BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF049A08

Length=469
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2  82.8    2e-15   
ref|XP_007026054.1|  MATE efflux family protein isoform 1             82.4    3e-15   
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.6    5e-15   Oryza brachyantha
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                 81.6    5e-15   Citrus sinensis [apfelsine]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg           81.6    5e-15   Citrus clementina [clementine]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     81.6    5e-15   Citrus sinensis [apfelsine]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12          80.5    1e-14   Glycine max [soybeans]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.5    2e-14   Populus euphratica
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.1    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026056.1|  MATE efflux family protein                       80.5    2e-14   
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     80.1    2e-14   Cicer arietinum [garbanzo]
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                          80.1    2e-14   
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                     80.1    2e-14   
gb|KJB69293.1|  hypothetical protein B456_011G014800                  79.7    3e-14   Gossypium raimondii
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  79.3    3e-14   Brachypodium distachyon [annual false brome]
emb|CDM86692.1|  unnamed protein product                              79.3    3e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  79.3    4e-14   Pyrus x bretschneideri [bai li]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12          79.3    4e-14   Phoenix dactylifera
gb|KJB30571.1|  hypothetical protein B456_005G149900                  79.0    4e-14   Gossypium raimondii
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     79.0    4e-14   Populus euphratica
emb|CDM86696.1|  unnamed protein product                              79.0    5e-14   Triticum aestivum [Canadian hard winter wheat]
gb|EEC75604.1|  hypothetical protein OsI_12313                        79.0    5e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001050520.1|  Os03g0570800                                     79.0    5e-14   
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     79.0    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  78.2    6e-14   Brachypodium distachyon [annual false brome]
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140        78.6    7e-14   Sorghum bicolor [broomcorn]
emb|CDM86687.1|  unnamed protein product                              78.2    8e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.2    9e-14   
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     78.2    1e-13   Cicer arietinum [garbanzo]
gb|AAR00628.1|  putative MATE family protein                          77.4    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein            77.8    1e-13   Gossypium arboreum [tree cotton]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  77.8    1e-13   Populus euphratica
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  77.4    2e-13   Pyrus x bretschneideri [bai li]
gb|KDP20758.1|  hypothetical protein JCGZ_21229                       77.4    2e-13   Jatropha curcas
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                          77.0    2e-13   
emb|CDM86677.1|  unnamed protein product                              77.0    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     77.0    2e-13   Brassica rapa
gb|KJB57728.1|  hypothetical protein B456_009G178100                  77.0    2e-13   Gossypium raimondii
emb|CDX76391.1|  BnaA08g10090D                                        77.0    2e-13   
emb|CDY27434.1|  BnaC03g64740D                                        77.0    2e-13   Brassica napus [oilseed rape]
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  76.3    2e-13   Populus euphratica
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g           76.6    3e-13   
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                          76.3    3e-13   
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     76.6    3e-13   Nicotiana sylvestris
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g           76.6    3e-13   
gb|KJB57730.1|  hypothetical protein B456_009G178100                  76.6    3e-13   Gossypium raimondii
ref|XP_007045633.1|  MATE efflux family protein isoform 1             76.6    3e-13   
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12          76.6    3e-13   Solanum lycopersicum
emb|CDX94061.1|  BnaC07g36950D                                        76.3    3e-13   
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                          76.3    4e-13   Glycine soja [wild soybean]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12          76.3    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     76.3    4e-13   Glycine max [soybeans]
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                          75.9    4e-13   Triticum urartu
gb|KJB30572.1|  hypothetical protein B456_005G149900                  75.5    4e-13   Gossypium raimondii
ref|XP_002867813.1|  mate efflux family protein                       76.3    4e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_002518492.1|  multidrug resistance pump, putative              76.3    4e-13   Ricinus communis
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g           75.9    5e-13   
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     76.3    5e-13   Elaeis guineensis
emb|CDM86680.1|  unnamed protein product                              75.5    5e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g           75.9    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.9    5e-13   Brassica rapa
emb|CDX98711.1|  BnaA03g44960D                                        75.9    5e-13   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.9    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  75.9    6e-13   Vitis vinifera
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.5    6e-13   Setaria italica
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.5    7e-13   Fragaria vesca subsp. vesca
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg           75.5    7e-13   Citrus clementina [clementine]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                          75.5    7e-13   Triticum urartu
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                          75.1    7e-13   Triticum urartu
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.5    7e-13   Elaeis guineensis
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                          74.7    8e-13   
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.5    8e-13   Pyrus x bretschneideri [bai li]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                          75.5    8e-13   Glycine soja [wild soybean]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.5    8e-13   Glycine max [soybeans]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12          75.1    9e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  75.1    9e-13   Populus euphratica
ref|NP_564787.1|  MATE efflux family protein                          75.1    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12          75.1    1e-12   Vitis vinifera
gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                72.0    1e-12   Citrus sinensis [apfelsine]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.1    1e-12   Sesamum indicum [beniseed]
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  75.1    1e-12   
ref|XP_002886501.1|  mate efflux family protein                       75.1    1e-12   
dbj|BAF47751.1|  multi antimicrobial extrusion family protein         75.1    1e-12   Nicotiana tabacum [American tobacco]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg              75.1    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.7    1e-12   Cucumis melo [Oriental melon]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12          74.7    1e-12   Vitis vinifera
ref|NP_001148084.1|  transparent testa 12 protein                     74.7    1e-12   Zea mays [maize]
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.7    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACZ55931.1|  MATE transporter 2                                    74.7    1e-12   Zea mays [maize]
gb|ACF85423.1|  unknown                                               74.7    1e-12   Zea mays [maize]
gb|ACZ55932.1|  MATE transporter 2                                    74.7    1e-12   Zea mays [maize]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                          74.7    1e-12   Glycine soja [wild soybean]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.7    1e-12   Brassica rapa
emb|CDY47166.1|  BnaA01g22920D                                        74.7    1e-12   Brassica napus [oilseed rape]
ref|NP_567640.1|  MATE efflux family protein                          74.7    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62936.1|  unknown                                               74.7    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g           74.7    2e-12   Phaseolus vulgaris [French bean]
gb|AAK82541.1|  At1g61890/F8K4_9                                      74.7    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg           74.7    2e-12   Eutrema salsugineum [saltwater cress]
gb|KJB57729.1|  hypothetical protein B456_009G178100                  73.6    2e-12   Gossypium raimondii
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.3    2e-12   Solanum lycopersicum
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein            74.3    2e-12   Gossypium arboreum [tree cotton]
emb|CDP11780.1|  unnamed protein product                              74.3    2e-12   Coffea canephora [robusta coffee]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.3    2e-12   
dbj|BAH19969.1|  AT4G21910                                            74.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                          74.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     74.3    2e-12   Brachypodium distachyon [annual false brome]
dbj|BAH20308.1|  AT1G61890                                            72.4    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like  71.2    2e-12   
emb|CDY25329.1|  BnaC01g29980D                                        74.3    2e-12   Brassica napus [oilseed rape]
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g           74.3    2e-12   Phaseolus vulgaris [French bean]
emb|CBI28940.3|  unnamed protein product                              69.7    2e-12   Vitis vinifera
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg           73.9    2e-12   Capsella rubella
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.9    2e-12   Eucalyptus grandis [rose gum]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.9    2e-12   Brassica rapa
emb|CDY12916.1|  BnaA09g13580D                                        73.9    2e-12   Brassica napus [oilseed rape]
emb|CDY19507.1|  BnaC09g13960D                                        73.9    2e-12   Brassica napus [oilseed rape]
gb|AHI48506.1|  multidrug and toxic extrusion transporter             73.9    2e-12   Vaccinium corymbosum [American blueberry]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  73.9    2e-12   Nicotiana tomentosiformis
emb|CDP22168.1|  unnamed protein product                              68.6    2e-12   Coffea canephora [robusta coffee]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.9    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720        73.9    2e-12   Sorghum bicolor [broomcorn]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.9    2e-12   Camelina sativa [gold-of-pleasure]
ref|NP_188806.1|  MATE efflux family protein                          73.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596992.1|  Transparent testa 12 protein                     73.9    3e-12   Medicago truncatula
ref|XP_002883313.1|  mate efflux family protein                       73.9    3e-12   
emb|CDY34833.1|  BnaA09g47590D                                        73.6    3e-12   Brassica napus [oilseed rape]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12          73.6    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.9    3e-12   Elaeis guineensis
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12          73.6    3e-12   Brassica rapa
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  73.6    3e-12   Nicotiana sylvestris
emb|CBI28937.3|  unnamed protein product                              73.9    3e-12   Vitis vinifera
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.6    3e-12   Pyrus x bretschneideri [bai li]
gb|AAM20595.1|  integral membrane protein, putative                   73.6    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    3e-12   Malus domestica [apple tree]
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    3e-12   Nicotiana tomentosiformis
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    4e-12   Cucumis melo [Oriental melon]
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.9    4e-12   Fragaria vesca subsp. vesca
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.6    4e-12   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.6    4e-12   
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    4e-12   Nicotiana sylvestris
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12          73.6    4e-12   Solanum lycopersicum
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.6    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    4e-12   Setaria italica
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                  73.2    4e-12   Arabis alpina [alpine rockcress]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.2    4e-12   Nicotiana tomentosiformis
emb|CDP04390.1|  unnamed protein product                              72.8    4e-12   Coffea canephora [robusta coffee]
gb|ACL53378.1|  unknown                                               72.8    5e-12   Zea mays [maize]
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.2    5e-12   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.2    5e-12   
gb|AFW68307.1|  putative MATE efflux family protein                   72.4    5e-12   
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.8    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  72.8    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg           72.8    6e-12   Eutrema salsugineum [saltwater cress]
