  72.8    7e-12   
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g           72.8    7e-12   
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg           72.8    7e-12   
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  72.8    8e-12   
ref|XP_001775759.1|  predicted protein                                72.8    8e-12   
emb|CDX85405.1|  BnaC07g27160D                                        72.8    9e-12   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                   72.4    9e-12   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                   72.4    1e-11   
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like              72.4    1e-11   
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                   72.0    1e-11   
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g           72.0    1e-11   
ref|XP_002865732.1|  beta-xylosidase 1                                72.0    1e-11   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like              72.0    2e-11   
emb|CDY33913.1|  BnaA02g30740D                                        72.0    2e-11   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...  71.6    2e-11   
ref|XP_010527498.1|  PREDICTED: probable beta-D-xylosidase 6          71.6    2e-11   
gb|AFK46503.1|  unknown                                               68.2    2e-11   
ref|NP_001053392.1|  Os04g0530700                                     71.2    3e-11   
gb|AHA84291.1|  beta-D-xylosidase                                     68.2    3e-11   
emb|CAJ86207.1|  B1011H02.4                                           71.2    3e-11   
dbj|BAG28345.1|  arabinofuranosidase                                  70.9    3e-11   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6          70.9    3e-11   
gb|EEE61389.1|  hypothetical protein OsJ_15562                        70.9    3e-11   
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5          70.9    3e-11   
gb|KGN48676.1|  hypothetical protein Csa_6G497270                     70.5    4e-11   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like     70.5    4e-11   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like     70.5    4e-11   
emb|CDY00033.1|  BnaC09g02680D                                        70.5    4e-11   
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...  70.5    4e-11   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6          70.5    5e-11   
ref|XP_006653619.1|  PREDICTED: probable beta-D-xylosidase 6-like     70.5    5e-11   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5          70.5    5e-11   
emb|CDP20993.1|  unnamed protein product                              65.1    7e-11   
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6          69.7    8e-11   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  69.3    1e-10   
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like     69.3    1e-10   
ref|XP_003594795.1|  Beta xylosidase                                  68.6    2e-10   
ref|XP_006850394.1|  hypothetical protein AMTR_s00184p00056440        68.6    2e-10   
ref|XP_010111676.1|  putative beta-D-xylosidase 5                     68.6    2e-10   
ref|XP_002448225.1|  hypothetical protein SORBIDRAFT_06g023450        68.2    2e-10   
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6          68.2    3e-10   
gb|EPS60429.1|  hypothetical protein M569_14372                       67.8    3e-10   
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  67.8    3e-10   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6          67.8    4e-10   
gb|KHG29436.1|  putative beta-D-xylosidase 5 -like protein            67.0    4e-10   
emb|CDO97277.1|  unnamed protein product                              67.8    4e-10   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6          67.8    4e-10   
gb|KHN24914.1|  Putative beta-D-xylosidase 7                          67.4    5e-10   
emb|CDP02677.1|  unnamed protein product                              67.4    5e-10   
ref|XP_009390582.1|  PREDICTED: probable beta-D-xylosidase 7          66.6    9e-10   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like     66.6    1e-09   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...  66.2    1e-09   
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7          66.2    1e-09   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg           66.2    1e-09   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like              65.9    1e-09   
gb|AES97966.2|  glycoside hydrolase family 3 protein                  65.9    1e-09   
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                        65.9    1e-09   
ref|XP_002527511.1|  Beta-glucosidase, putative                       65.9    2e-09   
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140        65.9    2e-09   
ref|XP_007141155.1|  hypothetical protein PHAVU_008G171800g           63.9    2e-09   
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6          65.5    2e-09   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...  65.5    2e-09   
gb|ACG29242.1|  auxin-induced beta-glucosidase                        65.5    2e-09   
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g           65.5    2e-09   
ref|NP_001167905.1|  uncharacterized protein LOC100381616             64.7    3e-09   
tpg|DAA36709.1|  TPA: putative O-Glycosyl hydrolase superfamily p...  64.7    4e-09   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  64.7    4e-09   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  64.3    5e-09   
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  64.3    5e-09   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like     64.3    5e-09   
dbj|BAJ94317.1|  predicted protein                                    64.3    5e-09   
gb|KHN09132.1|  Putative beta-D-xylosidase 7                          63.9    5e-09   
gb|KHN26079.1|  Putative beta-D-xylosidase 7                          63.9    6e-09   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like     63.9    7e-09   
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                        63.9    7e-09   
ref|XP_009391117.1|  PREDICTED: probable beta-D-xylosidase 7          63.9    7e-09   
gb|KDP44489.1|  hypothetical protein JCGZ_16322                       63.9    7e-09   
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2        63.5    8e-09   
ref|XP_004976327.1|  PREDICTED: probable beta-D-xylosidase 6-like     61.2    9e-09   
gb|EMS60786.1|  putative beta-D-xylosidase 6                          63.5    9e-09   
gb|AFI25186.1|  putative beta-D-xylosidase                            63.2    1e-08   
ref|XP_007042636.1|  Glycosyl hydrolase family protein                63.2    1e-08   
gb|KJB77632.1|  hypothetical protein B456_012G147500                  63.2    1e-08   
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5          62.8    2e-08   
emb|CBI22460.3|  unnamed protein product                              62.8    2e-08   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg           62.4    2e-08   
ref|XP_003615006.1|  Xylan 1 4-beta-xylosidase                        62.4    2e-08   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                 62.4    2e-08   
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...  62.4    2e-08   
emb|CAN82161.1|  hypothetical protein VITISV_035506                   62.4    2e-08   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg           62.4    3e-08   
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7          61.6    4e-08   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5          61.6    5e-08   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like     61.2    5e-08   
ref|XP_003580200.2|  PREDICTED: probable beta-D-xylosidase 6          61.2    5e-08   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400        61.2    5e-08   
gb|EPS73741.1|  hypothetical protein M569_01013                       61.2    6e-08   
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                        61.2    6e-08   
ref|XP_003615019.1|  hypothetical protein MTR_5g062650                61.2    6e-08   
ref|XP_002299457.1|  hypothetical protein POPTR_0001s10850g           61.2    6e-08   
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like     60.8    7e-08   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541           60.1    1e-07   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6          60.1    1e-07   
ref|XP_002885319.1|  beta-1,4-xylosidase                              60.1    1e-07   
gb|ADE76904.1|  unknown                                               58.5    2e-07   
ref|XP_007035964.1|  Glycosyl hydrolase family protein                59.7    2e-07   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5          59.7    2e-07   
gb|KCW55109.1|  hypothetical protein EUGRSUZ_I01067                   59.3    2e-07   
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  59.3    2e-07   
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like     59.3    2e-07   
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730        59.3    2e-07   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                       59.3    2e-07   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg           59.3    3e-07   
gb|KJB59940.1|  hypothetical protein B456_009G282000                  58.9    3e-07   
gb|KJB59942.1|  hypothetical protein B456_009G282000                  58.9    3e-07   
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein            58.9    3e-07   
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206           58.9    3e-07   
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g           58.5    4e-07   
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5          58.5    4e-07   
ref|XP_008808183.1|  PREDICTED: probable beta-D-xylosidase 7          58.2    5e-07   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876  58.5    5e-07   
ref|XP_003592512.1|  Xylosidase                                       58.2    6e-07   
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5          58.2    6e-07   
gb|KDO78121.1|  hypothetical protein CISIN_1g047862mg                 58.2    6e-07   
ref|XP_006468194.1|  PREDICTED: probable beta-D-xylosidase 5-like     58.2    6e-07   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...  57.8    7e-07   
ref|XP_010914750.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  57.8    8e-07   
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7          57.8    8e-07   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5          57.8    8e-07   
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087           57.4    8e-07   
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5          57.4    9e-07   
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                     57.4    1e-06   
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg           57.4    1e-06   
emb|CDY71910.1|  BnaAnng39260D                                        56.2    1e-06   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207           57.0    1e-06   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7          57.0    1e-06   
ref|XP_007018826.1|  Glycosyl hydrolase family protein                57.0    1e-06   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7          57.0    1e-06   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg              57.0    1e-06   
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7          57.0    1e-06   
ref|XP_006468193.1|  PREDICTED: probable beta-D-xylosidase 5-like     56.6    2e-06   
ref|XP_006383491.1|  hypothetical protein POPTR_0005s16650g           56.6    2e-06   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7          56.2    2e-06   
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5          56.2    2e-06   
ref|XP_006449655.1|  hypothetical protein CICLE_v10014315mg           56.2    2e-06   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7          56.2    2e-06   
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g           55.8    3e-06   
gb|EYU23225.1|  hypothetical protein MIMGU_mgv1a002689mg              55.8    3e-06   
emb|CAJ65923.1|  xylan 1,4-beta-xylosidase                            55.8    3e-06   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                       55.8    3e-06   
gb|KDO78122.1|  hypothetical protein CISIN_1g040836mg                 55.8    3e-06   
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970        55.8    3e-06   
ref|XP_006449654.1|  hypothetical protein CICLE_v10018058mg           55.8    3e-06   
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like     55.5    4e-06   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7          55.5    4e-06   
ref|XP_011011484.1|  PREDICTED: probable beta-D-xylosidase 7          55.1    5e-06   
ref|NP_001068441.1|  Os11g0673200                                     55.1    5e-06   
ref|XP_008346038.1|  PREDICTED: probable beta-D-xylosidase 7          54.7    5e-06   
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7          55.1    6e-06   
ref|XP_004238520.1|  PREDICTED: probable beta-D-xylosidase 7          55.1    6e-06   
gb|EYU23222.1|  hypothetical protein MIMGU_mgv1a021704mg              55.1    6e-06   
ref|XP_008371868.1|  PREDICTED: probable beta-D-xylosidase 7          54.7    6e-06   
gb|EAY81823.1|  hypothetical protein OsI_36995                        54.7    6e-06   
ref|XP_008810094.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  54.7    7e-06   
gb|ABA95273.1|  Beta-D-xylosidase, putative, expressed                54.7    7e-06   
ref|XP_007008778.1|  Glycosyl hydrolase family protein                54.7    8e-06   
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg           54.3    9e-06   
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5          54.3    1e-05   



>dbj|BAC98299.1| LEXYL2 [Solanum lycopersicum]
Length=633

 Score =   135 bits (341),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ C +  LDIHL V+NVG + G H+VLLF+SPP++HNAP+K L+ FQK+ L+P  + VV
Sbjct  533  EQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPPSVHNAPQKHLLDFQKIHLTPQSEGVV  592

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+ I
Sbjct  593  KFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTLRI  633



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   135 bits (340),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ C +  LDIHL V+NVG + G H+VLLF+SPP++HNAP+K L+ FQK+ L+P  + VV
Sbjct  678  EQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPPSVHNAPQKHLLDFQKIHLTPQSEGVV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+ I
Sbjct  738  KFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTLRI  778



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ C +   DIHL V+NVG + G H+VLLF+SPP++HNAP+K L+ FQK+ L+P  + VV
Sbjct  678  EQGCNNLGFDIHLKVQNVGKMRGSHTVLLFTSPPSVHNAPQKHLLDFQKIHLTPQSEGVV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+ I
Sbjct  738  KFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTLRI  778



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   134 bits (336),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            Q+C++   DIHL VKNVG +SG H++ LF+SPP++HNAP+K L+GF+KV L+P  + VV 
Sbjct  707  QSCSNMGFDIHLRVKNVGKISGSHTIFLFTSPPSVHNAPKKHLLGFEKVHLTPQGEGVVK  766

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            FNVDVCKHLSV DE GNRKVALG HVLHIG LKHSLTV I
Sbjct  767  FNVDVCKHLSVHDELGNRKVALGPHVLHIGDLKHSLTVRI  806



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C++   DIHL VKNVG +SG H+V LF+SPP++HNAP+K L+ FQK+ L+P  + +V
Sbjct  678  EQSCSNLGFDIHLRVKNVGKMSGSHTVFLFTSPPSVHNAPQKHLLEFQKIHLTPQSEGIV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F +DVCKHLSVVDE GN+KVALGLHVLHIG LKHSLTV I
Sbjct  738  KFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLKHSLTVRI  778



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C++   DIHL VKNVG +SG H+V LF+SPP++HNAP+K L+ FQK+ L+P  + +V
Sbjct  679  EQSCSNLGYDIHLRVKNVGKMSGSHTVFLFTSPPSVHNAPQKHLLEFQKIHLTPQSEGIV  738

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F +DVCKHLSVVDE GN+KVALGLHVLHIG LKHSLTV I
Sbjct  739  KFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLKHSLTVRI  779



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   129 bits (325),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C ++++D+HL VKNVG  SG H+VLLFSSPP +HNAPRK L+G+QK+ L+P  + +V
Sbjct  668  EQSCKNASIDVHLRVKNVGNYSGSHTVLLFSSPPQVHNAPRKHLIGYQKLHLTPQAEGLV  727

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FN+DVCKHLS+VDE GN+KVALG ++LHIG L HSL V I
Sbjct  728  RFNIDVCKHLSIVDENGNQKVALGEYILHIGSLMHSLHVVI  768