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12          72.8    6e-12   Tarenaya hassleriana [spider flower]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.8    6e-12   Setaria italica
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                          72.0    7e-12   
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  72.8    7e-12   Cicer arietinum [garbanzo]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    7e-12   Populus euphratica
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12          72.4    7e-12   
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  72.4    8e-12   Populus euphratica
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    8e-12   Cucumis sativus [cucumbers]
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    8e-12   Populus euphratica
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    9e-12   Solanum tuberosum [potatoes]
emb|CDY27431.1|  BnaC03g64710D                                        72.4    9e-12   Brassica napus [oilseed rape]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  72.0    1e-11   Brassica rapa
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100        72.0    1e-11   Sorghum bicolor [broomcorn]
ref|NP_001147791.1|  transparent testa 12 protein                     72.0    1e-11   Zea mays [maize]
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g           72.0    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg           72.0    1e-11   Capsella rubella
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    1e-11   Populus euphratica
ref|XP_007026057.1|  MATE efflux family protein                       72.0    1e-11   
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    1e-11   Sesamum indicum [beniseed]
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  72.0    1e-11   
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...  68.9    1e-11   Nicotiana alata [flowering tobacco]
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg           72.0    1e-11   Capsella rubella
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  72.0    1e-11   Cicer arietinum [garbanzo]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12          71.6    1e-11   Vitis vinifera
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.0    1e-11   Elaeis guineensis
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg           71.6    1e-11   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12          71.6    1e-11   
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     71.6    1e-11   Prunus mume [ume]
emb|CBI28938.3|  unnamed protein product                              71.2    1e-11   Vitis vinifera
emb|CAN73203.1|  hypothetical protein VITISV_008169                   69.7    2e-11   Vitis vinifera
ref|XP_006389638.1|  MATE efflux family protein                       71.6    2e-11   
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g           68.9    2e-11   
ref|NP_001050524.1|  Os03g0572900                                     71.6    2e-11   
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g           71.6    2e-11   Populus trichocarpa [western balsam poplar]
emb|CDX94063.1|  BnaC07g36970D                                        71.6    2e-11   
gb|EEC75610.1|  hypothetical protein OsI_12322                        71.6    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg           71.2    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_003605914.1|  Transparent testa 12 protein                     71.2    2e-11   Medicago truncatula
gb|EEC82143.1|  hypothetical protein OsI_26198                        71.2    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12          71.2    2e-11   Vitis vinifera
emb|CDX98712.1|  BnaA03g44970D                                        71.2    2e-11   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...  71.2    2e-11   Zea mays [maize]
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...  71.2    2e-11   
ref|NP_001059785.1|  Os07g0516600                                     71.2    2e-11   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     71.2    2e-11   
emb|CDY07257.1|  BnaC04g19140D                                        70.1    2e-11   
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.9    2e-11   Nicotiana tomentosiformis
emb|CDY34637.1|  BnaC08g41960D                                        70.9    2e-11   Brassica napus [oilseed rape]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     71.2    2e-11   
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.9    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg           70.9    3e-11   Eutrema salsugineum [saltwater cress]
emb|CBI23251.3|  unnamed protein product                              70.5    3e-11   Vitis vinifera
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.9    3e-11   Nicotiana tomentosiformis
emb|CDP11781.1|  unnamed protein product                              70.5    3e-11   Coffea canephora [robusta coffee]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    3e-11   Zea mays [maize]
emb|CBI23253.3|  unnamed protein product                              68.2    3e-11   Vitis vinifera
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    4e-11   Prunus mume [ume]
ref|NP_001149176.1|  transparent testa 12 protein                     70.5    4e-11   Zea mays [maize]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    4e-11   
gb|AGT17223.1|  MATE efflux family protein                            70.5    4e-11   Saccharum hybrid cultivar R570
tpg|DAA50100.1|  TPA: putative MATE efflux family protein             70.5    4e-11   
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  70.1    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    4e-11   Vitis vinifera
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1    70.1    4e-11   Zea mays [maize]
emb|CBI23254.3|  unnamed protein product                              70.1    4e-11   Vitis vinifera
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.5    4e-11   Populus euphratica
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.4    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    5e-11   Solanum tuberosum [potatoes]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     70.1    5e-11   Nicotiana sylvestris
gb|KEH36840.1|  MATE efflux family protein                            70.1    5e-11   Medicago truncatula
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  69.7    6e-11   
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg           69.7    6e-11   Capsella rubella
emb|CDP17486.1|  unnamed protein product                              69.7    7e-11   Coffea canephora [robusta coffee]
gb|EEE67272.1|  hypothetical protein OsJ_24453                        69.3    7e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ACF85024.1|  unknown                                               67.0    7e-11   Zea mays [maize]
emb|CAN82750.1|  hypothetical protein VITISV_014577                   68.9    8e-11   Vitis vinifera
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     69.7    8e-11   Brassica rapa
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     69.3    8e-11   Brassica rapa
ref|NP_001142368.1|  uncharacterized protein LOC100274540             69.3    9e-11   Zea mays [maize]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     69.3    9e-11   Prunus mume [ume]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  69.3    9e-11   Populus euphratica
dbj|BAJ34540.1|  unnamed protein product                              69.3    9e-11   Eutrema halophilum
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                   68.9    1e-10   Eucalyptus grandis [rose gum]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g           69.3    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     69.3    1e-10   Fragaria vesca subsp. vesca
gb|KGN64598.1|  hypothetical protein Csa_1G071120                     68.9    1e-10   Cucumis sativus [cucumbers]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg           68.9    1e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    1e-10   
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    1e-10   Populus euphratica
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.9    1e-10   Brassica rapa
emb|CDY64933.1|  BnaCnng45550D                                        68.9    1e-10   Brassica napus [oilseed rape]
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.9    1e-10   Brassica rapa
dbj|BAD95082.1|  hypothetical protein                                 66.6    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79109.1|  BnaA01g11760D                                        68.9    1e-10   
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                  68.9    1e-10   Arabis alpina [alpine rockcress]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    2e-10   Brassica rapa
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    2e-10   Prunus mume [ume]
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410        68.2    2e-10   
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    2e-10   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.6    2e-10   
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    2e-10   Zea mays [maize]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg           68.2    2e-10   Prunus persica
emb|CDX98713.1|  BnaA03g44980D                                        68.2    2e-10   
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    2e-10   Prunus mume [ume]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.8    2e-10   
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  68.2    2e-10   Elaeis guineensis
gb|ACF80989.1|  unknown                                               62.8    3e-10   Zea mays [maize]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     68.2    3e-10   Eucalyptus grandis [rose gum]
ref|XP_002518493.1|  multidrug resistance pump, putative              67.8    3e-10   Ricinus communis
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.8    3e-10   Cucumis sativus [cucumbers]
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.4    4e-10   Solanum tuberosum [potatoes]
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.4    4e-10   Tarenaya hassleriana [spider flower]
ref|NP_001119025.1|  mate efflux domain-containing protein            67.4    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                  67.4    4e-10   Arabis alpina [alpine rockcress]
gb|ABF97209.1|  MATE efflux family protein, expressed                 67.4    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg           67.4    5e-10   Citrus clementina [clementine]
gb|EEC75606.1|  hypothetical protein OsI_12318                        67.4    5e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.0    5e-10   Solanum lycopersicum
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.0    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.0    5e-10   Solanum tuberosum [potatoes]
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.0    5e-10   Pyrus x bretschneideri [bai li]
emb|CDY39493.1|  BnaA01g24950D                                        67.0    5e-10   Brassica napus [oilseed rape]
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.0    6e-10   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.0    6e-10   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.0    6e-10   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                       67.4    6e-10   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                          66.6    6e-10   
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg           66.6    6e-10   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                  67.0    6e-10   
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     67.0    6e-10   
emb|CDY38631.1|  BnaA05g19560D                                        67.0    6e-10   
ref|XP_002518495.1|  multidrug resistance pump, putative              66.6    8e-10   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  66.6    8e-10   
gb|KGN43526.1|  hypothetical protein Csa_7G043680                     66.2    9e-10   
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                 65.9    9e-10   
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg           65.9    9e-10   
emb|CDY65669.1|  BnaCnng48120D                                        66.2    1e-09   
ref|XP_002892653.1|  mate efflux family protein                       65.9    1e-09   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.9    1e-09   
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                 65.9    1e-09   
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  65.9    1e-09   
emb|CDY33129.1|  BnaCnng07000D                                        65.9    1e-09   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.5    2e-09   
emb|CDY33131.1|  BnaCnng07020D                                        63.2    2e-09   
emb|CDY39494.1|  BnaA01g24940D                                        65.5    2e-09   
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg           65.5    2e-09   
gb|AGT17221.1|  transparent testa 12 protein                          65.1    2e-09   
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.7    3e-09   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.7    3e-09   
emb|CDM85992.1|  unnamed protein product                              64.7    3e-09   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg           64.7    4e-09   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  64.7    4e-09   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.7    4e-09   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.3    4e-09   
ref|NP_172632.1|  MATE efflux family protein                          64.3    4e-09   
emb|CDY71092.1|  BnaAnng36070D                                        61.2    4e-09   
ref|XP_002867814.1|  mate efflux family protein                       64.3    5e-09   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg           63.9    5e-09   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.9    5e-09   
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg              63.9    6e-09   
emb|CDY19294.1|  BnaC01g31860D                                        63.5    8e-09   
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.2    9e-09   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.5    9e-09   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.2    1e-08   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  63.2    1e-08   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.2    1e-08   
emb|CDY24252.1|  BnaC03g42250D                                        60.8    1e-08   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    1e-08   
emb|CDX92916.1|  BnaA03g36380D                                        63.2    1e-08   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg           62.8    1e-08   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  62.8    1e-08   
gb|EEC68782.1|  hypothetical protein OsI_37323                        60.1    1e-08   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    2e-08   
gb|ADE77677.1|  unknown                                               61.6    3e-08   
gb|AAM98160.1|  unknown protein                                       61.6    3e-08   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    4e-08   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  60.8    6e-08   
ref|NP_001176767.1|  Os12g0125500                                     57.4    6e-08   
gb|EEE51571.1|  hypothetical protein OsJ_32800                        60.1    7e-08   
ref|NP_001176328.1|  Os11g0128900                                     60.1    8e-08   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                  60.5    9e-08   
gb|KGN43522.1|  Mate efflux family protein                            60.5    1e-07   
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.5    1e-07   
gb|ABA91295.1|  MATE efflux family protein, expressed                 59.7    1e-07   
ref|NP_001065641.2|  Os11g0129000                                     57.0    2e-07   
gb|EEC68785.1|  hypothetical protein OsI_37326                        59.3    2e-07   
ref|NP_001066047.1|  Os12g0126000                                     59.3    2e-07   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    2e-07   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    2e-07   
emb|CDP04391.1|  unnamed protein product                              59.3    2e-07   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    2e-07   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.9    2e-07   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                          59.3    2e-07   
dbj|BAJ90668.1|  predicted protein                                    58.2    4e-07   
gb|ABK24492.1|  unknown                                               58.2    5e-07   
gb|EAY90718.1|  hypothetical protein OsI_12316                        53.9    6e-07   
gb|AHI48503.1|  multidrug and toxic extrusion transporter             57.8    7e-07   
ref|NP_001176768.1|  Os12g0125800                                     56.6    8e-07   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    9e-07   
gb|EPS59093.1|  hypothetical protein M569_15717                       55.1    1e-06   
ref|XP_011468929.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    1e-06   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                          56.6    2e-06   
gb|EEC68781.1|  hypothetical protein OsI_37322                        56.2    2e-06   
emb|CDX94064.1|  BnaC07g36980D                                        55.8    2e-06   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                          55.8    3e-06   
gb|ABA26978.1|  TO22-3                                                52.4    3e-06   
emb|CAN60226.1|  hypothetical protein VITISV_039920                   55.8    3e-06   
emb|CDX83628.1|  BnaC07g23680D                                        55.1    4e-06   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.5    4e-06   
gb|EPS67796.1|  hypothetical protein M569_06975                       55.1    5e-06   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.7    5e-06   
ref|NP_001050521.1|  Os03g0571700                                     54.3    6e-06   
gb|ABF97208.1|  MATE efflux family protein, expressed                 54.3    6e-06   
gb|EEE59383.1|  hypothetical protein OsJ_11499                        54.3    7e-06   
ref|XP_006491465.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.7    7e-06   
gb|AFK46935.1|  unknown                                               54.7    7e-06   
gb|EEE51569.1|  hypothetical protein OsJ_32798                        54.3    8e-06   
ref|NP_001065623.1|  Os11g0126100                                     54.3    8e-06   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                          54.3    9e-06   
ref|XP_008458202.1|  PREDICTED: protein TRANSPARENT TESTA 12          54.3    9e-06   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120        54.3    1e-05   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                        54.3    1e-05   
ref|XP_011086620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    1e-05   
ref|NP_001141051.1|  putative MATE efflux family protein              53.9    1e-05   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    1e-05   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                     53.9    1e-05   
emb|CDP13215.1|  unnamed protein product                              53.9    1e-05   
ref|XP_004138494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    1e-05   
ref|XP_004168325.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    1e-05   
ref|XP_006438288.1|  hypothetical protein CICLE_v10031274mg           53.5    1e-05   
ref|XP_011087098.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    2e-05   
gb|KFK28220.1|  hypothetical protein AALP_AA8G488200                  50.8    2e-05   
ref|XP_004308359.1|  PREDICTED: protein TRANSPARENT TESTA 12          53.5    2e-05   
gb|EEC73528.1|  hypothetical protein OsI_07920                        53.5    2e-05   
ref|XP_006852295.1|  hypothetical protein AMTR_s00049p00187620        50.8    2e-05   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    2e-05   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                          53.1    2e-05   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                          53.1    2e-05   
gb|KHN34619.1|  Protein TRANSPARENT TESTA 12                          53.1    2e-05   
ref|XP_003554068.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    2e-05   
gb|KEH25522.1|  MATE efflux family protein                            53.1    2e-05   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.8    2e-05   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg              52.8    2e-05   
ref|XP_006445000.1|  hypothetical protein CICLE_v10018703mg           53.1    2e-05   
ref|XP_006852301.1|  hypothetical protein AMTR_s00049p00190450        51.2    3e-05   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.8    3e-05   
ref|XP_006483933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.8    3e-05   
ref|XP_006438289.1|  hypothetical protein CICLE_v10031274mg           52.8    3e-05   
dbj|BAJ90744.1|  predicted protein                                    52.4    3e-05   
emb|CBI31189.3|  unnamed protein product                              52.4    3e-05   
ref|NP_001190793.1|  MATE efflux family protein                       52.4    3e-05   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                        52.4    3e-05   
emb|CDY66203.1|  BnaA09g51730D                                        52.4    3e-05   
emb|CAN63841.1|  hypothetical protein VITISV_021179                   52.4    4e-05   
ref|XP_009111491.1|  PREDICTED: protein TRANSPARENT TESTA 12          52.4    4e-05   
gb|KDO86235.1|  hypothetical protein CISIN_1g015884mg                 52.0    4e-05   
ref|XP_010044581.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    4e-05   
ref|XP_010905904.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    4e-05   
ref|XP_009152044.1|  PREDICTED: protein TRANSPARENT TESTA 12          52.4    4e-05   
emb|CDY07225.1|  BnaCnng02400D                                        52.4    4e-05   
gb|AGT17222.1|  MATE efflux family protein                            52.4    4e-05   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760        52.4    4e-05   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    4e-05   
ref|XP_010044579.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    4e-05   
emb|CDY13643.1|  BnaA06g32800D                                        52.0    4e-05   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.0    5e-05   
gb|KCW86662.1|  hypothetical protein EUGRSUZ_B03290                   52.0    5e-05   
ref|XP_008240646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    5e-05   
emb|CDX83627.1|  BnaC07g23670D                                        52.0    5e-05   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg              52.0    5e-05   
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                  52.0    5e-05   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    6e-05   
ref|NP_567173.3|  MATE efflux family protein                          51.6    6e-05   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  51.6    6e-05   
ref|XP_002875033.1|  mate efflux family protein                       51.6    6e-05   
emb|CBI22674.3|  unnamed protein product                              48.5    6e-05   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg           51.6    6e-05   
gb|KCW86665.1|  hypothetical protein EUGRSUZ_B03293                   51.2    7e-05   
ref|XP_011023470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    7e-05   
ref|XP_010556554.1|  PREDICTED: protein TRANSPARENT TESTA 12          51.6    7e-05   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  51.2    8e-05   
ref|XP_010044578.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    8e-05   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    8e-05   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710        51.2    8e-05   
ref|XP_004492766.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    8e-05   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg           51.2    8e-05   
gb|AAO42212.1|  unknown protein                                       51.2    9e-05   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    1e-04   
ref|XP_003533603.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    1e-04   
ref|XP_002302594.2|  hypothetical protein POPTR_0002s16260g           50.8    1e-04   
ref|XP_007161913.1|  hypothetical protein PHAVU_001G108200g           50.8    1e-04   
ref|XP_006395543.1|  hypothetical protein EUTSA_v10005286mg           50.8    1e-04   
ref|XP_007161914.1|  hypothetical protein PHAVU_001G108200g           50.8    1e-04   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg              50.8    1e-04   
gb|AFW55870.1|  putative MATE efflux family protein                   50.8    1e-04   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    1e-04   
ref|XP_010044580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    1e-04   
gb|AES81000.2|  MATE efflux family protein                            50.4    1e-04   
gb|KCW86664.1|  hypothetical protein EUGRSUZ_B03292                   50.4    1e-04   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein            50.4    1e-04   
ref|XP_003624782.1|  Protein TRANSPARENT TESTA                        50.4    1e-04   
ref|XP_010661849.1|  PREDICTED: protein TRANSPARENT TESTA 12          50.4    1e-04   
gb|KFK32791.1|  hypothetical protein AALP_AA6G288700                  50.4    1e-04   
ref|XP_010111354.1|  Protein TRANSPARENT TESTA 12                     48.1    1e-04   
ref|XP_003624780.1|  Protein TRANSPARENT TESTA                        50.4    1e-04   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                          50.4    1e-04   
dbj|BAJ95959.1|  predicted protein                                    50.4    2e-04   
emb|CAN69304.1|  hypothetical protein VITISV_021604                   50.4    2e-04   
emb|CAN68575.1|  hypothetical protein VITISV_033685                   50.4    2e-04   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    2e-04   
ref|XP_004234431.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    2e-04   
gb|ACG27773.1|  transparent testa 12 protein                          50.4    2e-04   
ref|NP_001130797.1|  putative MATE efflux family protein              50.4    2e-04   
gb|ACF87410.1|  unknown                                               50.1    2e-04   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  50.4    2e-04   
gb|KJB31160.1|  hypothetical protein B456_005G179100                  50.1    2e-04   
ref|XP_006353901.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.1    2e-04   
ref|XP_009380883.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.1    2e-04   
ref|XP_010419571.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.1    2e-04   
ref|XP_007051759.1|  MATE efflux family protein                       50.1    2e-04   
gb|EYU20852.1|  hypothetical protein MIMGU_mgv1a005530mg              50.1    2e-04   
ref|XP_007153779.1|  hypothetical protein PHAVU_003G064300g           50.1    2e-04   
gb|AAN64140.1|  Putative ripening regulated protein                   49.7    2e-04   
ref|XP_010426921.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.1    2e-04   
ref|XP_004167812.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.9    2e-04   
ref|XP_002865386.1|  mate efflux family protein                       50.1    2e-04   
ref|XP_006856152.1|  hypothetical protein AMTR_s00059p00169820        50.1    2e-04   
emb|CDX78379.1|  BnaA03g02910D                                        50.1    2e-04   
gb|EEE58464.1|  hypothetical protein OsJ_09708                        50.1    2e-04   
ref|XP_004239125.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.1    2e-04   
emb|CAN78105.1|  hypothetical protein VITISV_014413                   48.5    2e-04   
ref|XP_008777525.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  48.5    2e-04   
ref|XP_009367805.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    2e-04   
ref|XP_006602812.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    2e-04   
ref|XP_010251087.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    2e-04   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    3e-04   
ref|XP_010671653.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    3e-04   
ref|XP_004957085.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    3e-04   
ref|XP_003624779.1|  Transparent testa 12 protein                     49.7    3e-04   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    3e-04   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12          49.7    3e-04   
emb|CDY68535.1|  BnaCnng59430D                                        48.5    3e-04   
ref|XP_008352684.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    3e-04   