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   129 bits (323),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A DIHL VKN G++SG H+V+LFSSPPA+H +P+K L+GF+KV LS   + +V
Sbjct  673  EERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFLSAQREALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  733  KFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKHSFSVRI  773



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   128 bits (321),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A DIHL VKN+G++SG H+V+LFSSPPA+H +P+K L+GF+KV +S     +V
Sbjct  673  EERCENLAFDIHLGVKNMGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFVSAQRVALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  733  KFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKHSFSVRI  773



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   127 bits (320),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            + TC +   DIH+ VKNVG +SG H+V LFSSPP +HNAP+K L+GFQK+ L P  + +V
Sbjct  668  DHTCKNLGFDIHVRVKNVGHMSGSHTVFLFSSPPQVHNAPQKHLLGFQKLHLEPQGEGLV  727

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG H+LH+G LKHSL + +
Sbjct  728  RFNVDVCKHLSVVDEKGNRKVALGEHLLHVGSLKHSLNLRV  768



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   127 bits (319),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A DIHL VKN+G +SG H+V+LFSSPPA+H +P+K L+GF+KV +S   + +V
Sbjct  673  EERCENLAFDIHLGVKNMGRMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFVSAKREALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  733  KFNVDVCKHLSVVDELGNRKVALGKHVLHVGSLKHSFSVRI  773



>gb|KCW63063.1| hypothetical protein EUGRSUZ_G00654 [Eucalyptus grandis]
Length=621

 Score =   126 bits (316),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            +TC++   D+HLNVKNVG  SG H+V LFSSPP++H AP+KQL+GF+KV L+   +  V 
Sbjct  522  ETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPSVHRAPQKQLLGFEKVFLASQSEAQVQ  581

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK LSVVDE G+RKVALG++VLH+G LKH+L+V+I
Sbjct  582  FKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKHALSVQI  621



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            Q+C++   DIHL VKNVG +SG H + LF+SPP++HNAP+K L+GF+KV L+P  + VV 
Sbjct  671  QSCSNMGFDIHLRVKNVGKISGSHIIFLFTSPPSVHNAPKKHLLGFEKVHLTPQGEGVVK  730

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            FNV+VCKHLSV DE GNRKVALG HVLHIG LKHSLTV I
Sbjct  731  FNVNVCKHLSVHDELGNRKVALGPHVLHIGDLKHSLTVRI  770



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A DIH+ VKN+G +SG H+V+L+SSPP++HNAP+K L+GF+KV LS  ++ +V
Sbjct  674  EERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPSVHNAPKKHLLGFEKVFLSSQKEALV  733

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G LK +L+V I
Sbjct  734  KFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQTLSVRI  774



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL VKN G++SGGH+VLLFSSPP++HN+P+K L+GF+KV LS   +E+V
Sbjct  679  QERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPSVHNSPQKHLLGFEKVFLSAQREELV  738

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  739  KFKVDVCKHLSVVDELGNRKVALGQHVLHVGSLKHSFSVGI  779



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   126 bits (316),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            +TC++   D+HLNVKNVG  SG H+V LFSSPP++H AP+KQL+GF+KV L+   +  V 
Sbjct  678  ETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPSVHRAPQKQLLGFEKVFLASQSEAQVQ  737

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK LSVVDE G+RKVALG++VLH+G LKH+L+V+I
Sbjct  738  FKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKHALSVQI  777



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   126 bits (316),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C++   ++HL VKN+G +SG H++ LF+SPP++HNAP+K L+GF+KV L+P E+ VV
Sbjct  681  EQSCSNLGFNVHLRVKNMGKISGSHTIFLFNSPPSVHNAPQKHLLGFEKVHLTPQEEGVV  740

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLS  DE GN+KVALG HVLHIG LKHS TV+I
Sbjct  741  KFNVDVCKHLSGHDELGNKKVALGQHVLHIGDLKHSFTVKI  781



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL VKN G++SGGH+VLLFSSPP++HN+P+K L+GF+KV LS   +E+V
Sbjct  679  QERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPSVHNSPQKHLLGFEKVFLSAQREELV  738

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  739  KFKVDVCKHLSVVDELGNRKVALGPHVLHVGSLKHSFSVGI  779



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   125 bits (314),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A DIHL VKN G++SG H+V+LFSSPPA+H +P+K L+GF+KV LS   + +V
Sbjct  673  EERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFLSAQREALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G LK S +V I
Sbjct  733  KFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKRSFSVRI  773



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   125 bits (314),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A DIH+ VKN+G +SG H+V+L+SSPP++HNAP+K L+GF+KV LS  ++ +V
Sbjct  699  EERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPSVHNAPKKHLLGFEKVFLSSQKEALV  758

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G LK +L+V I
Sbjct  759  KFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQTLSVRI  799



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   125 bits (313),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C++   ++HL VKN+G +SG H++ LF+SPP++HNAP+K L+GF+KV L+  E+ VV
Sbjct  684  EQSCSNVGFNVHLRVKNMGKISGSHTIFLFNSPPSVHNAPQKHLLGFKKVHLTAQEEGVV  743

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSV DE GN+KVALG HVLHIG LKHS TV I
Sbjct  744  KFNVDVCKHLSVHDELGNKKVALGQHVLHIGDLKHSFTVRI  784



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   125 bits (313),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A DIHL VKN+G + G H+VLL+SSPP++HNAP+K L+GF+KV LS   + +V
Sbjct  699  EERCQNLAFDIHLGVKNMGKMCGSHTVLLYSSPPSVHNAPKKHLLGFEKVFLSSQGEALV  758

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G L+ +L+V I
Sbjct  759  KFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLRQTLSVRI  799



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   124 bits (312),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C +   DIHL VKN G++SG H+V+LFSSPPA+H +P+K L+GF+KV LS   + +V
Sbjct  673  EERCKNLVFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFLSAQREALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLSVVDE GNRKVALG HVLH+G L HS +V I
Sbjct  733  KFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLXHSFSVRI  773



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   124 bits (312),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E++C ++A+++HL VKNVG  SG H+VLLFSSPP +HNA +K L+GF+K+ L+P  +  V
Sbjct  668  ERSCKNAAVNVHLRVKNVGNYSGSHTVLLFSSPPQVHNAAQKHLLGFEKLHLTPQAEGQV  727

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F++DVCKHLSVVDE G RKVALG HVLH+G L HSL V I
Sbjct  728  RFDIDVCKHLSVVDENGARKVALGEHVLHVGSLTHSLNVMI  768



>emb|CDO97479.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C +   +IHL V+NVGT+SG H+VLLFSSPP++HNA +K L+GFQK+ L+P  + +V
Sbjct  606  EQSCKNLGFNIHLRVRNVGTMSGSHTVLLFSSPPSVHNAAQKHLLGFQKLHLAPQTEGLV  665

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCKHLS+VDE GNRKVA+G HVLH G LKH+LTV I
Sbjct  666  KFNVDVCKHLSMVDELGNRKVAVGEHVLHAGDLKHTLTVRI  706



>emb|CAN78858.1| hypothetical protein VITISV_030325 [Vitis vinifera]
Length=699

 Score =   124 bits (310),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C + A DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV ++     +V
Sbjct  599  QESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFVTAKAKALV  658

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  659  RFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  699



>gb|KCW63060.1| hypothetical protein EUGRSUZ_G00652 [Eucalyptus grandis]
Length=460

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            +TC++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L+   +  + 
Sbjct  356  KTCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFLASQSEAQLQ  415

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F V+VCK LS+VDE G+RKVALG HVLHIG LKH+L+++I
Sbjct  416  FKVNVCKDLSLVDELGHRKVALGTHVLHIGDLKHALSMQI  455



>ref|XP_010068199.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2, partial [Eucalyptus grandis]
Length=531

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            +TC++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L+   +  + 
Sbjct  413  KTCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFLASQSEAQLQ  472

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F V+VCK LS+VDE G+RKVALG HVLHIG LKH+L+++I
Sbjct  473  FKVNVCKDLSLVDELGHRKVALGTHVLHIGDLKHALSMQI  512



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQTC +S  D+ L VKNVGTVSG H+VLLFSSPPA+HNAP+K LVGF+KV L+      V
Sbjct  675  EQTCQNSTFDMLLRVKNVGTVSGSHTVLLFSSPPAVHNAPQKHLVGFKKVFLNAQTGRHV  734

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F V++CK LS+VDE G++KVALG HVLH+G LKH L+V I
Sbjct  735  RFKVNICKDLSLVDELGSKKVALGEHVLHVGSLKHFLSVRI  775



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   122 bits (305),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G ++G H+V LFSSPPA+HNAPRK L+GF+KV L P     VVF 
Sbjct  672  CDGLAFDVHLRVQNSGGMAGSHTVFLFSSPPAVHNAPRKHLLGFEKVYLGPKAAGDVVFK  731

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRK+ALG HVLH G LKHSL+++I
Sbjct  732  VDVCKDLSVVDELGNRKLALGSHVLHAGSLKHSLSLKI  769



>emb|CBI20072.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C + A DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV ++   + +V
Sbjct  233  QESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFVTAKAEALV  292

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  293  RFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  333



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++TC + A DIHL VKN+G + G H+V LFS+PP++HN+P+K LV F+KV L       V
Sbjct  670  DRTCQNLAFDIHLKVKNMGRIRGSHTVFLFSTPPSVHNSPQKHLVDFEKVSLDAQTHSTV  729

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VD+CKHLSVVDE GNRK+ALG H+LH+G+LKHS+T+ I
Sbjct  730  QFKVDICKHLSVVDEFGNRKIALGEHILHVGNLKHSMTLRI  770



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H APRK L+GF+KV L+   +  V 
Sbjct  677  EMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPRKHLLGFEKVFLASQSEAQVQ  736

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK L VVDE G RKVALG+H+LH+G LKH+L+V+I
Sbjct  737  FKVDVCKDLGVVDELGCRKVALGMHILHVGDLKHALSVQI  776



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E TC + A DIHL VKNVGT  G H+V LFSSPP++HN+PRK L+GF+KV L    + +V
Sbjct  678  EHTCQNLAFDIHLRVKNVGTSGGTHTVFLFSSPPSVHNSPRKHLLGFEKVSLKAQSESLV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F V++CK LSVVDE G RKVALG H+LH+G LKHSL+V I
Sbjct  738  KFTVNICKDLSVVDEVGTRKVALGHHLLHVGDLKHSLSVRI  778



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  430  SSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvd  251
            ++A+++HL+VKNVG + G H+VLLFSSPP +H APRKQL+GF+KV L P  + VV FNVD
Sbjct  672  NAAIEVHLSVKNVGRMGGAHTVLLFSSPPEVHGAPRKQLLGFEKVHLVPQGEGVVRFNVD  731

Query  250  VCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VCKHLS+VDE GNRKVALG HVLH+G+LKHSL V I
Sbjct  732  VCKHLSLVDEKGNRKVALGEHVLHVGNLKHSLNVII  767



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQTC +   D+HL +KN GT SG H+V LFS+PP++HN+P+K LVGF+KV L    D  V
Sbjct  678  EQTCQNLTFDVHLRIKNTGTTSGSHTVFLFSTPPSVHNSPQKHLVGFEKVFLHAQTDSHV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G++KVALG HVLHIG LKHS+TV I
Sbjct  738  GFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSMTVRI  778



>gb|KJB31997.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=631

 Score =   119 bits (299),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L+   + +V
Sbjct  531  EQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSLTGKSETLV  590

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  591  RFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVGI  631



>gb|ACL53913.1| unknown [Zea mays]
 gb|ACN36701.1| unknown [Zea mays]
 gb|AFW59617.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=405

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L P +  VV F 
Sbjct  308  CEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFK  367

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  368  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  405



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   119 bits (298),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C + A DIHL V+N G ++G H+V LFS+PP++HN+P+KQL+GF+KV L P     VVF 
Sbjct  675  CENVAFDIHLRVQNTGRMAGSHTVFLFSTPPSVHNSPQKQLLGFEKVYLGPQGVGNVVFK  734

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LS+VDE GNRKVALG H+LH+G L HSL V +
Sbjct  735  VDVCKDLSLVDELGNRKVALGSHILHVGSLMHSLKVRV  772



>gb|AFW59618.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=475

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L P +  VV F 
Sbjct  378  CEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFK  437

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  438  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  475



>ref|NP_001146416.1| uncharacterized protein LOC100279996 [Zea mays]
 gb|ACN32073.1| unknown [Zea mays]
Length=507

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L P +  VV F 
Sbjct  410  CEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFK  469

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  470  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  507



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQTC +S  D+ L VKN GT+SG H+V LFSSPPA+HN+P+K LVGF+KV L+      V
Sbjct  673  EQTCQNSTFDMLLRVKNEGTISGSHTVFLFSSPPAVHNSPQKHLVGFEKVFLNAQTGRHV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VD+CK LSVVDE G++KVALG HVLH+G LKH L+V I
Sbjct  733  RFKVDICKDLSVVDELGSKKVALGEHVLHVGSLKHFLSVRI  773