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ I+LLWV  RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  466  KGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  514



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ I+LLWV  RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  465  KGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  513



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ +IL W+  RTDW KEVE AKKRLNQWD K++PLL
Sbjct  444  KGIWSGMLGGTCMQTLILFWITFRTDWNKEVEQAKKRLNQWDDKKQPLL  492



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ IILLWV IRTDW KEVE AK RL++W+ K++PLL
Sbjct  451  KGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ IILLWV IRTDW KEVE AK RL++W+ K++PLL
Sbjct  451  KGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ IILLWV IRTDW KEVE AK RL++W+ K++PLL
Sbjct  451  KGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTVMQ IILLWV  RTDW KEVE A KRL +W+ K+EPLL
Sbjct  455  KGIWLGMLGGTVMQTIILLWVTFRTDWTKEVEEAAKRLTKWEDKKEPLL  503



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GM+GGT++Q +ILLWV +RTDW KEVE AK RLN WD KR+P LP+
Sbjct  449  KGIWSGMLGGTLLQTMILLWVTLRTDWDKEVENAKNRLNTWDDKRQPPLPE  499



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ +ILLWV  RTDW KEVE AKKRLN+W+ K+EPLL
Sbjct  437  KGIWGGMIGGTFMQTLILLWVTFRTDWNKEVEEAKKRLNKWEDKKEPLL  485



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV   TDW KEVE AKKRL++W+ K+EPLL
Sbjct  469  KGIWSGMIGGTLMQTVILLWVTFTTDWNKEVETAKKRLDRWEDKKEPLL  517



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ IIL+WV  RTDW KEVE + KRLN+WD K+EPLL
Sbjct  457  KGIWLGMLGGTTMQTIILIWVTFRTDWNKEVEESAKRLNKWDDKKEPLL  505



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G+IGGT +Q  ILLWV IRTDW KEVE A+KRLN+WD K+EPLL
Sbjct  514  KGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWDEKKEPLL  562



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTVMQ +IL W+  RTDW KEVE A KRL++WDA +EP+L
Sbjct  447  KGIWLGMIGGTVMQTLILFWITFRTDWNKEVEEATKRLSKWDASKEPIL  495



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV  RTDW KEVE AKKRL++W+ KRE LL
Sbjct  472  KGIWSGMIGGTLMQTLILLWVTFRTDWNKEVETAKKRLDKWEDKRETLL  520



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTVMQ +ILLWV IRTDW KEVE A+KRL++W+  +EPLL
Sbjct  439  KGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  487



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G+IGGT +Q  ILLWV IRTDW KEVE A+KRLN+WD K++PLL
Sbjct  443  KGIWGGLIGGTALQTTILLWVTIRTDWTKEVEEAQKRLNKWDEKKQPLL  491



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GM+GGT+MQ +ILLWV IRTDW KEVE AKKRLN+WD K EPL
Sbjct  465  KGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWDVK-EPL  511



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ +ILLWV  RTDW KEVE A KRLN+W+ K++PLL
Sbjct  470  KGIWSGMIGGTFMQTLILLWVTFRTDWNKEVEQAIKRLNKWEGKKQPLL  518



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTVMQ ++L+WV  RTDW KEVE A+KR++ W+ K EPLL
Sbjct  456  KGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  504



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q IIL+WV +RTDW KEVE AK RL+ WD KR+PLL
Sbjct  449  KGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWDEKRQPLL  497



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G+IGGT +Q  ILLWV +RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  443  KGIWGGLIGGTALQTAILLWVTMRTDWTKEVEEAQKRLNKWDEKKEPLL  491



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ +IL W+  RTDW KEVE AKKRLNQW+ K++PLL
Sbjct  446  KGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLL  494



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ +IL W+  RTDW KEVE AKKRLNQW+ K++PLL
Sbjct  446  KGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLL  494



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR-EPLL  322
            KGIW GMIGGT+MQ +IL+WV  RTDW KEVE AKKRLN+WD K+ EPLL
Sbjct  471  KGIWGGMIGGTIMQTLILMWVTFRTDWNKEVEEAKKRLNKWDGKKEEPLL  520



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLP  319
            KGIW GMIGGTVMQ +ILLWV IRTDW KEVE A+KRL++W+  +EPLL 
Sbjct  347  KGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLLA  396



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPKP  313
            KGIW GM+GGT MQ +IL W+  RTDW KEVE A+KRLNQW+  ++PLL  P
Sbjct  448  KGIWTGMLGGTCMQTLILFWITFRTDWDKEVEEARKRLNQWEDNKQPLLLVP  499



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G+IGGT +Q  ILLWV IRTDW KEVE A+KRLN+WD K++PLL
Sbjct  445  KGIWGGLIGGTALQTAILLWVTIRTDWSKEVEEAQKRLNKWDEKKQPLL  493



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ  IL+WV +RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  444  KGIWGGMLGGTCMQTAILVWVTLRTDWKKEVEEAQKRLNKWDDKKEPLL  492



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ +IL+WV  RTDW KEV+ A KRLN+W+ K+EPLL
Sbjct  453  KGIWLGMLGGTTMQTVILMWVTFRTDWNKEVQEADKRLNKWEDKKEPLL  501



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLP  319
            KGIW GM+GGT MQ +IL W+  RTDW KEVE AKKRLNQW+ K++PLL 
Sbjct  347  KGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLLA  396



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV   TDW KEVE+A++RL++W+ K++PLL
Sbjct  468  KGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLL  516



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q +ILLWV  RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  450  KGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  498



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GM+GGT+MQ +ILLWV IRTDW KEVE A KRLN+WD K EPL
Sbjct  465  KGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEANKRLNKWDVK-EPL  511



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGTVMQ IILLWV  RTDW+KEVE AK RL++WD  ++ L
Sbjct  456  KGIWSGMIGGTVMQTIILLWVTFRTDWIKEVEKAKMRLDKWDDDKQTL  503