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            +TC++   D+HLNVKNVG  SG H+V LFSSPP++H +P+K L+GF+KV L+   +  V 
Sbjct  678  ETCSNLVFDVHLNVKNVGRFSGSHTVFLFSSPPSVHRSPQKHLLGFEKVFLASQSEAQVQ  737

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK LSVVDE G RKVALG HVLH+G LKH+L+V+I
Sbjct  738  FKVDVCKDLSVVDELGGRKVALGTHVLHVGDLKHALSVQI  777



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   118 bits (296),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/101 (58%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP++H +P+K L+ F+KV L   E+ +V
Sbjct  673  EQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPSVHKSPQKHLLAFEKVFLKGQEEALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VD CK LSVVDE GNRK+ALG H+LH+G+LKHSLT+ I
Sbjct  733  SFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKHSLTIRI  773



>ref|XP_008661823.1| PREDICTED: uncharacterized protein LOC100279996 isoform X2 [Zea 
mays]
Length=653

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L P +  VV F 
Sbjct  556  CEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFK  615

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  616  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  653



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E  C +    +HL VKNVG ++G H+VL+FS PP +HNAPRKQLV F+KV L P  +EVV
Sbjct  677  EPMCKNLGFGVHLTVKNVGKLTGSHTVLVFSRPPRVHNAPRKQLVAFRKVHLRPKGEEVV  736

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F +DVCK LSVVDE GNRKVALG HVLH+G+LKHS  V I
Sbjct  737  RFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHSFNVTI  777



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L+   +  V 
Sbjct  677  EMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFLASQSEAQVQ  736

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK LSVVDE G+ KVALG HVLH+G LKH+L+V+I
Sbjct  737  FKVDVCKDLSVVDELGHWKVALGTHVLHVGDLKHALSVQI  776



>gb|KCW63062.1| hypothetical protein EUGRSUZ_G006531, partial [Eucalyptus grandis]
Length=642

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L+   +  V 
Sbjct  530  EMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFLASQSEAQVQ  589

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VD+CK L VVDE G +KVALG HVLHIG LKH+L+V+I
Sbjct  590  FKVDICKDLGVVDELGCQKVALGTHVLHIGDLKHALSVQI  629



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L P +  VV F 
Sbjct  676  CEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFK  735

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  736  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  773



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C +   DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV ++     +V
Sbjct  651  QESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFVTAKAKALV  710

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  711  RFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  751



>gb|KJB31996.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
 gb|KJB31998.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=507

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L+   + +V
Sbjct  407  EQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSLTGKSETLV  466

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  467  RFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVGI  507



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L+   +  V 
Sbjct  677  EMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFLASQSEAQVQ  736

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VD+CK L VVDE G +KVALG HVLHIG LKH+L+V+I
Sbjct  737  FKVDICKDLGVVDELGCQKVALGTHVLHIGDLKHALSVQI  776



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C +   DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV ++     +V
Sbjct  674  QESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFVTAKAKALV  733

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  734  RFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  774



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQTC +   D+HL +KN GT SG H+V LFS+PP++HN+P+K LVGF+KV L    D  V
Sbjct  659  EQTCQN--FDVHLRIKNTGTTSGSHTVFLFSTPPSVHNSPQKHLVGFEKVFLHAQTDSHV  716

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G++KVALG HVLHIG LKHS+TV I
Sbjct  717  GFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSMTVRI  757



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C + A DIHL V+N G  SG H+V LFS+PP++HN+PRK L+GF+KV L+   + +V
Sbjct  687  EQSCKNLAFDIHLRVQNKGRNSGSHTVFLFSTPPSVHNSPRKHLLGFEKVLLTGKSESLV  746

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G+RKV+LG HVLH+G LKHSL V I
Sbjct  747  RFKVDVCKDLSVVDERGSRKVSLGQHVLHVGSLKHSLNVRI  787



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G +SG H+V LFSSPPA+HNAP K L+GF+KV L P +  VV F 
Sbjct  670  CEGLAFDVHLRVRNAGDMSGAHTVFLFSSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFK  729

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L++ +
Sbjct  730  VDVCKDLSVVDELGNRKVALGNHTLHVGDLKHTLSLGV  767



>ref|XP_009407358.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   116 bits (290),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+    D+HL V+N G ++G H+VLLF++PPA+HNAPRKQLVGF+KV L PNE + V F 
Sbjct  526  CSGLQFDVHLKVQNSGGMAGSHTVLLFNTPPAVHNAPRKQLVGFEKVFLEPNESKNVAFQ  585

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VD C+ LSV DE+GN KV LG HVLH+G + H+LT+ I
Sbjct  586  VDACRDLSVADESGNWKVPLGSHVLHVGDVTHTLTLSI  623



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   116 bits (291),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL+VKN+G +S  HSVLLF +PP +HNAP+K L+GF+KV+L+   + +V
Sbjct  675  DEHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPNVHNAPQKHLLGFEKVQLAGKSEGMV  734

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVC  LSVVDE GNRKV LG H+LH+G+LKHSL+V I
Sbjct  735  RFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKHSLSVRI  775



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL+VKN+G +S  HSVLLF +PP +HNAP+K L+GF+KV+L+   + +V
Sbjct  674  DKHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPNVHNAPQKHLLGFEKVQLAGKSEGMV  733

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVC  LSVVDE GNRKV LG H+LH+G+LKHSL+V I
Sbjct  734  RFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKHSLSVRI  774



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L+   + +V
Sbjct  679  EQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSLTGKSETLV  738

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  739  RFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVRI  779



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   116 bits (290),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ C   A +I L V+N+G V G H+V LF +PP++HN+P+K LV F+KV L      +V
Sbjct  677  EQNCQGLAFNIDLKVRNIGKVRGTHTVFLFFTPPSVHNSPQKHLVDFEKVSLDAKTYGMV  736

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCKHLSVVDE G+RKVALG HVLH+G+L+HSLTV I
Sbjct  737  SFKVDVCKHLSVVDEFGSRKVALGGHVLHVGNLEHSLTVRI  777



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C + A DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV ++   + +V
Sbjct  674  QESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFVTAKAEALV  733

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LS+VDE G +KVALGLHVLH+G LKHSL V I
Sbjct  734  RFKVDVCKDLSIVDELGTQKVALGLHVLHVGSLKHSLNVRI  774



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K L+GF+KV L P +  VV F 
Sbjct  668  CGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAKHLLGFEKVSLEPGQAGVVAFK  727

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  728  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  765



>gb|EEE61783.1| hypothetical protein OsJ_16354 [Oryza sativa Japonica Group]
Length=771

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K L+GF+KV L P +  VV F 
Sbjct  674  CGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAKHLLGFEKVSLEPGQAGVVAFK  733

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  734  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  771



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP++H +P+K L+ F+KV L   E+ +V
Sbjct  673  EQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPSVHKSPQKHLLAFEKVFLKGQEEALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VD CK LSVVDE GNRK+ALG H+LH+G+LKHSLTV I
Sbjct  733  SFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKHSLTVRI  773



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L+   + +V
Sbjct  679  EQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSLTGKSETLV  738

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  739  RFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVGI  779



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E  C +    +HL VKNVG ++G H+VL+FS PP +HNAPRKQLV F+KV L P  +EVV
Sbjct  670  EPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPPRVHNAPRKQLVAFRKVHLRPKGEEVV  729

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F +DVCK LSVVDE GNRKVALG HVLH+G+LKH   V I
Sbjct  730  RFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHFFNVTI  770



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K L+GF+KV L P +  VV F 
Sbjct  742  CGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAKHLLGFEKVSLEPGQAGVVAFK  801

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  802  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  839



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E  C +    +HL VKNVG ++G H+VL+FS PP +HNAPRKQLV F+KV L P  +EVV
Sbjct  673  EPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPPRVHNAPRKQLVAFRKVHLRPKGEEVV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F +DVCK LSVVDE GNRKVALG HVLH+G+LKH   V I
Sbjct  733  RFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHFFNVTI  773



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            + C +  +DI+L VKN G +S GH+V LFS+PPA+HNAP+K L+GF+KV L    + +V 
Sbjct  674  ELCQNLVIDINLKVKNKGNLSSGHTVFLFSTPPAVHNAPQKHLLGFEKVHLIGKSEALVR  733

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK LS+VDE GNRKVALG H+LH+G+LKH L+V I
Sbjct  734  FKVDVCKDLSIVDELGNRKVALGQHLLHVGNLKHPLSVMI  773



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQTC +    + L +KN GT+SG H+V LFS+PP++HN+P+K L+GF+KV L    D  V
Sbjct  676  EQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPSVHNSPQKHLLGFEKVFLHAQTDSHV  735

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G++KVALG HVLHIG LKHSLTV I
Sbjct  736  GFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSLTVRI  776



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            EQTC +    + L +KN GT+SG H+V LFS+PP++HN+P+K L+GF+KV L    D  V
Sbjct  676  EQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPSVHNSPQKHLLGFEKVFLHAQTDSHV  735

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G++KVALG HVLHIG LKHSLTV I
Sbjct  736  GFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSLTVRI  776



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+ C + A +IHL V+N+G +SG H+V LFS+PP++HNAP K L+GF+KV L+   + +V
Sbjct  673  EEGCRNLAFEIHLRVRNMGRMSGSHTVFLFSTPPSVHNAPNKHLLGFEKVFLTSQNEALV  732

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCK LSVVDE G RKVALG HVLH+G LKHSL + I
Sbjct  733  KFNVDVCKDLSVVDELGRRKVALGSHVLHVGSLKHSLNIRI  773



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C     D+HL V+N G  +G H+V LFS+PPA+H APRK LVGF+KV L P     VVF 
Sbjct  673  CNDLGFDVHLRVRNSGNRAGSHTVFLFSTPPAVHGAPRKHLVGFEKVFLGPKAVGQVVFK  732

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRK+ALG HVLH+G LKHSL++++
Sbjct  733  VDVCKDLSVVDELGNRKLALGSHVLHVGSLKHSLSLKV  770



>gb|KHN39204.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=648

 Score =   113 bits (283),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            + C +   DIHL +KN G +S  H+V LFS+PPA+HNAP+K L+GF+KV L    + +V 
Sbjct  549  EHCQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPAVHNAPQKHLLGFEKVHLIGKSEALVS  608

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK LS+VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  609  FKVDVCKDLSIVDELGNRKVALGQHLLHVGDLKHPLSVMI  648



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+HL V+N G V+G H+V LFSSPPA+HNAP K L+GF+KV L P +  VV F 
Sbjct  673  CDKLAFDVHLRVRNAGEVAGRHTVFLFSSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFK  732

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVC+ LSVVDE GNRKVALG H LH+G LKH++ + +
Sbjct  733  VDVCRDLSVVDELGNRKVALGSHTLHVGDLKHTINLRV  770



>gb|ACH60354.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60358.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60359.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60360.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60362.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60368.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60370.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60371.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60373.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60374.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
macrocarpa]
Length=107

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C    LD+H++V+N G++ GGH VLLFSSPPA+H AP+K+L+GF+KV +     E + F+
Sbjct  9    CEGLLLDLHMDVENTGSLDGGHVVLLFSSPPAVHAAPQKKLLGFRKVHVGAGAKERLHFS  68

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE G +K+ALG H+LH+G +KHSL +EI
Sbjct  69   VDVCKDLSVVDEIGVKKLALGSHLLHVGDVKHSLNIEI  106



>gb|KHN26728.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   113 bits (283),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K L+GF+KV L    +  V
Sbjct  548  DEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPDVHNAPQKHLLGFEKVHLPGKSEAQV  607

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VD+CK LSVVDE GNRKV LG H+LH+G+LKH L+V +
Sbjct  608  RFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKHQLSVSV  648



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   113 bits (283),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            + C +   D+HL V+N G + G H+V LFSSPP++HN+P+K L+ F+KV L    + + V
Sbjct  678  EHCKNLGFDVHLKVRNNGAMEGRHTVFLFSSPPSVHNSPKKNLIAFEKVFLHGKTEGMTV  737

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VD C+HLSVVDE GNRKVALG+H LHIG++KHS  V I
Sbjct  738  FKVDACEHLSVVDEEGNRKVALGVHQLHIGNMKHSFNVRI  777



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P+K L+GF+KV L    + VV
Sbjct  682  QESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSPQKHLLGFEKVSLGRGGETVV  741

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V++
Sbjct  742  RFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKHSLNVKV  782



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   113 bits (283),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K L+GF+KV L    +  V
Sbjct  676  DEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPDVHNAPQKHLLGFEKVHLPGKSEAQV  735

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VD+CK LSVVDE GNRKV LG H+LH+G+LKH L+V +
Sbjct  736  RFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKHQLSVSV  776



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P+K L+GF+KV L    + VV
Sbjct  691  QESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSPQKHLLGFEKVSLGRGREMVV  750

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V +
Sbjct  751  RFKVDVCKDLSVTDEVGSRKVALGLHILHVGTLKHSLNVRV  791



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C + + D+HL V+N G V+G H+V LF+SPP++HNAP K L+GF+KV L P +  VV F 
Sbjct  679  CENLSFDVHLRVRNAGDVAGRHTVFLFTSPPSVHNAPAKHLLGFEKVSLEPGQAGVVAFK  738