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KG+W GMIGGT MQ  ILLWV IRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  442  KGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KG+W GMIGGT MQ  ILLWV IRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  439  KGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  488



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  453  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV   TDW KEVE+A++RL++W+ K++PL 
Sbjct  468  KGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  516



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  453  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  453  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q +ILLWV  RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  355  KGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  403



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q +ILLWV  RTDW  EVEVAK RL+ WD KR+PLL
Sbjct  451  KGIWSGMLGGTVLQTLILLWVTWRTDWNTEVEVAKNRLSSWDDKRQPLL  499



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G+IGGT +Q  ILLWV IRTDW KEVE A+KRLN+W  K+EPLL
Sbjct  347  KGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWSEKKEPLL  395



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGTVMQ +ILLWV  RTDW KEVE AKKRL++W+  + PL
Sbjct  450  KGIWTGMIGGTVMQTVILLWVTFRTDWNKEVECAKKRLDKWENLKGPL  497



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT++Q IILLWV  RTDW KEVE A  RLN WD  ++PLL
Sbjct  436  KGIWSGMIGGTLIQTIILLWVTFRTDWNKEVEKATNRLNTWDNIKQPLL  484



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV   TDW KEVE+A++RL++W+ K++PL 
Sbjct  449  KGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  497



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ +IL+WV  RTDW KEVE A+KRL  W+ K+EPLL
Sbjct  455  KGIWSGMIGGTAMQTLILVWVTFRTDWKKEVEEARKRLVTWEDKKEPLL  503



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTVMQ +IL+W+ IRTDW KEVE A+ RLN+W  K+EP L
Sbjct  453  KGIWLGMMGGTVMQTVILIWITIRTDWNKEVEAAQGRLNKWGDKKEPEL  501



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILL+V  RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q IIL+WV  RTDW  EVE A KRLN+W+ K EPL+
Sbjct  468  KGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV  RT+W KEVE A KRLN+W+ K EPLL
Sbjct  462  KGIWSGMIGGTMMQTLILLWVTYRTNWNKEVEEATKRLNKWEDKPEPLL  510



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q IIL+WV  RTDW  EVE A KRLN+W+ K EPL+
Sbjct  468  KGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G+IGGT +Q  ILLWV IRT+W +EVE A+KRLN+WD K+EPLL
Sbjct  382  KGIWGGLIGGTALQTTILLWVTIRTNWTEEVEEAQKRLNKWDEKKEPLL  430



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTVMQ ++L+WV  RTDW KEVE A+KR++ W+ K EPLL
Sbjct  347  KGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  395



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  458  KGIWTGMIGGTFMQTLILLYVTYRTDWDKEVETARKRLDMWDDKKEPL  505



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT +Q +IL+WV  RTDW KEVE A++RLN W+ K+EPLL
Sbjct  447  KGIWSGMIGGTFLQTLILIWVTYRTDWNKEVEKARQRLNSWEDKKEPLL  495



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT++Q +ILLWV +RTDW KEVE AK RLN WD KR+P L
Sbjct  449  KGIWSGMLGGTLLQTMILLWVTLRTDWNKEVENAKNRLNTWDDKRQPPL  497



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +IL+WV  RTDW KEV  A KRLN+W+ K++PLL
Sbjct  471  KGIWSGMIGGTLMQTLILIWVTFRTDWNKEVNEAIKRLNKWEDKKKPLL  519



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLLPKP*KRS  301
            KGIW GMIGGT MQ  ILLWV IRTDW KEVE A KRLN+W D K++PLL      S
Sbjct  347  KGIWSGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLLTAATDNS  403



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q IIL+WV +RTDW KEVE AK RL+ WD K +PLL
Sbjct  449  KGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWDEKGQPLL  497



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILL+V  RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILL+V  RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREP  328
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE AKKRL+ WD K+EP
Sbjct  459  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ  IL+WV  RT+W KEVE AK+RL +WD K++PLL
Sbjct  457  KGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERLEKWDDKKQPLL  505



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GMIGGTVMQ  ILLWV +RTDW KEVE A+KRLN+W D K EPLL
Sbjct  443  KGIWGGMIGGTVMQTAILLWVTLRTDWSKEVEEAQKRLNKWEDKKTEPLL  492



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT +Q +ILLWV  RTDW KEVE  K RL++WD K+EPLL
Sbjct  456  QGIWSGMIGGTFIQTLILLWVTFRTDWKKEVENVKNRLDRWDDKKEPLL  504



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTVMQ +IL+WV  RTDW KEV+ A KRL++W+ K++PLL
Sbjct  471  KGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  519



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KG+W GMIGGT +Q  ILLWV IRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  442  KGLWGGMIGGTAIQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLLPKP*KRS  301
            KGIW GMIGGT MQ  ILLWV IRTDW KEVE A KRLN+W D K++PLL      S
Sbjct  347  KGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLLTAATDNS  403



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ +IL+WV  RTDW KEV+ A KRLN+W+ K++PLL
Sbjct  470  KGIWSGMIGGTFMQTLILIWVTFRTDWNKEVDEAIKRLNKWEDKKQPLL  518



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLLPKP*KRS  301
            KGIW GMIGGT MQ  ILLWV IRTDW KEVE A KRLN+W D K++PLL      S
Sbjct  347  KGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLLTAATDNS  403



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT+MQ +ILLWV  RTDW KEVE AK R+ +WD K++PLL
Sbjct  458  EGIWSGMIGGTLMQTLILLWVTFRTDWDKEVENAKSRVEKWDDKKQPLL  506



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREP  328
            +GIW GMIGGT++Q +ILLW+ +RTDW KEV  AKKRLN+W  K+EP
Sbjct  454  QGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  500



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREP  328
            +GIW GMIGGT++Q +ILLW+ +RTDW KEV  AKKRLN+W  K+EP
Sbjct  455  QGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  501



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTV+Q +ILLWV  RTDW KEVE A  RL++W+A +EPLL
Sbjct  459  KGIWGGMIGGTVIQTVILLWVTFRTDWQKEVEKAASRLDKWEAVKEPLL  507



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT++Q +ILLWV  RTDW KEVE AK RL++W+ KR+P L
Sbjct  465  KGIWSGMIGGTLLQTLILLWVTFRTDWRKEVEKAKSRLHKWEDKRKPSL  513



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V +RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ  IL+WV  RT+W KEVE AK+R+ +WD K++PLL
Sbjct  457  KGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  505



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTVMQ +IL+WV  RTDW KEV+ A KRL++W+ K++PLL
Sbjct  119  KGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  167



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV  RTDW KEVE A+KRL++W+   EPLL
Sbjct  459  KGIWSGMIGGTMMQTLILLWVTFRTDWNKEVEKARKRLDKWEEITEPLL  507



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGM-IGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM IGGT+MQ +ILLWV  RTDW KEVE A+ RL++WD K++PLL
Sbjct  462  KGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKWDDKKQPLL  511



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V +RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGTVMQ +ILLWV  RTDW K+VE AKKRL++W+  + PL
Sbjct  450  KGIWTGMIGGTVMQTVILLWVTFRTDWNKKVECAKKRLDKWENLKGPL  497



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ +ILLWV  RTDW KEVE A KRL  WD  +EPLL
Sbjct  466  KGIWTGMIGGTAMQTLILLWVTFRTDWNKEVEKAGKRLAMWDDIKEPLL  514



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ IIL+WV  RTDW KEVE + KRLN+WD K+E  L
Sbjct  446  KGIWLGMMGGTCMQTIILIWVTFRTDWNKEVEESMKRLNKWDVKQESTL  494



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ +IL+WV  RT+W KEVE A++RL +WD K++PLL
Sbjct  457  KGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  505



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+WD  + PLL
Sbjct  460  GIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIWCG+I GTV Q +ILL V  RTDW KEVE AKKRL++W+ K EPLL
Sbjct  475  KGIWCGLIAGTVNQTLILLVVTFRTDWNKEVEEAKKRLDKWEEKEEPLL  523



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+WD  + PLL
Sbjct  460  GIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+WD  + PLL
Sbjct  462  GIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+WD  + PLL
Sbjct  462  GIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q IIL+WV   TDW KEVE A KRLN+W+ K EPL+
Sbjct  467  KGIWLGMLGGTVLQTIILVWVTFGTDWNKEVEEAAKRLNKWEDKTEPLV  515



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V +RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V +RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  505



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  505



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ +IL+WV  RTDW KEVE A KRL+ W+ K+EP+L
Sbjct  458  KGIWLGMLGGTAMQTVILIWVTFRTDWNKEVEEAAKRLSIWEDKKEPVL  506



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ I+L+ V +RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIVLVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV   TDW KEVE+A++RL++W+ K++PL 
Sbjct  307  KGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  355



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGTVMQ  IL+W   RTDW KEVE AK+RL++W+  +EPL  K
Sbjct  449  KGIWTGMIGGTVMQTFILIWFTFRTDWNKEVEKAKERLDKWENVKEPLSKK  499



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR-EPLL  322
            KGIW GMIGGTVMQ ++L+WV  RTDW KEVE A+KR++ W  K+ EPLL
Sbjct  456  KGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWQVKKEEPLL  505