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  739  VDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  776



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C ++A DIHL V+N G ++G H+V LFS+PP++HN+P+K L+GF+K+ L P     VVFN
Sbjct  676  CQNAAFDIHLRVQNPGRMAGSHTVFLFSTPPSVHNSPQKHLLGFEKIYLGPKXVGYVVFN  735

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LS+VDE GNR VALG HVLH+G LKHSL V +
Sbjct  736  VDVCKDLSLVDELGNRMVALGSHVLHVGSLKHSLRVRV  773



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P+K L+GF+KV L    + VV
Sbjct  709  QESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSPQKHLLGFEKVSLGRGGETVV  768

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V++
Sbjct  769  RFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKHSLNVKV  809



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ALD+ L V+N G V+G HSVLLFSSPP  HNAP K LVGF+KV L+P E   V F 
Sbjct  680  CDDLALDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLVGFEKVSLAPGEAGTVAFR  739

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVC+ LSVVDE G RKVALG H LH G LKH++ + +
Sbjct  740  VDVCRDLSVVDELGGRKVALGGHTLHDGDLKHTVELRV  777



>dbj|BAK03439.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   112 bits (279),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV L+P E   V F 
Sbjct  597  CDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFR  656

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  657  VDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  694



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A ++ L V N G ++G H+VLLFSSPPA+HNAP K L+GF+K+ L P +  V  F 
Sbjct  677  CEGMAFEVRLRVHNTGEMAGAHTVLLFSSPPAVHNAPAKHLLGFEKLNLEPGQAGVAAFK  736

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  737  VDVCKDLSVVDELGNRKVALGGHTLHVGDLKHTLNLGV  774



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   112 bits (279),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV L+P E   V F 
Sbjct  678  CDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFR  737

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  738  VDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  775



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   112 bits (279),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV L+P E   V F 
Sbjct  678  CDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFR  737

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  738  VDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  775



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL+ KN+G +S  H+VLLF SPP +HNAP+K L+GF+KV+L+   + +V
Sbjct  675  DEHCQNLAFDIHLSAKNMGKMSSSHTVLLFFSPPNVHNAPQKHLLGFEKVQLAGKSEALV  734

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G RKV LG H+LH+G+LK+ L+V I
Sbjct  735  KFKVDVCKDLSVVDEVGKRKVPLGEHMLHVGNLKYPLSVRI  775



>dbj|BAK01582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=709

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV L+P E   V F 
Sbjct  612  CDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFR  671

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  672  VDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  709



>gb|KHN33504.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   111 bits (277),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL VKN G +S  H VLLF +PP +HNAP+K L+GF+KV L    +  V
Sbjct  548  DEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPDVHNAPQKHLLGFEKVHLPGKSEAQV  607

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE GNRKV LG H+LH+G+LKH L++ +
Sbjct  608  RFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKHPLSLRV  648



>gb|ACH60351.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60352.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60353.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60355.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60356.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60357.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60361.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60363.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60364.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60365.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60366.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60367.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60369.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60372.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
Length=107

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C    LD+H++V+N G++ GGH VLLFSSPPA+H AP+K+L+GF+KV +     E + F+
Sbjct  9    CEGLLLDLHIDVQNTGSLDGGHVVLLFSSPPAVHGAPQKKLLGFRKVHVGAGAKERLHFS  68

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  69   VDVCKDLSVVDEIGVKKLALGSHLLHVGDVEHSLNIQI  106



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   111 bits (277),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL VKN G +S  H VLLF +PP +HNAP+K L+GF+KV L    +  V
Sbjct  676  DEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPDVHNAPQKHLLGFEKVHLPGKSEAQV  735

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE GNRKV LG H+LH+G+LKH L++ +
Sbjct  736  RFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKHPLSLRV  776



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E +C + A  IHL V+N+G  SG H+VLLF++PP++HNAP+K L+GF+KV L+   +E+V
Sbjct  671  EGSCQNLAFKIHLRVRNMGRRSGSHTVLLFNTPPSVHNAPKKHLLGFKKVFLTAQSEELV  730

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             FNVDVCK LSVVDE G+RKVALG HVL +G LKHSL ++I
Sbjct  731  KFNVDVCKDLSVVDELGSRKVALGSHVLQVGSLKHSLNIKI  771



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   A D+ L V+N G V+G HSVLLFSSPP+ HNAP K L+GF+KV L+P E   V F 
Sbjct  873  CEDLAFDVKLRVRNAGEVAGAHSVLLFSSPPSAHNAPAKHLLGFEKVSLAPGEAGTVAFR  932

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  933  VDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  970



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +   DIHL +KN G +S  H+V LFS+PPA+HNAP+K L+GF+KV L    + +V F 
Sbjct  668  CQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPAVHNAPQKHLLGFEKVHLIGKSEALVSFK  727

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LS+VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  728  VDVCKDLSIVDELGNRKVALGQHLLHVGDLKHPLSVMI  765



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   108 bits (271),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 53/95 (56%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF+K+RL   E+ VV F V++
Sbjct  686  SAFEVHIKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVEI  745

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG H+LH+G LKHSL++ I
Sbjct  746  CKDLSVVDEIGKRKIALGQHLLHVGDLKHSLSIRI  780



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   108 bits (269),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF+KVRL   E+ VV F V+V
Sbjct  691  SAFEVHIKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKVRLGKMEEAVVRFKVEV  750

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE GNRK++LG H+LH+G LKH L++ I
Sbjct  751  CKDLSVVDEVGNRKISLGKHLLHVGDLKHYLSIRI  785



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   107 bits (268),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+    +A ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF+K+RL   E+ VV
Sbjct  678  EKKAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKIRLGKREEAVV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  738  KFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHSLSIRI  778



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   107 bits (268),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++H+ V+N G   G H+V LF++PPA+H +PRK LVGF+K+RL   E+ VV F V++
Sbjct  690  SAFEVHIKVRNGGDREGIHTVFLFTTPPAIHGSPRKHLVGFEKIRLGKREEAVVRFKVEI  749

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  750  CKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  784



>dbj|BAD94481.1| beta-xylosidase [Arabidopsis thaliana]
Length=523

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++H+ V+N G   G H+V LF++PPA+H +PRK LVGF+K+RL   E+ VV F V++
Sbjct  429  SAFEVHIKVRNGGDREGIHTVFLFTTPPAIHGSPRKHLVGFEKIRLGKREEAVVRFKVEI  488

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  489  CKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  523



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+    +A ++H+ V+N G   G H+V LF++PP +H +PRK L+GF+K+RL   E+ VV
Sbjct  678  EKNAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPTVHGSPRKHLLGFEKIRLGKREEAVV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  738  KFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHSLSIRI  778



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   105 bits (263),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++HLNV+N G   G H+V LF++PPA+H +P K L+GF+KVRL  NE+ VV F VDV
Sbjct  685  SDFEVHLNVRNAGDREGSHTVFLFTTPPAIHRSPIKHLLGFEKVRLGKNEEAVVRFKVDV  744

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            C+ LSVVDE G RK+ALG H+LH+G LKH+L + +
Sbjct  745  CQDLSVVDEIGKRKIALGQHLLHVGSLKHTLNIRV  779



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +   DIHL +KN G +S   +V LFS+PPA+HNAP+K L+ F+KV  +   + +V F 
Sbjct  677  CQNLVFDIHLRIKNKGKMSSSQTVFLFSTPPAVHNAPQKHLLAFEKVHFTGKSEALVSFK  736

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK LSVVDE GNRKVALG H+LH+G LKH L+V I
Sbjct  737  VDVCKDLSVVDELGNRKVALGKHMLHVGDLKHPLSVMI  774



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C + A DIHL +KN G +S   +V LFS+PPA+HNAP+K L+ F+KV L+   + +V F 
Sbjct  677  CQNLAFDIHLRIKNKGKMSSSQTVFLFSTPPAVHNAPQKHLLAFEKVLLTGKSEALVSFK  736

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            VDVCK L +VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  737  VDVCKDLGLVDELGNRKVALGKHMLHVGDLKHPLSVMI  774



>dbj|BAD94522.1| beta-xylosidase - like protein [Arabidopsis thaliana]
Length=287

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
              S  ++HLNVKN G  +G H+V LF++ P +H +P KQL+GF+K+RL  +E+ VV FNV
Sbjct  191  GGSDFEVHLNVKNTGDRAGSHTVFLFTTSPQVHGSPIKQLLGFEKIRLGKSEEAVVRFNV  250

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            +VCK LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  251  NVCKDLSVVDETGKRKIALGHHLLHVGSLKHSLNISV  287



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -2

Query  442  QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            Q C + A DI L++KN G +S   +V LFS+PPA+HNAP+K L+ F+KV L    + VV 
Sbjct  675  QHCQNLAFDIQLSIKNNGKMSISQTVFLFSTPPAVHNAPQKHLLAFEKVHLMGKSEAVVS  734

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            F VDVCK LSVVDE GNRKVALG H+LH+G LKH L V I
Sbjct  735  FKVDVCKDLSVVDEVGNRKVALGQHMLHVGDLKHPLGVRI  774



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++ + V+N G   G H+V LF++PPA+H +PRK L+GF+K+RL   E+ VV F V+V
Sbjct  690  SAFEVQIKVRNGGDREGIHTVFLFTTPPAIHGSPRKHLLGFEKIRLGKMEEAVVRFKVEV  749

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  750  CKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  784



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   103 bits (258),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++ + V+N G   G H+V L+++PPA+H +PRK L+GF+KVRL   E+ VV F V+V
Sbjct  682  SAFEVQIKVRNGGDREGIHTVFLYTTPPAVHGSPRKHLLGFEKVRLGKMEEAVVRFRVEV  741

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  742  CKDLSVVDEVGKRKIGLGKHLLHVGDLKHSLSIRI  776



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = -2

Query  445  EQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedev  269
            EQ C  S   DIHL V+N     G HSVLLF +PP++HN+PRK L+GF+K+ L      +
Sbjct  675  EQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTPPSVHNSPRKHLIGFEKISLKGKSGTL  734

Query  268  vvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            + F VDVCK LSVVDE G RK+ALG +VLH+G+ KH+L++ I
Sbjct  735  MRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNFKHTLSLRI  776



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = -2

Query  445  EQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedev  269
            EQ C  S   DIHL V+N     G HSVLLF +PP++HN+PRK L+GF+K+ L      +
Sbjct  675  EQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTPPSVHNSPRKHLIGFEKISLKGKSGTL  734

Query  268  vvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            + F VDVCK LSVVDE G RK+ALG +VLH+G+ KH+L++ I
Sbjct  735  MRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNFKHTLSLRI  776



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   103 bits (258),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            A ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDVC
Sbjct  687  AFEVHIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVC  746

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            K LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  747  KDLSVVDEVGKRKIGLGQHLLHVGDVKHSLSIRI  780



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   103 bits (256),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++ + V+N G   G H+V LF++PP +H +PRK L+GF+K+RL   E+ VV F V++
Sbjct  685  SAFEVEVKVQNGGEREGIHTVFLFTTPPDVHGSPRKHLLGFEKIRLGKMEEAVVRFKVEI  744

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG H+LH+G LKHSL++ I
Sbjct  745  CKDLSVVDEIGKRKIALGKHLLHVGDLKHSLSIRI  779



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   103 bits (256),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++ + V+N G   G H+V LF++PPA+H +P+K L+GF+K+RL   E+ VV F V V
Sbjct  690  SAFEVQIKVRNGGDREGIHTVFLFTTPPAVHGSPKKHLLGFEKIRLGKMEEAVVRFKVKV  749

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  750  CKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  784



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ LNVKN G   G H+V LF++PPA+H +P K L+GF+KVRL  NE+ VV FNVDV
Sbjct  685  SGFEVQLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGFEKVRLGKNEEAVVRFNVDV  744

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  745  CKDLSVVDEIGTRKIALGHHLLHVGSLKHSLNITV  779



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   103 bits (256),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            SA ++ + V+N G   G H+V LF++PP +H +PRK L+GF+KVRL   E+ VV F V V
Sbjct  682  SAFEVQIKVRNGGEREGIHTVFLFTTPPDVHGSPRKHLLGFEKVRLGKMEEAVVRFKVAV  741

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  742  CKDLSVVDEVGKRKIGLGKHLLHVGDLKHSLSIRI  776



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            ++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K L+ F+KV L    +  V
Sbjct  675  DEHCQNLAFDIHLGVKNLGQMSSNHVVLLFFTPPHVHNAPQKHLLAFEKVHLPGKSETQV  734

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE GNRKV LG H+LH+G+ KH ++V +
Sbjct  735  RFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNFKHPISVRV  775



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++HLNVKN G  +G H+V LF++ P +H +P KQL+GF+K+RL  +E+ VV FNV+V
Sbjct  679  SDFEVHLNVKNTGDRAGSHTVFLFTTSPQVHGSPIKQLLGFEKIRLGKSEEAVVRFNVNV  738

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  739  CKDLSVVDETGKRKIALGHHLLHVGSLKHSLNISV  773