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KG+W GM+GGT MQ IILLWV IRTDW KEVEVA KRL++W D K+E LL
Sbjct  450  KGLWSGMLGGTTMQTIILLWVTIRTDWNKEVEVALKRLDKWEDQKKEALL  499



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT MQ +IL+WV  RTDW KEV+ A KRLN+W+ +++PLL
Sbjct  440  KGIWSGMIGGTFMQTVILIWVTFRTDWNKEVDEAIKRLNKWEDEKQPLL  488



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  460  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+EPL
Sbjct  460  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  507



>ref|XP_010237714.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=496

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q IILLW+  RTDW KEVE A++RL++WD  ++PLL
Sbjct  444  KGLWGGMIGGTLIQTIILLWITFRTDWNKEVEEARRRLDKWDEAKQPLL  492



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V +RTDW KEVE A  RL+QW+  REPLL +
Sbjct  244  KGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  294



>ref|XP_008342112.1| PREDICTED: MATE efflux family protein ALF5-like [Malus domestica]
Length=179

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWD  343
            KGIW GM+GGT+MQ +ILLWV IRTDW KEVE AKKRLN+WD
Sbjct  136  KGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWD  177



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q +IL+WV  RTDW KEV  A++RLNQW+  +EPLL
Sbjct  467  KGIWLGMLGGTVLQTLILMWVTFRTDWNKEVVEAERRLNQWEDVKEPLL  515



>emb|CBI28940.3| unnamed protein product [Vitis vinifera]
Length=100

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ  IL+WV  RT+W KEVE AK+RL +WD K++PLL
Sbjct  50   KGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERLEKWDDKKQPLL  98



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREP  328
            KGIW GMIGG++MQ +ILL+V  RTDW KEVE AKKRL+ WD K+EP
Sbjct  455  KGIWTGMIGGSLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDEKKEP  501



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ +IL+WV  RTDW KEVE AK RL++W+ K++PLL
Sbjct  462  KGIWSGMLGGTTMQTLILIWVTYRTDWNKEVEKAKGRLDKWEDKKKPLL  510



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEVE A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTV+Q  IL+W   +TDW+KEVE AKKRL++WD   +PLL
Sbjct  473  KGIWSGMIGGTVLQTAILIWTTYQTDWIKEVEKAKKRLDKWDDINQPLL  521



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGTVMQ IILLW   RTDW KEVE A+ RL++W+  +EPL
Sbjct  453  KGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWENVKEPL  500



>emb|CDP22168.1| unnamed protein product, partial [Coffea canephora]
Length=51

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLLP  319
            G+W GM+GGTVMQ IILLWV +RT+W KEVE A KRL++W D K+E LL 
Sbjct  1    GLWSGMLGGTVMQTIILLWVTVRTNWTKEVEAALKRLDKWEDRKKEALLK  50



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLWV  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  478  EGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q +IL+W+ +RTDW KEVE A+KRL++WD  R+PLL
Sbjct  444  KGLWGGMIGGTLIQTLILIWITLRTDWNKEVEEARKRLDKWDDTRQPLL  492



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGTV+Q  IL WV  RTDW KEVE A KR+++W  K++ ++P+
Sbjct  456  KGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGTV+Q  IL WV  RTDW KEVE A KRL++W  K++ ++P+
Sbjct  456  KGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GM+GGT MQ IIL+WV  RTDW KEV+ A KRLN+W + K+EPLL
Sbjct  457  KGIWLGMLGGTTMQTIILMWVTFRTDWNKEVKEAAKRLNKWEEKKKEPLL  506



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGTV+Q  IL WV  RTDW KEVE A KRL++W  K++ ++P+
Sbjct  456  KGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IILL V IRTDW KEVE A +RL+QW+  + PLL +
Sbjct  409  KGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWEGSQAPLLKQ  459



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GMIGGT+MQ IILLWV  RTDW +EVE A KRLN+W+ K +
Sbjct  454  KGIWSGMIGGTLMQTIILLWVACRTDWKREVEEAAKRLNKWEDKHK  499



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT +Q +IL+WV  RTDW KEV  A KRLN+W+ K++PLL
Sbjct  470  KGIWSGMIGGTFIQTLILIWVTFRTDWNKEVYEATKRLNKWEDKKQPLL  518



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IILL V IRTDW KEVE A +RL+QW+  + PLL +
Sbjct  454  KGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWEDSQAPLLKQ  504



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGTVMQ IILLW   RTDW KEVE A+ RL++W   +EPL
Sbjct  454  KGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWGNVKEPL  501



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ +IL+WV  RT+W KEVE A++RL +WD K++PLL
Sbjct  493  KGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  541



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLWV  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  478  EGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGTV+Q  IL WV  RTDW KEVE A KRL++W  K++ ++P+
Sbjct  456  KGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT+MQ +ILLWV  RTDW KEV+ AK R+ +WD K +PLL
Sbjct  458  EGIWSGMIGGTLMQTLILLWVTFRTDWDKEVDNAKSRVEKWDDKEQPLL  506



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTVMQ IIL+W+  RTDW KEVE A+ RL +WD K+E +L
Sbjct  463  KGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWDDKKEAIL  511



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GMIGGT MQ +IL+WV  RTDW KEVE + KRLN+WD K+E
Sbjct  460  KGIWVGMIGGTFMQTVILIWVTYRTDWNKEVEESMKRLNKWDDKQE  505



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GM+ GT+MQ IILLW+ IRTDW KEVE A +RLN WD K EPL
Sbjct  138  KGIWLGMMAGTLMQTIILLWITIRTDWKKEVEEAARRLNNWDVK-EPL  184



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLW+  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  485  EGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  533



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLW+  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  488  EGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  536



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTVMQ IIL+W+  RTDW KEVE A+ RL +WD K+E +L
Sbjct  463  KGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWDDKKESIL  511



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTVMQ IIL+W+  RTDW KEVE A+ RL +WD K+E +L
Sbjct  462  KGIWSGMLGGTVMQTIILIWITARTDWNKEVEAAQSRLKKWDDKKESIL  510



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT +Q +IL+WV  RT+W KEVE A KRL  WD K+EPLL
Sbjct  463  KGIWSGMIGGTTVQTLILIWVTYRTNWNKEVEEAMKRLETWDEKKEPLL  511



>ref|XP_004957863.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=501

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q +IL+W+ +RTDW KEVE A+KRL++WD  R+PLL
Sbjct  449  KGLWGGMIGGTLIQTLILIWITLRTDWNKEVEEARKRLDKWDDTRQPLL  497



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V IRTDW KEV  A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTIRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGTVMQ IILLWV   TDW KEVE A+KRL++W+  + PL
Sbjct  450  KGIWTGMIGGTVMQTIILLWVTFSTDWNKEVESARKRLDKWENLKGPL  497



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +IL+W   RTDW KEVE A++RL  WD K+EPLL
Sbjct  384  KGIWSGMIGGTMMQTLILVWSTFRTDWNKEVEKARERLRTWDDKKEPLL  432



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGM-IGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM IGGT+MQ +ILLWV  RTDW KEVE A+ RL++WD K++PLL
Sbjct  412  KGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKWDDKKQPLL  461



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLW+  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  478  EGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLW+  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  481  EGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  529



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
             GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+WD  + PLL  
Sbjct  349  AGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLLSA  399



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+ Q  IL WV  RTDW KEVE A KR+++W  K++ ++P+
Sbjct  456  KGIWTGMIGGTITQTFILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>ref|XP_010448968.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010448969.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=508

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREP  328
            KGIW GMIGGT+MQ +ILL+V  RT W KEVE AKKRL+ WD K+EP
Sbjct  459  KGIWTGMIGGTLMQTLILLYVTYRTAWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMI GTVMQ +IL WV  RTDWVKEVE A KRL++W  K+  ++P+
Sbjct  465  KGIWTGMICGTVMQTVILAWVTFRTDWVKEVEEASKRLDKWSNKKLEVVPE  515



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMI GTVMQ IIL WV   TDW KEV++A KRL+QW  ++EPL
Sbjct  454  KGIWTGMICGTVMQTIILAWVTFSTDWNKEVDLATKRLDQWSDRKEPL  501



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            GIW GMIGGT+MQ +IL+WV  RT+WVKEVE A+KRLN+W+ K  PLL
Sbjct  464  GIWSGMIGGTLMQTLILIWVTFRTNWVKEVEEAQKRLNKWEEK-SPLL  510



>gb|EMT14886.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=400

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KG+W GMIGGT++Q IILLW+  RTDW KEVE A++RL++WD  ++PLL  
Sbjct  347  KGLWGGMIGGTLIQTIILLWITFRTDWNKEVEEARRRLDKWDDAKQPLLAN  397



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GG +MQ IILLWV  RTDW KEVE + KRLN+W+ + E L+
Sbjct  462  KGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWEDRTETLI  510



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT MQ ++LLW   RT+W KEVE A+ RL+ WDA  EPLL
Sbjct  466  KGIWTGMLGGTAMQTLVLLWATFRTNWGKEVEKAQGRLDTWDATNEPLL  514