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  445  EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevv  266
            E+    +A ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF+K+ L   E+ VV
Sbjct  678  EKNAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKISLGKREEAVV  737

Query  265  vfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             F VDVCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  738  KFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHSLSIRI  778



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   101 bits (252),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            +A ++ + V+N G   G H+V LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDV
Sbjct  686  TAFEVQIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDV  745

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  746  CKDLSVVDEVGKRKIGLGRHLLHVGDVKHSLSIRI  780



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   101 bits (252),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            +A ++ + V+N G   G H+V LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDV
Sbjct  697  TAFEVQIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDV  756

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  757  CKDLSVVDEVGKRKIGLGRHLLHVGDVKHSLSIRI  791



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   101 bits (252),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            +A ++ + V+N G   G H+V LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDV
Sbjct  697  TAFEVQIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDV  756

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  757  CKDLSVVDEVGKRKIGLGQHLLHVGDVKHSLSIRI  791



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +    +H+ VKNVG   GG++VLLFS+PP +HNAPRK+L+GF+KV + P  +  V F 
Sbjct  672  CPNLTFSLHVKVKNVGDRHGGNTVLLFSTPPRVHNAPRKRLLGFEKVHVEPRSERAVEFR  731

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
            V+VC+ L VVDE G++KVALG H  H+G+L HSL+V
Sbjct  732  VEVCEGLGVVDEFGSKKVALGSHTFHVGNLVHSLSV  767



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/95 (56%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  +I L V N G   G H+V LF++PPA+H +P K L+GF+K+RL  NE+ VV F V+V
Sbjct  678  SDFEIQLKVANAGDREGSHTVFLFTTPPAIHRSPIKHLLGFEKIRLVKNEETVVRFKVNV  737

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG HVLH+G+LKHSL + +
Sbjct  738  CKDLSVVDETGKRKIGLGEHVLHVGNLKHSLNIRV  772



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S +++ LNVKN G   G H+V LF++PPA+H +P K L+GF+KVRL  NE+ VV F VDV
Sbjct  685  SGIEVKLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGFEKVRLRKNEEAVVRFKVDV  744

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG ++LH+G LKHSL + +
Sbjct  745  CKDLSVVDEIGTRKIALGHYLLHVGSLKHSLNITV  779



>gb|AFG54596.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV +     E V F+
Sbjct  30   CQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKVHVGAGATERVQFS  89

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            +DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  90   IDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S +++ LNVKN G   G H+V LF++PPA+H +P K L+GF+KVRL  NE+ VV F VDV
Sbjct  671  SGIEVKLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGFEKVRLRKNEEAVVRFKVDV  730

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG ++LH+G LKHSL + +
Sbjct  731  CKDLSVVDEIGTRKIALGHYLLHVGSLKHSLNITV  765



>gb|AFG54601.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV +     E V F+
Sbjct  30   CQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKVHVGAGATERVQFS  89

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            +DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  90   IDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ LNVKN G   G H+V LF++PPA+H +P K L+GF+KVRL  NE+ VV F VDV
Sbjct  658  SGFEVQLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGFEKVRLGKNEEAVVSFKVDV  717

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG H LH+G LKHSL + +
Sbjct  718  CKDLSVVDEIGTRKIALGHHHLHVGSLKHSLNITV  752



>gb|AFG54595.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54597.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54598.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54599.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54600.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54605.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54606.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54607.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54608.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54610.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV +     E V F+
Sbjct  30   CQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKVHVGAGATERVQFS  89

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            +DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  90   IDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ LNVKN G   G H+V LF++PPA+H +P K L+GF+KVRL  NE+ VV F VDV
Sbjct  700  SGFEVQLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGFEKVRLGKNEEAVVSFKVDV  759

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ALG H LH+G LKHSL + +
Sbjct  760  CKDLSVVDEIGTRKIALGHHHLHVGSLKHSLNITV  794



>emb|CAB89360.1| beta-glucosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09525.1| unnamed protein product [Arabidopsis thaliana]
Length=411

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ L V+NVG   G  +V LF++PP +H +PRKQL+GF+K+RL   E+ VV F VDV
Sbjct  317  SDFEVQLKVRNVGDREGTETVFLFTTPPEVHGSPRKQLLGFEKIRLGKKEETVVRFKVDV  376

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK L VVDE G RK+ALG H+LH+G LKHS  + +
Sbjct  377  CKDLGVVDEIGKRKLALGHHLLHVGSLKHSFNISV  411



>gb|AFG54602.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54603.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54604.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54609.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV +     E V F 
Sbjct  30   CQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKVHVGAGATERVQFG  89

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            +DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  90   IDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ + V+N G   G H+V LF++PP +H APRK L+GF+K+RL   E+ VV F VDV
Sbjct  682  SGFEVQVKVRNGGEREGVHTVFLFTTPPEVHGAPRKHLLGFEKIRLGKMEEAVVKFKVDV  741

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H LH+G LKHSL++ I
Sbjct  742  CKDLSVVDEIGKRKIGLGQHRLHVGDLKHSLSIRI  776



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LDIH++VKN GT+ G H++L+F++PPA   AP KQLVGF KV +    +  V   
Sbjct  672  CDSLSLDIHVDVKNTGTMDGTHTLLVFATPPAEKWAPNKQLVGFHKVHIVAGSERRVRVG  731

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  732  VHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   100 bits (249),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ + V+N G   G H+V LF++PP +H APRK L+GF+K+RL   E+ VV F VDV
Sbjct  682  SGFEVQVKVRNGGEREGVHTVFLFTTPPEVHGAPRKHLLGFEKIRLGKMEEAVVKFKVDV  741

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK LSVVDE G RK+ LG H LH+G LKHSL++ I
Sbjct  742  CKDLSVVDEIGKRKIGLGQHRLHVGDLKHSLSIRI  776



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  421  LDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCK  242
             ++ L V+NVG   G H+V LF++PP +H +PRK L+GF+K+RL   E+ V+ FNVDVCK
Sbjct  687  FEVQLKVRNVGDREGSHTVFLFTTPPEVHGSPRKHLLGFEKIRLGEKEETVIRFNVDVCK  746

Query  241  HLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             LSVVDE G RK+ALG ++LH+G  KHSLT+ +
Sbjct  747  DLSVVDEIGKRKIALGHYLLHVGSFKHSLTISV  779



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   100 bits (248),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            A+++ L V+N G   G  +V LF++PPA+H +P K LV F+KVRL   E   V FNVDVC
Sbjct  681  AIEVELRVRNAGEREGTETVFLFTTPPAVHRSPVKHLVAFEKVRLGKKEKAAVRFNVDVC  740

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            K LSVVDE G RK+ALG+HVLH+G LK+SL V I
Sbjct  741  KDLSVVDENGKRKIALGVHVLHVGSLKYSLIVRI  774



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            A+++ L V+N G   G  +V LF++PPA+H +P K L+ F+KVRL   E  VV FNVDVC
Sbjct  602  AIEVQLRVRNAGEREGTDTVFLFTTPPAVHRSPVKHLLAFEKVRLGKEEKAVVRFNVDVC  661

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            K LSVVDE G RK+ALG+HVLH+G LK+SL V I
Sbjct  662  KDLSVVDETGKRKIALGVHVLHVGSLKYSLIVRI  695



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LDIH++VKN GT+ G H++L+F +PPA   AP KQLVGF KV +    +  V   
Sbjct  672  CDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKWAPNKQLVGFHKVHIVAGSERRVRVG  731

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  732  VHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LDIH++VKN GT+ G H++L+F +PPA   AP KQLVGF KV +    +  V   
Sbjct  672  CDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKWAPNKQLVGFHKVHIVAGSERRVRVG  731

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  732  VHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LDIH+++KN GT+ G H++L+F++PPA   AP KQLVGF KV +    +  V   
Sbjct  672  CDSLSLDIHVDIKNTGTMDGTHTLLVFATPPAEKWAPNKQLVGFHKVHIVAGLERRVRVG  731

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  732  VHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|NP_196532.2| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AED91435.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=526

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ L V+NVG   G  +V LF++PP +H +PRKQL+GF+K+RL   E+ VV F VDV
Sbjct  432  SDFEVQLKVRNVGDREGTETVFLFTTPPEVHGSPRKQLLGFEKIRLGKKEETVVRFKVDV  491

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK L VVDE G RK+ALG H+LH+G LKHS  + +
Sbjct  492  CKDLGVVDEIGKRKLALGHHLLHVGSLKHSFNISV  526



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            A+++ L V+N G   G  +V LF++PPA+H +P K L+ F+KVRL   E  VV FNVDVC
Sbjct  681  AIEVQLRVRNAGEREGTDTVFLFTTPPAVHRSPVKHLLAFEKVRLGKKEKAVVRFNVDVC  740

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            K LSVVDE G RK+ALG+HVLH+G LK+SL V I
Sbjct  741  KDLSVVDETGKRKIALGVHVLHVGSLKYSLIVRI  774



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPP--ALHNAPRKQLVGFQKVRLSPnedevvvf  260
             S+A ++H+ VKN G   G H+V LF++PP  ++  +PRK L+GF+KVRL   E++VV F
Sbjct  683  GSAAFEVHMKVKNSGEAEGTHTVFLFTTPPQSSVRGSPRKHLLGFEKVRLGKEEEKVVRF  742

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             ++VCK LS+VDE G RKV LG HVLH+G LKHSL+V +
Sbjct  743  RIEVCKDLSLVDEFGTRKVVLGEHVLHVGSLKHSLSVRV  781



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -2

Query  427  SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdV  248
            S  ++ + V+N G   G H+V LF++PP +H +PRK L+GF+K+RL   E+ VV F VDV
Sbjct  682  SGFEVQVKVRNGGDREGIHTVFLFTTPPEVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDV  741

Query  247  CKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            CK L+VVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  742  CKDLNVVDEIGKRKIGLGQHLLHVGDLKHSLSIRI  776



>ref|NP_001280797.1| putative beta-D-xylosidase precursor [Malus domestica]
 gb|ADI79208.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Malus domestica]
Length=774

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LD+H+++KN GT+ G H++L+F++PP    AP KQLVGF KV +    +  V   
Sbjct  670  CDSLSLDVHIDIKNSGTMDGTHTLLVFATPPTGKWAPNKQLVGFHKVHIVAGSERRVRVG  729

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLSVVDE G R++ LG H L IG L+H ++VE
Sbjct  730  VQVCKHLSVVDELGIRRIPLGQHKLEIGDLQHHVSVE  766



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            A+++ L V+N G   G  +V LF++PPA+H +P K LV F+KVRL   E   V FNVDVC
Sbjct  681  AIEVQLRVRNAGEREGTETVFLFTTPPAVHRSPVKHLVAFEKVRLGKKEKAAVRFNVDVC  740

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            K LSVVDE G RK+ALG+HVLH+G LK+SL V 
Sbjct  741  KDLSVVDETGKRKIALGVHVLHVGSLKYSLIVR  773



>ref|XP_008353169.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=774

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LD+H+++KN GT+ G H++L+F++PP    AP KQLVGF KV +    +  V   
Sbjct  670  CDSLSLDVHIDIKNSGTMDGTHTLLVFATPPTGKWAPNKQLVGFHKVHIVAGSERRVRVG  729

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLSVVD  G R++ LG H L IG L+H ++VE
Sbjct  730  VQVCKHLSVVDXXGIRRIPLGQHKLEIGDLQHHVSVE  766



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            A ++ L V+N G   G H+V +F SPPA+H +P K L+ F+KVR    E  VV F VDVC
Sbjct  683  AFEVQLRVRNAGNREGSHTVFMFMSPPAVHRSPVKHLLAFEKVRPGMKEKTVVRFEVDVC  742

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            K LSVVDE G RK+ALG HVLH+G LK+SL + I
Sbjct  743  KDLSVVDETGKRKIALGKHVLHVGSLKYSLYITI  776



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +L  H++V+N GT+ G H++L+FS+PPA   +P KQL+GF +V +     + V  N
Sbjct  672  CDSLSLPFHIDVQNTGTIDGTHTLLVFSTPPAGKWSPNKQLIGFHRVHVLAGSQQRVEIN  731

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            +  CKHLS+VDE G R++ +G H LHIG L+HS++++
Sbjct  732  IHACKHLSIVDELGIRRIPMGAHSLHIGDLEHSISLQ  768



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -2

Query  421  LDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCK  242
             ++ L V N G   G H+V LF++PP +H +P K L+GF+KVRL  +E+ +V F V+VCK
Sbjct  688  FEVQLKVTNAGDREGSHTVFLFTTPPEVHGSPVKHLLGFEKVRLRKSEEAMVRFKVNVCK  747

Query  241  HLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  748  DLSVVDEIGTRKIALGHHLLHVGSLKHSLNITV  780



>emb|CDP17082.1| unnamed protein product [Coffea canephora]
Length=195

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL-HNAPRKQLVGFQKVRLSPnedevvvf  260
            C+  ++ +H++VKNVG + G H++L+FSSPP   H AP KQLV F+KV +     + V  
Sbjct  89   CSRLSIGVHVDVKNVGGMDGSHTLLVFSSPPGSGHWAPHKQLVAFEKVHVPARAQQRVFL  148

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             + VCK+LSVVD AG R++ +GLH LHIG + HS++++
Sbjct  149  KIHVCKYLSVVDRAGIRRIPMGLHSLHIGPITHSISLQ  186



>ref|XP_010024778.1| PREDICTED: putative beta-D-xylosidase [Eucalyptus grandis]
 gb|KCW61273.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=788

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +++L IH+N++N G++ G H++L+FS+PP    +P +QL+GF+KV +S      V  +
Sbjct  688  CNAASLGIHVNIENTGSMDGTHTLLVFSAPPEGKWSPARQLIGFEKVHVSAGSQRRVRID  747

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VC+HLSVVDE G R++ +G H LH+G ++HS+T++
Sbjct  748  VRVCEHLSVVDEFGIRRIPIGEHKLHVGDVEHSMTLQ  784



>gb|KCW61272.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=749

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +++L IH+N++N G++ G H++L+FS+PP    +P +QL+GF+KV +S      V  +
Sbjct  649  CNAASLGIHVNIENTGSMDGTHTLLVFSAPPEGKWSPARQLIGFEKVHVSAGSQRRVRID  708

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VC+HLSVVDE G R++ +G H LH+G ++HS+T++
Sbjct  709  VRVCEHLSVVDEFGIRRIPIGEHKLHVGDVEHSMTLQ  745



>dbj|BAF79669.1| beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF KV +    +  V   
Sbjct  670  CDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHKVHIVAGSERRVRVG  729

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  730  VHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>dbj|BAD98523.1| alpha-L-arabinofuranosidase / beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF KV +    +  V   
Sbjct  670  CDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHKVHIVAGSERRVRVG  729

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  730  VHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -2

Query  421  LDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCK  242
             ++ L V N G   G H+V LF++PP +H +P K L+GF+KVRL  +E+ +V FNVDVCK
Sbjct  687  FEVQLKVTNAGDREGTHTVFLFTTPPEVHGSPVKHLLGFEKVRLGKSEEAMVRFNVDVCK  746

Query  241  HLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
             LSVVDE G RK+ALG H+LH+G LKHSL +
Sbjct  747  DLSVVDEIGTRKIALGHHLLHVGSLKHSLNI  777



>gb|AGR44452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=774

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF KV +    +  V   
Sbjct  670  CDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHKVHIVAGSERRVRVG  729

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  730  VHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRLSPnedevvv  263
            C   ++++H++VKNVG+  G H++L+FS+PPA   H AP KQLV F+KV +     + V 
Sbjct  642  CGKLSINLHVDVKNVGSKDGIHTLLVFSAPPAGNGHWAPHKQLVAFEKVHIPAKAQQRVR  701

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
              + VCK LSVVD +G R++ +GLH LHIG +KHS++++
Sbjct  702  VKIHVCKLLSVVDRSGTRRIPMGLHSLHIGDVKHSVSLQ  740



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRLSPnedevvv  263
            C   ++++H++VKNVG+  G H++L+FS+PPA   H AP KQLV F+KV +     + V 
Sbjct  665  CGKLSINLHVDVKNVGSKDGIHTLLVFSAPPAGNGHWAPHKQLVAFEKVHIPAKAQQRVR  724

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
              + VCK LSVVD +G R++ +GLH LHIG +KHS++++
Sbjct  725  VKIHVCKLLSVVDRSGTRRIPMGLHSLHIGDVKHSVSLQ  763



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            +L +H++VKN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  669  SLGLHVDVKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  728

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  729  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  761



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
              D+ L V+N G + G H+VLLF S P +H+AP K+L+GF K+ L    + V  F +DVC
Sbjct  670  GFDLQLKVRNEGGMGGSHTVLLFVSTPRVHDAPEKRLLGFDKLHLGGWGEGVARFRIDVC  729

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            +HLSVVDE G RK+ LG HVLH+G  KHS  V I
Sbjct  730  EHLSVVDEFGKRKLGLGEHVLHVGGSKHSFNVAI  763



>ref|XP_006349198.1| PREDICTED: probable beta-D-xylosidase 2-like [Solanum tuberosum]
Length=774

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+  ++ IH++VKNVG   G H++L+FS PP     P KQLV FQKV +     + V  N
Sbjct  669  CSKLSIQIHIDVKNVGPKDGSHTLLVFSKPPVDVWVPHKQLVAFQKVYVPARSKQRVAIN  728

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD+AG R++++G H +HIG  KHSL+++
Sbjct  729  IHVCKYLSVVDKAGVRRISIGEHSIHIGDAKHSLSLQ  765



>gb|KJB49844.1| hypothetical protein B456_008G140600 [Gossypium raimondii]
Length=774

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ++ + +NVKN G+  G H++L+FS+PPA H AP KQLV F KV +    ++ V  +
Sbjct  669  CNKLSVGLQVNVKNTGSKDGTHTMLVFSTPPAGHWAPSKQLVAFAKVYVPARSEQQVGIS  728

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++ +GLH +HIG +KHS+++E
Sbjct  729  IHVCKFLSVVDRSGVRRIPIGLHRIHIGDVKHSVSLE  765



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L + ++VKN+G++ G H++L++S PPA H AP KQLV F+KV ++    + V  N
Sbjct  665  CNKLSLGVQVDVKNIGSMDGTHTLLVYSRPPARHWAPHKQLVAFEKVHVAAGTQQRVGIN  724

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  725  IHVCKSLSVVDASGIRRIPMGEHSLHIGDVKHSVSLQ  761



>gb|KDO71842.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=369

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  269  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  328

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  329  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  361



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C    L + ++VKNVG+  G H++L+FS+PPA H AP KQLV F+KV +     + V  N
Sbjct  665  CNRLTLGVQVDVKNVGSKDGAHTLLVFSTPPAGHWAPHKQLVAFEKVHVPAGAQQRVGIN  724

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
            + VCK+LSVVD +G R++ LG H +HIG  KHS+++
Sbjct  725  IHVCKYLSVVDRSGTRRIPLGEHNIHIGGTKHSVSL  760



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L + ++VKN+G++ G H++L++S PPA H AP KQLV F+KV ++    + V  N
Sbjct  665  CNKLSLGMQVDVKNIGSMDGTHTLLVYSRPPARHWAPHKQLVAFEKVHVAAGTQQRVGIN  724

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  725  IHVCKSLSVVDASGIRRIPMGEHSLHIGDVKHSVSLQ  761



>gb|AEW09080.1| hypothetical protein CL3618Contig1_02, partial [Pinus lambertiana]
Length=86

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  409  LNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSV  230
            + V NVG   GGH + LFSSPP+ H+AP+KQL+GF+K+ L     E V F ++VCK LS+
Sbjct  1    VEVSNVGRREGGHVLFLFSSPPSRHHAPKKQLLGFRKLHLQAGAMEKVHFTLNVCKDLSI  60

Query  229  VDEAGNRKVALGLHVLHIGHLKHSLT  152
            VD+ G RK+ +G H+LHIG L+HS++
Sbjct  61   VDKTGTRKLPVGSHLLHIGDLQHSVS  86



>gb|KDO71844.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=485

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  385  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  444

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  445  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  477



>gb|KDO71845.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71846.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71847.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71848.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=486

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  386  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  445

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  446  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  478



>gb|ABK96385.1| unknown [Populus trichocarpa x Populus deltoides]
Length=343

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C + AL +H++VKN G + G H++L+FSSPP    + +KQL+GF+KV L     + V  +
Sbjct  239  CEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQLIGFEKVHLVTGSQKRVKID  298

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCKHLSVVD  G R++  G H L+IG LKHS++++
Sbjct  299  IHVCKHLSVVDRFGIRRIPNGEHYLYIGDLKHSISLQ  335



>gb|KDO71843.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=476

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  376  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  435

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  436  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  468



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+  ++ +H++VKNVG+  G  ++L+FS PP    AP KQLV FQKV +     + V  N
Sbjct  668  CSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPIGLWAPHKQLVAFQKVHVPAGSLQRVAIN  727

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD+AG R++ +G H LHIG  KHSL+++
Sbjct  728  IHVCKYLSVVDKAGVRRIPIGEHSLHIGDAKHSLSLQ  764



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C + AL +H++VKN G + G H++L+FSSPP    + +KQL+GF+KV L     + V  +
Sbjct  664  CEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQLIGFEKVHLVTGSQKRVKID  723

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCKHLSVVD  G R++ +G H L+IG LKHS++++
Sbjct  724  IHVCKHLSVVDRFGIRRIPIGEHDLYIGDLKHSISLQ  760



>gb|KDO71849.1| hypothetical protein CISIN_1g0062242mg [Citrus sinensis]
Length=415

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  245
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  315  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  374

Query  244  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  375  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  407



>gb|EYU46800.1| hypothetical protein MIMGU_mgv1a018473mg [Erythranthe guttata]
Length=757

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L + ++VKN G+  G H++L+F+SPP    AP KQLV F+KVR++    E V   
Sbjct  652  CKGLSLSVGMDVKNTGSRDGSHTLLVFASPPGGGWAPHKQLVAFEKVRVAAGGQERVAVR  711

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD AG R++ +G+H LHIG +KHS++++
Sbjct  712  IHVCKFLSVVDGAGIRRIPMGVHALHIGGVKHSVSLQ  748



>emb|CDO98788.1| unnamed protein product [Coffea canephora]
Length=770

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +  L +H +V+NVG   G HS+L+FS+PPA   AP KQLV F+KV +     + +  +
Sbjct  666  CDAMKLGMHFDVQNVGERDGSHSLLVFSTPPAGKWAPAKQLVAFEKVHVLAGAQQRISVH  725

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             D CKHLSVVD  G R++ +G+H L IG L+H++T++
Sbjct  726  FDACKHLSVVDRFGIRRIPMGVHSLQIGDLEHAITLQ  762



>gb|KDO87030.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
 gb|KDO87031.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
Length=544

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C    L + ++VKNVG+  G H++L+FS+PPA H AP KQLV F+KV +     + V  N
Sbjct  439  CNRLTLGVQVDVKNVGSKDGAHTLLVFSTPPAGHWAPHKQLVAFEKVHVPAGAQQRVGIN  498

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
            + VCK+LSVVD +G R++ LG H +HIG  KHS+++
Sbjct  499  IHVCKYLSVVDRSGTRRIPLGEHNIHIGGTKHSVSL  534



>ref|NP_001266107.1| SlArf/Xyl2 protein precursor [Solanum lycopersicum]
 dbj|BAL44717.1| SlArf/Xyl2 [Solanum lycopersicum]
Length=774

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+  ++ IH++VKNVG   G H++L+FS PP     P KQLV FQKV +     + V  N
Sbjct  669  CSKISVQIHVDVKNVGPKDGSHTLLVFSKPPVDIWVPHKQLVAFQKVYVPARSKQRVAIN  728

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H +HIG  KHSL+++
Sbjct  729  IHVCKYLSVVDRAGVRRIPIGEHSIHIGDAKHSLSLQ  765



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ++ +H++VKN G + G HS+L+FS PP    AP KQLV F+KV +    ++ V   
Sbjct  671  CDGLSVVVHVDVKNTGPMDGAHSLLVFSEPPTGQWAPSKQLVAFEKVHVPAGTEQRVEVK  730

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            +  CKHLSVVD  G R++ +G H LHIG +KHS++++
Sbjct  731  IHACKHLSVVDRFGIRRIPMGEHSLHIGDVKHSVSLQ  767



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = -2

Query  439   TCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvf  260
             T     +++ L V N GT  G H+V LF +PPA+H +P K LV F+K+ L   E  VV F
Sbjct  915   TYCGKTVEVQLEVINAGTREGSHTVFLFMTPPAVHRSPVKHLVTFEKLLLGRTEIAVVRF  974

Query  259   nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             ++DVCK LSVVDE G R++ALG +VLH+G LK+SL + I
Sbjct  975   DLDVCKDLSVVDETGKRQIALGEYVLHVGSLKYSLYITI  1013



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S +L IH++V+N G   G H++L+FS+PP    A  KQLVGFQKV L+    + V+  
Sbjct  678  CNSLSLRIHIDVENNGPTDGTHTLLIFSTPPTHKWAAHKQLVGFQKVHLAAGSRQRVILG  737

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  146
            V VCKHLS+VD+ G R++ +G H LHIG  LKHS++ +
Sbjct  738  VHVCKHLSIVDQFGIRRIPMGEHTLHIGDDLKHSISFQ  775



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRLSPnedevvv  263
            C   +L +H++VKNVG+  G H++L+FS+PP    H AP KQLV FQKVR++    + V 
Sbjct  672  CNRLSLGLHVDVKNVGSRDGSHTLLVFSTPPTENGHWAPLKQLVAFQKVRVAAGSQQRVR  731

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             ++ VCK+LSVVD +G R++ +G H +HIG  +HS++++
Sbjct  732  ISIHVCKYLSVVDRSGIRRLPMGEHNIHIGDARHSVSLQ  770



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C + AL +H++VKN G + G H++L+FSSPP    + +KQL+GF+KV L     + V  +
Sbjct  663  CEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQLIGFEKVHLVTGSQKRVKID  722