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G++GGT+MQ IIL+ V +RTDW KEVE A +RL+QW+ K+EPLL
Sbjct  465  KGIWLGLLGGTLMQTIILIVVMVRTDWNKEVEKALERLDQWEDKKEPLL  513



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT++Q IIL WV  RTDW KEVE A  RLN WD  ++PLL
Sbjct  484  KGIWSGMIGGTLIQTIILSWVTFRTDWNKEVEKATNRLNIWDNIKQPLL  532



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GMIGGT MQ IIL+WV  RTDW KEVE A KRLN+W+ K++
Sbjct  460  KGIWLGMIGGTCMQTIILIWVTYRTDWNKEVEEATKRLNKWEDKQQ  505



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ I+LLW   RT+W KEVE A  RL+ W+  +EPLL
Sbjct  463  KGIWSGMLGGTIMQTIVLLWATFRTNWKKEVEKAHSRLDSWNDNKEPLL  511



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTVMQ IIL+W+  RTDW KEVE A+ RL  WD K+E +L
Sbjct  462  KGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQSRLKMWDDKKESIL  510



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE AKKRL+ WD K++
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE AKKRL+ WD K++
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR--EPLL  322
            KGIW GMIGGT MQ  ILLWV +RTDW KEVE A+KRL++W+ K+  EPLL
Sbjct  446  KGIWGGMIGGTCMQTAILLWVTLRTDWNKEVEEAQKRLHKWEDKKTTEPLL  496



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGM-IGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GM IGGT+ Q +ILLWV +RTDW KEVE AK RL++WD K++PLL
Sbjct  461  KGVWSGMVIGGTLTQTLILLWVTVRTDWNKEVENAKARLDKWDDKKQPLL  510



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEV  A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GM+GGTV+Q +ILL V  RTDW KEVE AK RL+ WD K EPLL K
Sbjct  451  KGIWSGMLGGTVLQTLILLGVTWRTDWNKEVEGAKNRLSTWDDKSEPLLQK  501



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEV  A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEV  A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT++Q ++LLW  IRT+W KEVE A+ R+++WD  +EPLL
Sbjct  463  KGIWTGMLGGTIVQTMVLLWATIRTNWGKEVEKAQSRVDRWDDNKEPLL  511



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q +IL++V  RTDW KEVE  + RL++W+ K+EPLL
Sbjct  463  KGIWSGMMGGTVIQTLILMYVTFRTDWTKEVEKTRNRLDRWEDKKEPLL  511



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GM+GGT +Q IIL+WV +RTDW KEVE+A+ RLN+W+ K+E
Sbjct  457  KGIWSGMLGGTALQTIILIWVTVRTDWNKEVEIARGRLNRWEDKKE  502



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V  RTDW KEV  A  RL+QW+  REPLL +
Sbjct  451  KGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWD  343
            KGIW GMIGGT+MQ IILLWV  RTDW KEVE AKKRL++W+
Sbjct  121  KGIWTGMIGGTMMQTIILLWVTFRTDWNKEVESAKKRLDKWE  162



>ref|XP_006282967.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
 gb|EOA15865.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
Length=505

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE AKKRL+ WD  +E
Sbjct  455  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVETAKKRLDMWDDVKE  500



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GG +MQ IILLWV  RTDW KEVE + KRLN+W+ + E L+
Sbjct  460  KGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWEDRTETLI  508



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GMIGGTVMQ +IL+W+  RTDW KEVE AK+RL++W D + +PLL
Sbjct  458  KGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  507



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT+MQ +ILLWV  RTDW KEV+ A KRL++W+ K++ LL
Sbjct  471  KGIWSGMIGGTLMQTVILLWVTFRTDWNKEVDQALKRLDKWEDKKQHLL  519



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  +TDW KEVE A+KRL+ WD K+E L
Sbjct  453  KGIWTGMIGGTLMQTLILLYVTYQTDWDKEVEKARKRLDMWDDKKESL  500



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+ GT+MQ +IL+W+  RTDW KEVE A KRL++W   +EP L
Sbjct  470  KGIWGGMLAGTIMQTLILMWITFRTDWNKEVEEAMKRLDEWQDNKEPFL  518



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GM+ GT+MQ IIL+WV  RTDW KEVE A KRLN+W   +EPL
Sbjct  470  KGIWLGMMAGTLMQTIILIWVTYRTDWKKEVEEAAKRLNKWGKVKEPL  517



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ  IL+WV  RT+W KEVE AK+R+ +WD K++PLL
Sbjct  384  KGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  432



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ  IL+WV  RT+W KEVE AK+R  +WD K++PLL
Sbjct  215  KGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERXEKWDDKKQPLL  263



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR  334
            KGIW GMIGGT++Q +ILLWV  RTDW KEVE AK RL++W+ KR
Sbjct  460  KGIWSGMIGGTLLQTLILLWVTFRTDWKKEVEKAKSRLHKWEDKR  504



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMI G V+Q +ILLWV IRTDW KEV+ A KRL  W+ K EPL+
Sbjct  145  KGIWSGMIAGIVLQTVILLWVTIRTDWNKEVQEALKRLETWEGKEEPLV  193



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GM+GGT MQ  IL+WV +RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  444  KGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT++Q I+LLW  IRT+W KEV  A+ RL++WD  +EPLL
Sbjct  463  KGIWTGMLGGTIVQTIVLLWATIRTNWGKEVGKAQSRLDKWDDNKEPLL  511



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+  L
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKNSL  505



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GM+GGT MQ  IL+WV +RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  444  KGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|XP_006413715.1| hypothetical protein EUTSA_v10024969mg [Eutrema salsugineum]
 gb|ESQ55168.1| hypothetical protein EUTSA_v10024969mg [Eutrema salsugineum]
Length=504

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+ RL+ WD K+E L
Sbjct  455  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARTRLDMWDEKKESL  502



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGTV+Q IIL+WV  RTDW  EV  + KRLN+W+ K E LL
Sbjct  469  KGIWLGMLGGTVLQTIILMWVTFRTDWNNEVVESNKRLNKWEGKTESLL  517



>gb|EEC82143.1| hypothetical protein OsI_26198 [Oryza sativa Indica Group]
Length=492

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q +IL+W+  RTDW KEVE A++RL++WD  ++PLL
Sbjct  440  KGLWGGMIGGTLIQTLILIWITFRTDWNKEVEDARRRLDKWDDTKQPLL  488



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWD  343
            KGIW GMIGGTVMQ +ILLWV  RTDW KEVE AK RL  WD
Sbjct  455  KGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWD  496



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A+KRL+ WD K+  L
Sbjct  458  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKNSL  505



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            +GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+W+  + P+
Sbjct  489  QGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  536



>ref|XP_008667480.1| PREDICTED: putative MATE efflux family protein isoform 1 isoform 
X1 [Zea mays]
Length=567

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q + L+W+ +RTDW KEVE A+KRL++WD  R+PL+
Sbjct  515  KGLWGGMIGGTLIQTLALIWITLRTDWNKEVEEARKRLDKWDDTRQPLV  563



>ref|NP_001059785.1| Os07g0516600 [Oryza sativa Japonica Group]
 dbj|BAF21699.1| Os07g0516600 [Oryza sativa Japonica Group]
 dbj|BAH00206.1| unnamed protein product [Oryza sativa Japonica Group]
Length=493

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q +IL+W+  RTDW KEVE A++RL++WD  ++PLL
Sbjct  441  KGLWGGMIGGTLIQTLILIWITFRTDWNKEVEDARRRLDKWDDTKQPLL  489



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            GIWCGMIGGT+MQ +IL+WV  RT+W KEVE A KRLN+W+ K  P+L
Sbjct  470  GIWCGMIGGTLMQTLILVWVTFRTNWNKEVEEALKRLNKWEDK-SPIL  516



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IIL+ V ++TDW KEVE +  RL+QW+  REPLL +
Sbjct  277  KGIWTGMIGGTLMQTIILVVVTLKTDWDKEVEKSSSRLDQWEESREPLLKQ  327



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GM+GGT+MQ +IL+WV  RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  438  KGIWSGMMGGTLMQTVILVWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  487



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGT+MQ IILL V IRTDW KEVE A +RL++W+  + PLL +
Sbjct  409  KGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDKWEDTQAPLLKQ  459



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGTV+Q  IL WV  RTDW KE E A KR+++W  K++ ++P+
Sbjct  467  KGIWTGMIGGTVIQTFILAWVTFRTDWTKEEEEASKRMDKWSNKKQEVVPE  517



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ  IL+WV  RTDW KEVE A +RL++W+  ++PLL
Sbjct  443  KGIWGGMLGGTLMQTFILIWVTFRTDWNKEVEQAMRRLDKWEDNKQPLL  491



>ref|XP_006413716.1| hypothetical protein EUTSA_v10027142mg [Eutrema salsugineum]
 gb|ESQ55169.1| hypothetical protein EUTSA_v10027142mg [Eutrema salsugineum]
Length=508

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT++Q +ILL+V  RTDW KEV+ A+KRL+ W+ K+EP+L
Sbjct  459  KGIWTGMIGGTLLQTLILLYVTYRTDWDKEVKKARKRLDIWEDKKEPVL  507