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
            + VCKHLSVVD  G R++ +G H L+IG LKHS+++
Sbjct  723  IHVCKHLSVVDRFGIRRIPIGEHDLYIGDLKHSISL  758



>ref|XP_010268028.1| PREDICTED: probable beta-D-xylosidase 2 [Nelumbo nucifera]
Length=767

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPP-ALHNAPRKQLVGFQKVRLSPnedevvvf  260
            C   ++ +H++VKN G+  G HS+L+FSSPP A H  P+KQLV F+KV L     + V  
Sbjct  668  CDGLSVVLHVDVKNAGSKDGSHSLLVFSSPPPAEHWVPQKQLVAFEKVHLPAGSQQRVQI  727

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
             + +CK LSVVD+ G R++ LG HVLHIG++ HS+ +
Sbjct  728  TIHLCKFLSVVDKLGIRRIPLGQHVLHIGNIHHSIVL  764



>gb|AEW09079.1| hypothetical protein CL3618Contig1_02, partial [Pinus radiata]
Length=86

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  409  LNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSV  230
            + V NVG   GGH + LFSSPP+ H+AP+KQL+GF+K+ L     E V F ++VCK LS+
Sbjct  1    VEVSNVGRREGGHVLFLFSSPPSKHHAPKKQLLGFRKLHLQAGAMEKVHFTLNVCKDLSI  60

Query  229  VDEAGNRKVALGLHVLHIGHLKHSLT  152
            VD+ G RK+ +G H+LHIG ++HS++
Sbjct  61   VDKTGTRKLPVGSHLLHIGDVQHSVS  86



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/98 (46%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPA-LHNAPRKQLVGFQKVRLSPnedevvvf  260
            C S +L +H++V+N+G + G H++LLFS PPA +  +P KQL+ F +V +     + V  
Sbjct  669  CDSLSLPLHIDVENIGNMDGTHTLLLFSEPPAAVKWSPNKQLISFHRVHVIAGSKQRVKI  728

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            NV  CKHLSVVDE G R++ +G H L+IG LKHS++++
Sbjct  729  NVHACKHLSVVDEFGIRRIPMGQHSLYIGDLKHSISLQ  766



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +  + ++VKN G++ G H++L++S PPA H AP KQLV F+KV ++      V  N
Sbjct  665  CNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHWAPLKQLVAFEKVHVTAGTQRRVGIN  724

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  725  VHVCKFLSVVDRSGIRRIPMGAHSLHIGDVKHSVSLQ  761



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +  + ++VKN G++ G H++L++S PPA H AP KQLV F+KV ++    + V  N
Sbjct  665  CNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHWAPLKQLVAFEKVHVAAGTQQRVGIN  724

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  725  VHVCKFLSVVDRSGIRRIPMGAHSLHIGDVKHSVSLQ  761



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H++VKN G+  G H++L+FS PPA   AP+KQLV F++V L     + V  +
Sbjct  660  CGQLSLMVHVDVKNEGSKDGAHTLLVFSRPPAGKWAPQKQLVAFERVHLPAGSQQRVRVH  719

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD++G R++ LG H +HIG+ +HS++++
Sbjct  720  IHVCKYLSVVDKSGIRRIPLGDHHIHIGNARHSISLK  756



>ref|XP_011082425.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=791

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   AL +H++VKN G+  G H++L+FSSPP    AP+KQLV F+KV +     + +  +
Sbjct  686  CERLALRVHVDVKNTGSRDGSHTLLVFSSPPGGDWAPQKQLVAFEKVSVRAGGQQRIGVS  745

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD  G R++ +G H LHIG  +H++++E
Sbjct  746  IRVCKYLSVVDRFGVRRIPMGEHGLHIGDARHAVSLE  782



>ref|XP_010652235.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Vitis vinifera]
Length=626

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ++ +HL+VKNVG   G H++L+FS PPA H AP KQLV F+KV ++    + V  N
Sbjct  521  CNRLSIALHLDVKNVGNKDGSHTLLVFSKPPAGHWAPHKQLVAFEKVHVAARTQQRVQIN  580

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD +G R++ +G H LHIG  KH ++++
Sbjct  581  IHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKHLVSLQ  617



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRLSPnedevvv  263
            C   ++ + ++VKNVG+  G H++L+FS+PPA   H AP KQLV FQK+ +     + V 
Sbjct  664  CGKLSISLQVDVKNVGSKDGTHTLLVFSAPPAGNGHWAPHKQLVAFQKLHIPSKAQQRVN  723

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             N+ VCK LSVVD +G R+V +GLH LHIG +KH ++++
Sbjct  724  VNIHVCKLLSVVDRSGTRRVPMGLHSLHIGDVKHYVSLQ  762



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHN-APRKQLVGFQKVRLSPnedevvvf  260
            C S +   H++V+N G + G H++L+FS+PPA    +P KQL+GF +V +     + V  
Sbjct  667  CDSLSSLFHIDVENTGNMDGTHTLLVFSTPPAGQKWSPNKQLIGFHRVHVVAGSKQRVKI  726

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            N+  CKHLSVVDE G R++ +G H LHIG LKHS++++
Sbjct  727  NIHACKHLSVVDEFGIRRIPMGSHSLHIGDLKHSISLQ  764



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = -2

Query  439  TCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvf  260
            T     +++ L V N GT  G H+V LF +PPA+H +P K LV F+K+ L   E  VV F
Sbjct  676  TYCGKTVEVQLEVINAGTREGSHTVFLFMTPPAVHRSPVKHLVTFEKLLLGRTEMAVVRF  735

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
             +DVCK LSVVDE G R++ALG +VLH+G L +SL + I
Sbjct  736  ELDVCKDLSVVDETGKRQIALGEYVLHVGSLTYSLYITI  774



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ++ +HL+VKNVG   G H++L+FS PPA H AP KQLV F+KV ++    + V  N
Sbjct  663  CNRLSIALHLDVKNVGNKDGSHTLLVFSKPPAGHWAPHKQLVAFEKVHVAARTQQRVQIN  722

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD +G R++ +G H LHIG  KH ++++
Sbjct  723  IHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKHLVSLQ  759



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+  ++ +H++VKNVG+  G  ++L+FS PP     P KQLV FQKV +     + V  N
Sbjct  665  CSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPVGLWVPHKQLVAFQKVYVPAGSLQRVTIN  724

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H LHIG  KH+L+++
Sbjct  725  IHVCKYLSVVDRAGVRRIPIGEHSLHIGDAKHTLSLQ  761



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C    L +H++VKN G + G H++L+FSSPP    +  K+L+GF+KV L     + V  +
Sbjct  664  CEPLVLGVHIDVKNAGDMDGTHTLLVFSSPPEGKWSTNKKLIGFEKVHLVAGSKKRVKID  723

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  724  IPVCKHLSVVDRFGIRRLPIGKHDLHIGDLKHSISLQ  760



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  664  CDRLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVN  723

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AGNR++ +G H +HIG  +H+++++
Sbjct  724  IHVCKYLSVVDRAGNRRIPIGDHGIHIGDERHTVSLQ  760



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  664  CDRLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVN  723

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AGNR++ +G H +HIG  +H+++++
Sbjct  724  IHVCKYLSVVDRAGNRRIPIGDHGIHIGDERHTVSLQ  760



>gb|KHG28205.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=529

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ++ + +NVKN G+  G H++L+FS PPA H AP KQLV F KV +    ++ V  +
Sbjct  424  CNKLSVGLQVNVKNTGSKDGTHTILVFSIPPAGHWAPSKQLVAFAKVYVLARSEQQVGIS  483

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++ +GLH +HIG +KHS+++E
Sbjct  484  IHVCKFLSVVDRSGVRRIPIGLHHIHIGDVKHSVSLE  520



>gb|ADV41671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Actinidia deliciosa 
var. deliciosa]
Length=634

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++   +  V   V
Sbjct  531  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIAAGSETRVRIAV  590

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  591  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  626



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H+++KNVGT  G H++L+FS+PP+   APRKQLV F +V ++  E++ V  N
Sbjct  662  CNRLSLGVHVDIKNVGTRDGTHTMLVFSAPPSGEWAPRKQLVAFTRVHVAAGENKRVQVN  721

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  722  IHVCKYLSVVDRAGIRRIPIGDHGIHIGDESHTVSLQ  758



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  658  CNRLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVN  717

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  718  IHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  754



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++   ++ V   V
Sbjct  672  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIAAGSEKRVRIAV  731

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
              CKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  732  HACKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>ref|XP_006306830.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39728.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=625

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  520  CNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVN  579

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  580  IHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  616



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ++ + ++VKN G+  G H++L+FS PPA H AP+KQLV F KV +       V  N
Sbjct  671  CNKLSVGLQVDVKNTGSKEGTHTMLVFSKPPAGHWAPQKQLVAFAKVHVPARSQRRVGIN  730

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++  G+H LHIG  KHSL+++
Sbjct  731  IHVCKFLSVVDRSGVRRIPTGVHNLHIGGAKHSLSLQ  767



>ref|XP_002276351.1| PREDICTED: putative beta-D-xylosidase [Vitis vinifera]
Length=770

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +  L  H++VKN GT+ G H++LLFS+PP    +P K+L+ F+KV +     E V F+
Sbjct  665  CNTQPLGFHIDVKNTGTMDGSHTLLLFSTPPPGTWSPNKRLLAFEKVHVGAGSQERVRFD  724

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            V VCKHLSVVD  G  ++ +G H  HIG LKHS++++
Sbjct  725  VHVCKHLSVVDHFGIHRIPMGEHHFHIGDLKHSISLQ  761



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H+++KNVGT  G H++L+FS+PP    APRKQLV F +V ++  E++ V  N
Sbjct  662  CNRLSLGVHVDIKNVGTRDGTHTMLVFSAPPGGEWAPRKQLVAFTRVHVAAGENKRVQVN  721

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  722  IHVCKYLSVVDRAGIRRIPIGDHGIHIGDESHTVSLQ  758



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = -2

Query  412  HLNVKNVGTVSGGHSVLLFSSPPALHN-APRKQLVGFQKVRLSPnedevvvfnvdVCKHL  236
            H++V+N G + G H++L+FS+PPA    +P KQL+GF +V +     + V  N+  CKHL
Sbjct  675  HIDVENTGNMDGTHTLLVFSTPPAGQKWSPNKQLIGFHRVHVIAGSKQRVKINIHACKHL  734

Query  235  SVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            SVVDE G R++ +G H LHIG LKHS++++
Sbjct  735  SVVDEFGIRRIPMGSHSLHIGDLKHSISLQ  764



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++   +  V   V
Sbjct  672  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIAAGSETRVRIAV  731

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  732  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  663  CNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVN  722

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  723  IHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  759



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++   +  V   V
Sbjct  672  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIAAGSETRVRIAV  731

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  732  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>gb|AFG60329.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60330.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60331.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60332.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60333.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60334.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60335.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60336.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60337.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60338.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60339.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60340.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60341.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60342.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60343.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60344.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60345.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60346.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
Length=86

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  409  LNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSV  230
            + V NVG   GGH + LFSSPP+ H+AP+K L+GF+K+ L     E V F ++VCK LS+
Sbjct  1    VEVSNVGRREGGHVLFLFSSPPSKHHAPKKLLLGFRKLHLQAGAMEKVHFTLNVCKDLSI  60

Query  229  VDEAGNRKVALGLHVLHIGHLKHSLT  152
            VD+ G RK+ +G H+LHIG ++HS++
Sbjct  61   VDKTGTRKLPVGSHLLHIGDIQHSVS  86



>ref|XP_004151112.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
 gb|KGN47391.1| hypothetical protein Csa_6G309980 [Cucumis sativus]
Length=770

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -2

Query  436  CAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvf  260
            CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV L     + V  
Sbjct  665  CASVSDLPIMIDVKNTGTVDGSHTILVFSTVPNQTWSPEKHLIGFEKVHLIAGSQKRVRI  724

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             + VC HLS VDE G R++ +G H LHIG L HS++++
Sbjct  725  GIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLTHSISLQ  762



>gb|AAG10624.1|AC022521_2 Similar to xylosidase [Arabidopsis thaliana]
Length=763

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H+ V NVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  658  CDRLSLGVHVEVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVN  717

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  718  IHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  754



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L + ++VKNVG+  G +++L++S+PPA   AP KQLV F+KV ++    + V  N
Sbjct  667  CNRLSLGLQVDVKNVGSKDGTYTLLVYSTPPAGLWAPHKQLVAFEKVHVAAGSQQRVGIN  726

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD+ G R++ +GLH LHIG ++HS++++
Sbjct  727  IHVCKYLSVVDKYGIRRIPIGLHSLHIGDIEHSVSLQ  763



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H+++KNVG+  G H++L+FS+PP+   APRKQLV F +V ++  E + V  N
Sbjct  657  CNRLSLGVHVDIKNVGSRDGTHTMLVFSAPPSGEWAPRKQLVAFTRVHVATGESKRVQVN  716