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTVMQ +ILLWV  RTDW KEVE AK RL  WD      L
Sbjct  382  KGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWDTNNSASL  430



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GM+GGT+MQ +IL+WV  RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  463  KGIWSGMMGGTLMQTVILVWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  512



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KG+W GM+GGT+MQ IILLWV IRTDW+KEVE A +RL++W+  ++
Sbjct  382  KGLWSGMLGGTIMQTIILLWVTIRTDWIKEVEAALRRLDKWEVLKD  427



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 4/53 (8%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR----EPLL  322
            KGIW GMIGGT MQ  ILLW  +RTDW KEVE A+KRL++W+ ++    EPLL
Sbjct  438  KGIWSGMIGGTFMQTAILLWATLRTDWNKEVEEAQKRLHKWEDQKTTTTEPLL  490



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GMIGGTVMQ +IL+WV  RTDW KEV  AK+RL++W D + EPLL
Sbjct  170  KGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  219



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREP  328
            +GIW GMIGGT MQ IILLWV  RTDW KEVE A  RL +W+ K+ P
Sbjct  461  EGIWSGMIGGTFMQTIILLWVTFRTDWNKEVETAGNRLKKWEDKKLP  507



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+W+  + P+
Sbjct  466  GIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWD  343
            KGIW GM+ GT+MQ +ILLWV IRTDW KEVE AKKRLN+WD
Sbjct  463  KGIWLGMVWGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWD  504



>gb|AGT17223.1| MATE efflux family protein [Saccharum hybrid cultivar R570]
Length=516

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPKP  313
            KGIW GM+GGT MQ +IL W+  RT+W KEVE  +KRLNQ +  ++PLL  P
Sbjct  463  KGIWTGMLGGTCMQTLILFWITFRTNWNKEVEEVRKRLNQCEDNKQPLLLVP  514



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+W+  + P+
Sbjct  466  GIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLWV  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  405  EGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  453



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GMIGGTVMQ +IL+WV  RTDW KEV  AK+RL++W D + EPLL
Sbjct  457  KGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  506



>ref|NP_001140602.1| putative MATE efflux family protein isoform 1 [Zea mays]
 gb|ACF84156.1| unknown [Zea mays]
 tpg|DAA40991.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA40992.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=497

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q + L+W+ +RTDW KEVE A+KRL++WD  R+PL+
Sbjct  445  KGLWGGMIGGTLIQTLALIWITLRTDWNKEVEEARKRLDKWDDTRQPLV  493



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GMIGGTVMQ +IL+W+  RTDW KEVE AK+RL++W D + +PLL
Sbjct  384  KGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  433



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT+MQ I+LLWV  RT+W KEVE A+ RL  W+   EPLL
Sbjct  463  KGIWTGMLGGTIMQTIVLLWVTFRTNWEKEVEKAQNRLVTWNDINEPLL  511



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTV+Q  IL WV  RTDW KEVE A KR+++W  K++ L+
Sbjct  138  KGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWSDKKQELV  186



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMIGGTV+Q  IL WV  RTDW KE E A KR+++W  +++ ++P+
Sbjct  456  KGIWTGMIGGTVIQTFILAWVTFRTDWSKEAEEASKRMDKWSNQKQEVVPE  506



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GM+GGT MQ IILLWV  RTDW KEVE AK RLN W +  ++PL 
Sbjct  449  KGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMWQNNSKKPLF  498



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GM+GGT MQ IILLWV  RT+W +EVE AK RLN W D  ++PLL
Sbjct  458  KGIWLGMLGGTAMQTIILLWVTFRTNWEQEVEKAKSRLNMWQDQSKKPLL  507



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWD  343
            KGIW GMIGGTV+Q +ILLW+  RTDW+KEV  AKKRL++W+
Sbjct  453  KGIWSGMIGGTVLQTLILLWITFRTDWIKEVNTAKKRLDKWE  494



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            +GIW GMIGGT++Q +ILLW+  RTDW KEV+ AK R+ +WD K++PLL
Sbjct  412  EGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  460



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGTV+Q  IL WV  RTDW KEVE A KRL++W  K++ ++
Sbjct  457  KGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQDVV  505



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW G+I G  +Q +ILLW   RTDW KEVE+A+KRL  WD +++PLL
Sbjct  462  KGIWIGIISGVFLQTLILLWTTFRTDWNKEVEIAQKRLATWDDQKQPLL  510



>gb|EEE67272.1| hypothetical protein OsJ_24453 [Oryza sativa Japonica Group]
Length=424

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KG+W GMIGGT++Q +IL+W+  RTDW KEVE A++RL++WD  ++PLL
Sbjct  372  KGLWGGMIGGTLIQTLILIWITFRTDWNKEVEDARRRLDKWDDTKQPLL  420



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
             GIW GMIGGT+MQ +IL+WV  RT+W KEVE A+KRLN+W+  + P+
Sbjct  138  AGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  185



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQW-DAKREPLL  322
            KGIW GMIGGTVMQ +IL+WV  RTDW KEV  AK+RL++W D + EPLL
Sbjct  347  KGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDXEDEPLL  396



>ref|XP_009137221.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=508

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPL  325
            KGIW GMIGGT+MQ +ILL+V  +TDW KEVE A+KRL+ WD K+  L
Sbjct  459  KGIWTGMIGGTLMQTLILLYVTYQTDWDKEVEKARKRLDMWDDKKNSL  506



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR  334
            KGIW GMIGGT++Q +IL+WV +RTDW KEVE A KRL++W  K+
Sbjct  456  KGIWTGMIGGTLIQTVILVWVILRTDWTKEVEKASKRLDKWSNKK  500



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 2/52 (4%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR--EPLLP  319
            KGIW GMIGGT MQ  IL+WV +RTDW KEVE A+ RL++W+A +  EPLL 
Sbjct  391  KGIWAGMIGGTCMQTAILVWVTLRTDWNKEVEEAQNRLHKWEANKTTEPLLA  442



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GMIGGT+MQ IILLWV  RTDW KEV  A  RL +WD ++E
Sbjct  461  KGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEKWDDRQE  506



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKE-----VEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT++Q +ILLWV  RTDW KE     VE AK RL++W+ KR+P L
Sbjct  465  KGIWSGMIGGTLLQTLILLWVTFRTDWRKEMFQFQVEKAKSRLHKWEDKRKPSL  518



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR  334
            KGIW GMIGGT++Q +IL WV  RTDWVKEVE A KRL+ W  K+
Sbjct  455  KGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDIWSNKK  499



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT +Q +IL+WV  R DW KEVE AK RL++W+ K++PLL
Sbjct  347  KGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  395



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GM+GGT +Q ++LLW   RT+W KEVE A+ RL+ WD  +EPLL
Sbjct  463  KGIWTGMLGGTAVQTLVLLWATFRTNWDKEVEKAQSRLDTWDDVKEPLL  511



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 4/53 (8%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWD----AKREPLL  322
            +GIW GMIGGT MQ IILLWV  RTDW+KEV  ++ RL +WD     +++PLL
Sbjct  458  QGIWSGMIGGTFMQTIILLWVTFRTDWIKEVGTSRDRLEKWDDSNKQQQQPLL  510



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKRE  331
            KGIW GM+GGT +Q IIL+WV   TDW KEVE + KRLN+WD K+E
Sbjct  446  KGIWLGMMGGTCIQTIILIWVTFGTDWNKEVEESMKRLNKWDDKQE  491



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  465  GIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            GIW GMIGGT+MQ IILL V  RTDW KEVE A +RL+QW+  + PLL +
Sbjct  458  GIWTGMIGGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  507



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGGT +Q +IL+WV  R DW KEVE AK RL++W+ K++PLL
Sbjct  372  KGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  420



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLL  322
            KGIW GMIGG V++ +ILLWV  RTDW KEV+ A KRL  W+ K+EPL+
Sbjct  352  KGIWSGMIGGVVLRTVILLWVTCRTDWNKEVQEALKRLETWEGKKEPLV  400



>ref|XP_009110708.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=504

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMI GT+MQ IILL V  RTDW KEVE A +RL+QW+  + PLL +
Sbjct  454  KGIWTGMIAGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  504



>emb|CDY64933.1| BnaCnng45550D [Brassica napus]
Length=505

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            KGIW GMI GT+MQ IILL V  RTDW KEVE A +RL+QW+  + PLL +
Sbjct  455  KGIWTGMIAGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  505



>ref|XP_009135444.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=497

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKR  334
            KGIW GMIGGT+MQ +ILL+V  RTDW KEVE A KRL+ WD K+
Sbjct  453  KGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKANKRLDMWDDKK  497



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  468  KGIWCGMIGGTVMQPIILLWVPIRTDWVKEVEVAKKRLNQWDAKREPLLPK  316
            +GIW GMIGGT+MQ IIL+ V  RTDWVKEVE A +RL+QW+    PLL +
Sbjct  170  RGIWTGMIGGTLMQTIILVIVTFRTDWVKEVEKASRRLDQWE-DTSPLLKQ  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556930065965