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  717  IHVCKYLSVVDRAGIRRIPIGDHGIHIGDESHTVSLQ  753



>ref|NP_563659.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
 sp|Q94KD8.1|BXL2_ARATH RecName: Full=Probable beta-D-xylosidase 2; Short=AtBXL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK56255.1|AF367266_1 At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AAN28891.1| At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AEE27453.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
Length=768

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H+ V NVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  663  CDRLSLGVHVEVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVN  722

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  723  IHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  759



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L + ++VKN G++ G H++L++S PPA H AP KQLV F+KV ++    + V  N
Sbjct  660  CNRLSLGMQVDVKNTGSMDGTHTLLVYSRPPARHWAPHKQLVAFEKVHVAAGTQQRVGIN  719

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  720  IHVCKSLSVVDGSGIRRIPMGEHSLHIGDVKHSVSLQ  756



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S  +D+H++VKN G + G H+VL+FS+PP       KQLV F+KV +     + V  N
Sbjct  668  CESLDIDMHIDVKNTGDMDGTHAVLIFSTPP--DPTETKQLVAFEKVHVVAGAKQRVKIN  725

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  146
            ++ CKHLSV DE G R++ +G H +H+G HLKHS+T +
Sbjct  726  MNACKHLSVADEYGVRRIYMGEHKIHVGDHLKHSITFQ  763



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   ++ + ++VKN G+  G H++L+FS PPA H AP+KQLV F KV +       V  N
Sbjct  692  CNKLSVGLQVDVKNTGSKDGTHTMLVFSKPPAGHWAPQKQLVAFAKVLVPARSQRRVGIN  751

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++  G+H LHIG +KH L+++
Sbjct  752  IHVCKFLSVVDRSGVRRIPTGVHNLHIGGIKHPLSLQ  788



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/98 (44%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C +  L IH++VKN G + G H+VL+FS+PP       KQL+GF+KV +     + V  +
Sbjct  663  CDTLILGIHIDVKNTGDMDGTHTVLVFSTPPVGKWGANKQLIGFKKVHVVARGRQRVKIH  722

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            V VC  LSVVD+ G R++ +G H LHIG +KHS+++++
Sbjct  723  VHVCNQLSVVDQFGIRRIPIGEHSLHIGDIKHSISLQV  760



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K+ ++   ++ V   V
Sbjct  672  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHKIHIAAGSEKRVRIAV  731

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  732  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>ref|XP_006418321.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
 gb|ESQ36674.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
Length=766

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H+++KNVG+  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  661  CNRLSLGVHVDIKNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAAGEMKRVQVN  720

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  721  IHVCKYLSVVDRAGIRRIPIGDHGIHIGDETHTVSLQ  757



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L + ++V+N G+  G H++L+FS+PP    AP KQL+ F+KV+++    E V   
Sbjct  666  CNRLSLVVSVDVRNTGSKDGSHTLLVFSTPPRGLGAPHKQLITFEKVKVAAGGQERVPIK  725

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H LHIG ++H++++E
Sbjct  726  IHVCKYLSVVDGAGVRRIPMGEHALHIGDIRHAISLE  762



>ref|XP_010313018.1| PREDICTED: slArf/Xyl1 protein isoform X1 [Solanum lycopersicum]
Length=633

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S  +D+H++VKN G + G H+VL+FS+PP       KQLV F+KV +     + V  N
Sbjct  530  CESLDIDMHIDVKNTGDMDGTHAVLIFSTPP--DPTETKQLVAFEKVHVVAGAKQRVKIN  587

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  146
            ++ CKHLSV DE G R++ +G H +H+G HLKHS+T +
Sbjct  588  MNACKHLSVADEYGVRRIYMGEHKIHVGDHLKHSITFQ  625



>ref|XP_010671663.1| PREDICTED: beta-D-xylosidase 1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -2

Query  430  SSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvd  251
            +++L +H++VKN G   G H+VL+FSSPP    A  K L+GF+KV +     E V  N+ 
Sbjct  668  TTSLSLHIDVKNTGEADGSHTVLVFSSPPRGAQASEKHLIGFKKVHVLAGSLERVRMNIH  727

Query  250  VCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVEI  143
            VCKHLS  DE G R++ +G H LHIG  +KH L++++
Sbjct  728  VCKHLSTADEFGIRRIQMGEHTLHIGDDIKHQLSLQV  764



>emb|CBI22910.3| unnamed protein product [Vitis vinifera]
Length=738

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/95 (46%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  430  SSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvd  251
            ++ L  H++VKN GT+ G H++LLFS+PP    +P K+L+ F+KV +     E V F+V 
Sbjct  635  TTPLGFHIDVKNTGTMDGSHTLLLFSTPPPGTWSPNKRLLAFEKVHVGAGSQERVRFDVH  694

Query  250  VCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            VCKHLSVVD  G  ++ +G H  HIG LKHS++++
Sbjct  695  VCKHLSVVDHFGIHRIPMGEHHFHIGDLKHSISLQ  729



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C    + + ++VKN G+  G H++L+FS+ PA H AP+KQLV F KVR+     + +  N
Sbjct  713  CNKLTIGLQVDVKNTGSKDGTHTMLVFSTTPAGHWAPQKQLVAFAKVRVPAGAQQRIGIN  772

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++ +G+H LHIG++KHS++++
Sbjct  773  IHVCKFLSVVDGSGVRRIPIGVHNLHIGNVKHSVSLQ  809



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+   + +H++V N+G + G H V ++S+PP  H AP KQLVGF+++ L  N  +   F+
Sbjct  668  CSGLFMSLHIDVNNIGPMDGSHVVFVYSTPPQGHGAPSKQLVGFRRIHLPSNSQQQARFD  727

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  143
            +DVC+ LS+VD+ G +K+ +G H+  +G L HS+++++
Sbjct  728  IDVCRDLSIVDQFGLKKLPIGSHLFQVGELTHSVSLQL  765



>ref|XP_010522822.1| PREDICTED: probable beta-D-xylosidase 2 [Tarenaya hassleriana]
Length=767

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+  +L +H++VKNVG+  G H++L+FS+PPA   AP +QLV F++V ++  E + V  N
Sbjct  662  CSRLSLGVHVDVKNVGSRDGTHTMLVFSAPPAGRWAPHRQLVAFERVHVAAGEKKRVPIN  721

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  722  IHVCKYLSVVDRAGVRRIPIGDHNIHIGDATHTVSLQ  758



>ref|XP_008458374.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Cucumis 
melo]
Length=768

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -2

Query  436  CAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvf  260
            CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV L     + V  
Sbjct  663  CASVSDLPIQVDVKNTGTVDGSHTILVFSTAPNPIWSPEKHLIGFEKVHLMAGSQKRVRI  722

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
             + VC HLS VDE G R++  G H LHIG L HS+++
Sbjct  723  GIHVCDHLSRVDEFGTRRIPTGEHKLHIGDLTHSISL  759



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S  L + L+VKN G+V G  ++L+FSSPP    +  KQL+GF+K+ L     + V  N
Sbjct  671  CESLLLGLDLDVKNTGSVDGTQTLLVFSSPPEGKWSSNKQLIGFEKIHLVAGSQKQVRIN  730

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  731  IHVCKHLSVVDRFGIRRIPIGKHHLHIGDLKHSISLQ  767



>dbj|BAF43576.1| arabinofuranosidase/xylosidase homolog [Prunus persica]
Length=349

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K+ ++   ++ V   V
Sbjct  246  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHKIHIAAGSEKRVRIAV  305

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  306  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  341



>ref|XP_004172482.1| PREDICTED: beta-D-xylosidase 1-like, partial [Cucumis sativus]
Length=534

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -2

Query  436  CAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvf  260
            CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV L     + V  
Sbjct  429  CASVSDLPIMIDVKNTGTVDGSHTILVFSTVPNQTWSPEKHLIGFEKVHLIAGSQKRVRI  488

Query  259  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             + VC HLS VDE G R++ +G H LHIG L HS++++
Sbjct  489  GIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLTHSISLQ  526



>ref|XP_006352077.1| PREDICTED: beta-D-xylosidase 1-like [Solanum tuberosum]
Length=773

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C S  +D+H++VKN+G + G H+VL+FS+PP       KQLV F+KV +    ++ V  N
Sbjct  670  CESLDIDMHIDVKNIGDMDGTHTVLIFSTPP--DPTETKQLVAFEKVHVVAGANQRVKIN  727

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  146
            ++ CKHLSV DE G R++ +G H +H+G  LKHS+T +
Sbjct  728  MNACKHLSVADEYGVRRIYMGEHKIHVGDDLKHSITFQ  765



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C+  ++   ++V+NVG   G H++L+ S+PPA   APRKQLV F+KV +       V   
Sbjct  681  CSRVSVSFDVDVRNVGNRDGSHTLLVLSTPPAQDWAPRKQLVAFEKVYVPARAQRRVRIQ  740

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD  G R++ +G H LHIG L HS++++
Sbjct  741  IHVCKSLSVVDRFGIRRIPMGQHNLHIGDLMHSVSLK  777



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L I ++VKNVG+  G H++L++S+PPA   +P KQLV F++V +S    E V  +
Sbjct  663  CNKLSLGIQVDVKNVGSKDGTHTLLVYSAPPAGRWSPHKQLVAFERVHVSAGTQERVGIS  722

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCK LSVVD +G R++ +G H +HIG++KHS++++
Sbjct  723  IHVCKLLSVVDRSGIRRIPIGEHSIHIGNVKHSVSLQ  759



>gb|KFK42620.1| hypothetical protein AALP_AA1G019000 [Arabis alpina]
Length=766

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C   +L +H+++ NVGT  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  661  CNRLSLGVHVDITNVGTRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAAGEKKRVQVN  720

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  149
            + VCK+LSVVD AG R++ +G H +HIG   H++++
Sbjct  721  IHVCKYLSVVDRAGIRRIPIGDHGIHIGDETHTVSL  756



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = -2

Query  436  CASSALDI--HLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvv  263
            C    LD+  H++VKN G++ G H++L+FS PP    +  KQLV FQK+ +     + V 
Sbjct  667  CDHDTLDMEFHVDVKNDGSMDGTHTLLVFSKPPPGKWSQIKQLVNFQKIHVPAGSTQRVT  726

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
              V VCKHLSVVD+ G R++  G H LHIG LKHS++V+
Sbjct  727  VGVHVCKHLSVVDQFGIRRIPSGEHELHIGDLKHSISVQ  765



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  257
            C    L +H++VKN G + G  ++L+FSSPP    +  K+L+GF+KV +     + V  +
Sbjct  667  CEPLVLGVHIDVKNTGDMDGIQTLLVFSSPPEGKWSANKKLIGFEKVHIVAGSKKRVKID  726

Query  256  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            + VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  727  IPVCKHLSVVDRFGIRRLPIGKHDLHIGDLKHSISLQ  763



>sp|P83344.1|XYNB_PRUPE RecName: Full=Putative beta-D-xylosidase; AltName: Full=PpAz152, 
partial [Prunus persica]
 gb|AAM00218.1|AF362990_1 beta-D-xylosidase, partial [Prunus persica]
Length=461

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -2

Query  433  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  254
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K+ ++   ++ V   V
Sbjct  358  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHKIHIATGSEKRVRIAV  417

Query  253  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  418  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  453



>ref|XP_008451490.1| PREDICTED: probable beta-D-xylosidase 2 [Cucumis melo]
Length=773

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = -2

Query  436  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGFQKVRLSPnedevvv  263
            C   +L IH++V+N G   G H++L+FS+PPA      PRKQLV F+K+ LS  E   + 
Sbjct  666  CQKLSLVIHVDVENKGDRDGFHTMLVFSTPPANGATWVPRKQLVAFEKLHLSSKEKRRLQ  725

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
             +V +CK+LSVVD+ G R++ LG HV+HIG +KH+++++
Sbjct  726  VHVHICKYLSVVDKLGVRRIPLGDHVIHIGDVKHTISLQ  764



>emb|CAJ41429.1| beta (1,4)-xylosidase [Populus tremula x Populus alba]
Length=732

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -2

Query  430  SSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvd  251
             S L + ++VKN G++ G H++L++  PPA H AP KQLV F+KV ++    + V  N+ 
Sbjct  629  DSLLGMQVDVKNTGSMDGTHTLLVYFRPPARHWAPHKQLVAFEKVHVAAGTQQRVGINIH  688

Query  250  VCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  689  VCKSLSVVDGSGIRRIPMGEHSLHIGDVKHSVSLQ  723



>dbj|BAC41913.1| putative beta-xylosidase [Arabidopsis thaliana]
Length=732

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = -2

Query  439  TCASSALDIHLNVKNVGTVSGGHSVLLFSS-PPALHNAPRKQLVGFQKVRLSPnedevvv  263
            +C S   ++ ++V N G + G H V+LFS  PP L   P KQL+G+ +V +  NE    V
Sbjct  633  SCESLRFNVRVHVSNTGEIDGSHVVMLFSKMPPVLSGVPEKQLIGYDRVHVRSNEMMETV  692

Query  262  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  146
            F +D CK LSV ++ G R + LG HVL +G L+HSL+VE
Sbjct  693  FVIDPCKQLSVANDVGKRVIPLGSHVLFLGDLQHSLSVE  731



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880